Compare commits

..

200 Commits

Author SHA1 Message Date
Carl Worth
623e68fb1b docs: Add release notes for 10.2.2 release
Which is ready to go.
2014-06-24 21:30:02 -07:00
Carl Worth
a9750ff7b5 Update VERSION to 10.2.2
In preparation for the 10.2.2 release.
2014-06-24 21:26:25 -07:00
Ville Syrjälä
274be620a8 i915: Fix gen2 texblend setup
Fix an off by one in the texture unit walk during texblend
setup on gen2. This caused the last enabled texunit to be
skipped resulting in totally messed up texturing.

This is a regression introduced here:
 commit 1ad443ecdd
 Author: Eric Anholt <eric@anholt.net>
 Date:   Wed Apr 23 15:35:27 2014 -0700

    i915: Redo texture unit walking on i830.

Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Ville Syrjälä <ville.syrjala@linux.intel.com>
(cherry picked from commit ca55a1aaa7)
2014-06-23 15:04:35 -07:00
Kenneth Graunke
5751b661ad i965: Save meta stencil blit programs in the context.
When the last context in a share group is destroyed, the hash table
containing all of the shader programs (ctx->Shared->ShaderObjects) is
destroyed, throwing away all of the shader programs.

Using a static variable to store program IDs ends up holding on to them
after this, so we think we still have a compiled program, when it
actually got destroyed.  _mesa_UseProgram then hits GL errors, since no
program by that ID exists.

Instead, store the program IDs in the context, so we know to recompile
if our context gets destroyed and the application creates another one.

Fixes es3conform tests when run without -minfmt (where it creates
separate contexts for testing each visual).

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=77865
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Eric Anholt <eric@anholt.net>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit a20994d616)

Conflicts:
	src/mesa/drivers/dri/i965/brw_meta_stencil_blit.c
2014-06-23 15:04:11 -07:00
Daniel Manjarres
282ca8ba98 glx: Don't crash on swap event for a Window (non-GLXWindow)
Prior to GLX 1.3 there was the glxMakeCurrent() function that took a
single drawable handle. The Drawable could be either a bare XID for a
Window or an XID for a glxpixmap.

GLX 1.3 added glxMakeContextCurrent that takes 2 handles: one for
reading, one for writing. Nowadays the old glxMakeCurrent call is
implemented as a call to glxMakeContextCurrent with the single handle
duplicated.

Because of this it is allowed to use a plain-old Window ID as an
argument to glxMakeContextCurrent, although nobody really documents this
sort of thing. The manpage for the NEW call specifies the arguments as
GLXPixmaps, but the actual code accepts Window XIDs too, and handles
them correctly.

Similarly, the glxSelectEvents function can also take a bare Window XID.

The "piglit" tests all use GLXWindows and/or GLXPixmaps. You never
tested swap events with a bare Window XID. That is what my app was
doing.

The swap_events code worked with Window XIDs in mesa 7.x.y. The new code
added in versions 8, 9, and 10 assumes that all buffer swap events have
a GLXPixmap associated with them. Because of the historical quirks
above, this is not true. Swap events for bare Window XIDs do NOT have a
glxpixmap resulting in a segfault.

Any app that uses the old school glxMakeCurrent call with a Window XID
while trying to use swap_events will crash when the libs try to lookup
the nonexistent GLXPixmap associated with the incoming swap event.

I believe that the people who wrote the spec overlooked this, because
the "sbc" field comes from the OML_sync extension that is defined in
terms of glxpixmaps only.

v2 (idr): Formatting changes.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=54372
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Acked-by: Jesse Barnes <jbarnes@virtuousgeek.org>
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 86bd2196b4)
2014-06-23 15:01:16 -07:00
Iago Toral Quiroga
c50fa76c7e mesa: Copy Geom.UsesEndPrimitive when cloning a geometry program.
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 96a95f48ea)
2014-06-23 15:01:06 -07:00
Tom Stellard
ad9264366a clover: Don't use llvm's global context
An LLVMContext should only be accessed by a single and using the global
context was causing crashes in multi-threaded environments.  Now we use
a separate context for each compile.

Reviewed-by: Francisco Jerez <currojerez@riseup.net>

CC: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 4aa128a123)
2014-06-23 15:00:49 -07:00
Tom Stellard
855adad132 clover: Prevent Clang from printing number of errors and warnings to stderr.
https://bugs.freedesktop.org/show_bug.cgi?id=78581

CC: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 0cc391f013)
2014-06-23 15:00:37 -07:00
Ilia Mirkin
3568cf8128 nv30: hack to avoid errors on unexpected color/zeta combinations
This is just a hack, it should be possible to create a temporary zeta
surface and render to that instead. However that's more complicated and
this avoids the render being entirely broken and errors being reported
by the card.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 25182e249e)
2014-06-23 15:00:14 -07:00
Ilia Mirkin
aca2d98c35 nv30: avoid dangling references to deleted contexts
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit c092c46b27)
2014-06-23 15:00:00 -07:00
Ilia Mirkin
08317fa9c4 nv30: plug some memory leaks on screen destroy and shader compile
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 5af80f6268)
2014-06-23 14:59:47 -07:00
Ian Romanick
4d0c445af6 meta: Respect the driver's maximum number of draw buffers
Commit c1c1cf5f9 added infrastructure for saving and restoring draw
buffer state.  However, it universially used MAX_DRAW_BUFFERS, but many
drivers support far fewer than that at limit.  For example, the radeon
and i915 drivers only support 1.  Using MAX_DRAW_BUFFERS causes meta to
generate GL errors.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=80115
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
Tested-by: Kenneth Graunke <kenneth@whitecape.org> [on Broadwell]
Tested-by: jpsinthemix@verizon.net
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit cc219d1d65)
2014-06-23 14:59:28 -07:00
Kristian Høgsberg
9ad103d664 mesa: Remove glClear optimization based on drawable size
A drawable size of 0x0 means that we don't have buffers for a drawable yet,
not that we have a zero-sized buffer.  Core mesa shouldn't be optimizing out
drawing based on buffer size, since the draw call could be what triggers
the driver to go and get buffers.  As discussed in the referenced bug report,
the optimization was added as part of a scatter-shot attempt to fix a
different problem.  There's no other example in mesa core of using the
buffer size in this way.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=74005
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Kristian Høgsberg <krh@bitplanet.net>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
(cherry picked from commit 7928b946ad)
2014-06-23 14:59:06 -07:00
Grigori Goronzy
12fcbcde47 radeon/uvd: disable VC-1 simple/main on UVD 2.x
It's about as broken as on later UVD revisions.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=66452
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>

Reviewed-by: Christian König <christian.koenig@amd.com>
(cherry picked from commit 6cd30f5d73)
2014-06-23 14:58:46 -07:00
Ilia Mirkin
d8e3158a43 nv50: make sure to mark first scissor dirty after blit
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit af05270ccf)
2014-06-23 14:58:33 -07:00
Kenneth Graunke
ef5f998b76 i965: Use 8x4 aligned rectangles for HiZ operations on Broadwell.
Like on Haswell, we need to use 8x4 aligned rectangle primitives for
hierarchical depth buffer resolves and depth clears.  See the comments
in brw_blorp.cpp's brw_hiz_op_params() constructor.  (The Broadwell
documentation confirms that this is still necessary.)

This patch makes the Broadwell code follow the same behavior as Chad and
Jordan's Gen7 BLORP code.  Based on a patch by Topi Pohjolainen.

This fixes es3conform's framebuffer_blit_functionality_scissor_blit
test, with no Piglit regressions.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Jordan Justen <jordan.l.justen@intel.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 49659ad90c)
2014-06-23 14:58:22 -07:00
Kenneth Graunke
31dd2a6f18 i965/vec4: Use the sampler for pull constant loads on Broadwell.
We've used the LD sampler message for pull constant loads on earlier
hardware for some time, and also were already using it for the FS on
Broadwell.  This patch makes us use it for Broadwell VS/GS as well.

I believe that when I wrote this code in 2012, we still used the data
port in some cases, and I somehow neglected to convert it while
rebasing.

Improves performance in GLBenchmark 2.7 Egypt by 416.978% +/- 2.25821%
(n = 17).  Many other applications should benefit similarly: this speeds
up uniform array access in the VS, which is commonly used for skinning
shaders, among other things.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Reviewed-by: Jordan Justen <jordan.l.justen@intel.com>
Tested-by: Ben Widawsky <ben@bwidawsk.net>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 5d8e246ac8)
2014-06-23 14:57:56 -07:00
Kenneth Graunke
c07485eab1 i965: Add missing newlines to a few perf_debug messages.
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 847abaccc0)
2014-06-23 14:57:27 -07:00
Kenneth Graunke
3b941857ee i965: Drop Broadwell perf_debugs about missing MOCS that aren't missing.
I actually added MOCS support for these things, but forgot to delete the
corresponding perf_debug() warnings.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit d053a05ef3)
2014-06-23 14:56:50 -07:00
Kenneth Graunke
6b753df1f4 i965: Add missing MOCS setup for 3DSTATE_INDEX_BUFFER on Broadwell.
Somehow I missed this when adding all of the other MOCS values.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 7f256c1c70)
2014-06-23 14:56:31 -07:00
Kenneth Graunke
01a79ac679 i965/vec4: Fix dead code elimination for VGRFs of size > 1.
When faced with code such as:

    mov vgrf31.0:UD, 960D
    mov vgrf31.1:UD, vgrf30.xxxx:UD

The dead code eliminator didn't consider reg_offsets, so it decided that
the second instruction was writing was writing to the same register as
the first one, and eliminated the first one.  But they're actually
different registers.

This fixes INTEL_DEBUG=shader_time for vertex shaders.  In the above
code, vgrf31.0 represents the offset into the shader_time buffer where
the data should be written, and vgrf31.1 represents the actual time
data.  With a completely undefined offset, results were...unexpected.

I think this is probably one of the few cases (maybe only case) where we
generate multiple MOVs to a large VGRF.  Normally, we just use them as
texturing results; the other SEND-from-GRF uses a size 1 VGRF.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=79029
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Cc: mesa-stable@lists.freedesktop.org
(cherry picked from commit d0575d98fc)
2014-06-23 14:56:11 -07:00
Jason Ekstrand
83be6a5517 meta_blit: properly compute texture width for the CopyTexSubImage fallback
Cc: "10.2" <mesa-stable@lists.freedesktop.org>

Reviewed-by: Brian Paul <brianp@vmware.com>
Reviewed-by: Matt Turner <mattst88@gmail.com>
(cherry picked from commit ffe609cc69)
2014-06-23 14:55:48 -07:00
Emil Velikov
348125e7f7 configure: correctly autodetect xvmc/vdpau/omx
Commit e62b7d38a1 (configure: autodetect video state-trackers
when non swrast driver is present) added a check that caused
the autodetection to be omitted when we have the swrast gallium
driver. Whereas it should have skipped the VL targets when only
swrast was selected.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=79907
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Christian König <christian.koenig@amd.com>
(cherry picked from commit 816d392b58)
2014-06-23 11:47:24 -07:00
Neil Roberts
126600c918 i965: Set the fast clear color value for texture surfaces
When a multisampled texture is used for sampling the fast clear color value
needs to be programmed into the surface state. This was being left as all
zeroes so if the surface was cleared to a value other than black then it
wouldn't work properly. This doesn't matter for single-sample textures because
in that case the MCS buffer is resolved before it is used as a texture source.

https://bugs.freedesktop.org/show_bug.cgi?id=79729

Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 765efeef88)
2014-06-23 11:47:04 -07:00
Kenneth Graunke
ee2035a95f i965: Invalidate live intervals when inserting Gen4 SEND workarounds.
We need to invalidate the live intervals when inserting new
instructions.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Cc: mesa-stable@lists.freedesktop.org
(cherry picked from commit 237aac39b1)
2014-06-23 11:46:43 -07:00
Kenneth Graunke
07a6f8bcab i965: Don't use the head sentinel as an fs_inst in Gen4 workaround code.
When walking backwards, we want to stop at the head sentinel, which is
where scan_inst->prev->prev == NULL, not scan_inst->prev == NULL.

Fixes random crashes, as well as valgrind errors.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Cc: mesa-stable@lists.freedesktop.org
(cherry picked from commit ecc78eab11)
2014-06-23 11:46:17 -07:00
Michel Dänzer
1d46c58b83 configure: Only check for OpenCL without LLVM when the latter is certain
LLVM is enabled by default for some architectures, but the test was failing
before that.

Signed-off-by: Michel Dänzer <michel.daenzer@amd.com>
Reviewed-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Tom Stellard <thomas.stellard@amd.com>

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 2d399bb183)
2014-06-23 11:45:48 -07:00
Adrian Negreanu
f7fd6e52ec android, dricore: undefined reference to _mesa_streaming_load_memcpy
_mesa_streaming_load_memcpy is defined in main/streaming-load-memcpy.c
I'm adding it to the dricore lib

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Adrian Negreanu <adrian.m.negreanu@intel.com>
Reviewed-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Juha-Pekka Heikkila <juhapekka.heikkila@gmail.com>
(cherry picked from commit 357a8b6f33)
2014-06-23 11:43:11 -07:00
Adrian Negreanu
a46fa0f9de android, mesa_gen_matypes: pull in timespec POSIX definition
This fixes:
  include/c11/threads_posix.h: In function 'cnd_timedwait':
  include/c11/threads_posix.h:140:21: error: storage size of 'abs_time' isn't known

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Adrian Negreanu <adrian.m.negreanu@intel.com>
Reviewed-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Juha-Pekka Heikkila <juhapekka.heikkila@gmail.com>
(cherry picked from commit 6eb3888c86)
2014-06-23 11:43:02 -07:00
Adrian Negreanu
f4a19c1e2c android, egl: typo dri2_fallback_pixmap_surface -> dri2_fallback_create_pixmap_surface
I used commit bc8b07a6 as reference, and only the droid_display_vtbl had this issue.

This fixes:
src/egl/drivers/dri2/platform_android.c:641:29:
  error: 'dri2_fallback_pixmap_surface' undeclared here (not in a function)

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Adrian Negreanu <adrian.m.negreanu@intel.com>
Reviewed-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Juha-Pekka Heikkila <juhapekka.heikkila@gmail.com>
(cherry picked from commit 6980cae6ae)
2014-06-23 11:42:53 -07:00
Adrian Negreanu
bed18b082a android, egl: add correct drm include for libmesa_egl_dri2
Fixes:
  src/egl/drivers/dri2/platform_android.c:38:
  include/GL/internal/dri_interface.h:51:17:
    fatal error: drm.h: No such file or directory

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Adrian Negreanu <adrian.m.negreanu@intel.com>
Reviewed-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Juha-Pekka Heikkila <juhapekka.heikkila@gmail.com>
(cherry picked from commit 4dc5545eff)
2014-06-23 11:42:42 -07:00
Adrian Negreanu
43752c3c37 android: add src/gallium/auxiliary as include path for libmesa_dricore
This fixes:
In file included from
/home/adrian/workspace/mesa/mesa-master.git/src/mesa/vbo/vbo_exec_api.c:445:0:
/home/adrian/workspace/mesa/mesa-master.git/src/mesa/vbo/vbo_attrib_tmp.h:28:38:
fatal error: util/u_format_r11g11b10f.h: No such file or directory

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Adrian Negreanu <adrian.m.negreanu@intel.com>
Reviewed-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Juha-Pekka Heikkila <juhapekka.heikkila@gmail.com>
(cherry picked from commit 0048483f73)
2014-06-23 11:40:25 -07:00
Adrian Negreanu
aa03f78fc8 android: add libloader to libGLES_mesa and libmesa_egl_dri2
This fixes
  src/egl/drivers/dri2/platform_android.c:664: error: undefined reference to 'loader_set_logger'
  src/egl/drivers/dri2/platform_android.c:678: error: undefined reference to 'loader_get_driver_for_fd'

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Adrian Negreanu <adrian.m.negreanu@intel.com>
Reviewed-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Juha-Pekka Heikkila <juhapekka.heikkila@gmail.com>
(cherry picked from commit a49ebfab1d)
2014-06-23 11:40:14 -07:00
Adrian Negreanu
6194593661 android: adapt to the megadriver mechanism
Fixes linker error:
  ld:
  .../libmesa_dri_common_intermediates/libmesa_dri_common.a(dri_util.o):
    in function globalDriverAPI:dri_util.c(.data.rel+0x0): error:
    undefined reference to 'driDriverAPI'

As an example, you can see that mesa_dri_drivers
also uses common/libmegadriver_stub (src/mesa/drivers/dri/Makefile.am)

The _stub part might be confusing, but
it actually provides the dri-driver shared lib constructor,
megadriver_stub_init, which will later on load the real
platform dependent part and call
l __driDriverGetExtensions_<platform>

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Adrian Negreanu <adrian.m.negreanu@intel.com>
Reviewed-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Juha-Pekka Heikkila <juhapekka.heikkila@gmail.com>
(cherry picked from commit aba0f152be)
2014-06-23 11:39:59 -07:00
Adrian Negreanu
7654120e86 add megadriver_stub_FILES
So that android part can also use $(megadriver_stub_FILES)

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Adrian Negreanu <adrian.m.negreanu@intel.com>
Reviewed-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Juha-Pekka Heikkila <juhapekka.heikkila@gmail.com>
(cherry picked from commit eb3f80dbba)
2014-06-23 11:39:43 -07:00
Emil Velikov
d6d80b44c4 configure: error out when building opencl without LLVM
Cc: Tom Stellard <thomas.stellard@amd.com>
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Tom Stellard <thomas.stellard@amd.com>
(cherry picked from commit 93257a56b5)
2014-06-23 11:39:28 -07:00
José Fonseca
a5d00e243c mesa/main: Prevent sefgault on glGetIntegerv(GL_ATOMIC_COUNTER_BUFFER_BINDING).
A recent ApiTrace change, that tries to dump more buffer state
causes Mesa from my distro (10.1.4) to segfaults here.

I haven't actually confirm this fixes it (I can't repro on master),
but it seems a good idea to be defensive here anyway.

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit eb58aa9cf0)
2014-06-23 11:39:15 -07:00
Ilia Mirkin
bfff355cef gk110/ir: fix bfind emission
There is a short-immediate version as well, but it should never end up
getting used since it would have gotten folded earlier.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit bd7dd3ed06)
2014-06-23 11:38:58 -07:00
Ilia Mirkin
1e1bdee5ec gk110/ir: fix emitting constbuf file index
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 7a67318794)
2014-06-23 11:38:38 -07:00
Ilia Mirkin
9e50fc3812 gk110/ir: emit saturate flag on fadd when needed
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 4a3a71a183)
2014-06-23 11:38:10 -07:00
Emil Velikov
8c319b3f98 targets/xa: limit the amount of exported symbols
In the presence of LLVM the final library exports every symbol from
the llvm namespace. Resolve this by using a version script (w/o the
version/name tag).

Considering that there are only ~35 symbols, explicitly list them
to minimize the chances of rogue symbols sneaking in.

v2: Conditionally include the version-script.

Reviewed-by: Thomas Hellstrom <thellstrom@vmware.com> (v1)
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
(cherry picked from commit a75baba2f1)
Signed-off-by: Andreas Boll <andreas.boll.dev@gmail.com>
2014-06-16 15:32:16 +02:00
Ian Romanick
70ce1031e7 docs: Add MD5 checksum, etc. for 10.2.1 release
Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2014-06-06 23:28:53 -07:00
Ian Romanick
8c4845d29b docs: Add initial 10.2.1 release notes
Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2014-06-06 23:20:00 -07:00
Ian Romanick
1b69ea1c6d Bump version to 10.2.1 2014-06-06 23:20:00 -07:00
Ian Romanick
c2fc9fb907 radeonsi: Fix build error introduced in 5ab9a9c
While resolving conflicts in cherry picking commit d226191, I
accidentally introduced some garbage.  Because radeonsi isn't built by
default, the problem went unnoticed by me.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
Reported-by: Laurent Carlier <lordheavym@gmail.com>
Tested-by: Laurent Carlier <lordheavym@gmail.com>
2014-06-06 23:19:53 -07:00
Ian Romanick
28d41e409d docs: Add MD5 checksum, etc. for 10.1 release
Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2014-06-06 21:17:02 -07:00
Ian Romanick
f836ef63fd Bump version to 10.2 (final)
Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2014-06-06 20:40:00 -07:00
Ilia Mirkin
99b9a0973a gk110/ir: fix slct emission
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 9fef8b3d81)
2014-06-06 20:40:00 -07:00
Ilia Mirkin
d36d53b564 gk110/ir: fix interp mode emission
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit d588a4919b)
2014-06-06 18:40:58 -07:00
Ilia Mirkin
283cd12933 nvc0: don't bother trying to set up compute for gk110+
The nouveau fw currently prints a bunch of errors. No point in seeing
those all the time, esp since compute doesn't really work in the first
place.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Ben Skeggs <bskeggs@redhat.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>

Conflicts:
	src/gallium/drivers/nouveau/nvc0/nvc0_screen.c
(cherry picked from commit ca65fc418f)
2014-06-06 18:40:21 -07:00
Ilia Mirkin
aa8ea648f4 gk110: add in forgotten code for gk110 isa
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Ben Skeggs <bskeggs@redhat.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>

Conflicts:
	src/gallium/drivers/nouveau/nvc0/nvc0_surface.c
(cherry picked from commit b9ec766bd0)
2014-06-06 18:37:07 -07:00
Ilia Mirkin
e901f40764 gk110/ir: fix ISAD emission with register args
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit ed1b9e5721)
2014-06-06 18:19:45 -07:00
Ilia Mirkin
d5e47ee66b gk110/ir: fix quadon opcode emission
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 6e046508a1)
2014-06-06 18:19:10 -07:00
Ilia Mirkin
932a5dadda gk110/ir: emit texbar the same way that the blob does
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Ben Skeggs <bskeggs@redhat.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 73eec47ef8)
2014-06-06 18:14:50 -07:00
Tobias Klausmann
203bc289a0 nv50/ir: clear subop when folding constant expressions
Some operations (e.g. OP_MUL/OP_MAD/OP_EXTBF) might have a subop set.
After folding, make sure that it is cleared

Signed-off-by: Tobias Klausmann <tobias.johannes.klausmann@mni.thm.de>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 3164bfc734)
2014-06-06 18:14:22 -07:00
Kenneth Graunke
11b3011805 i965: Support GL_CLAMP natively on Broadwell.
The new hardware actually supports this OpenGL 1.x feature natively,
so we can finally drop our shader workarounds.

Not many applications use GL_CLAMP, and most use it unintentionally, but
it's trivial to do right, so we should.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 221169693b)
2014-06-06 18:13:03 -07:00
Kenneth Graunke
c62bc58cce i965: Pass brw to translate_wrap_mode().
This lets us do generation checks.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 7f3d64a77b)
2014-06-06 18:12:20 -07:00
Kenneth Graunke
304e80e356 i965: Fix copy and pasted values in Broadwell code.
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 7913b4b97b)
2014-06-06 18:11:54 -07:00
Sinclair Yeh
f4aca6868a egl: Check for NULL native_window in eglCreateWindowSurface
We have customers using NULL as a way to test the robustness of the API.
Without this check, EGL will segfault trying to dereference
dri2_surf->wl_win->private because wl_win is NULL.

This fix adds a check and sets EGL_BAD_NATIVE_WINDOW

v2: Incorporated feedback from idr - moved the check to a higher level
function.

Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Chad Versace <chad.versace@linux.intel.com>
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 91ff0d4c65)
2014-06-06 18:11:30 -07:00
Marek Olšák
5ab9a9c0cc r600g,radeonsi: don't use hardware MSAA resolve if dst is fast-cleared
It doesn't work and our docs say so too.

Cc: mesa-stable@lists.freedesktop.org
Reviewed-by: Michel Dänzer <michel.daenzer@amd.com>
(cherry picked from commit d226191820)
2014-06-06 18:08:23 -07:00
Marek Olšák
ae16f443c2 r600g,radeonsi: disable fast clear if render condition is on
For some reason, CP DMA doesn't follow the predicate bit if I enable it,
so this is the only option.

This fixes piglit: spec/NV_conditional_render/clear

Cc: mesa-stable@lists.freedesktop.org
Reviewed-by: Michel Dänzer <michel.daenzer@amd.com>
(cherry picked from commit bf701a84eb)
2014-06-06 18:03:10 -07:00
José Fonseca
b8241bb3f2 mesa: Make glGetIntegerv(GL_*_ARRAY_SIZE) return GL_BGRA.
Same as b026b6bbfe, but
COLOR_ARRAY_SIZE/SECONDARY_COLOR_ARRAY_SIZE.

Ideally we wouldn't munge the incoming state, so that we wouldn't need
to unmunge it back on glGet*.  But the array size state is copied and
referred in many places, many of which couldn't take an GLenum like
GL_BGRA instead of a plain integer.  So just hack around on glGet*,
to ensure there is no risk of introducing regressions elsewhere.

This bug causes problems to Apitrace, resulting in wrong traces.  See
https://github.com/apitrace/apitrace/issues/261 for details.

Tested with piglit arb_vertex_array_bgra-get, which was created for this
purpose.

Reviewed-by: Matt Turner <mattst88@gmail.com>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit e3e13d6b85)
2014-06-06 17:54:32 -07:00
José Fonseca
224c193237 mesa/main: Make get_hash.c values constant.
Reviewed-by: Matt Turner <mattst88@gmail.com>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 53468dee03)
2014-06-06 17:35:45 -07:00
Beren Minor
494f916125 egl/main: Fix eglMakeCurrent when releasing context from current thread.
EGL 1.4 Specification says that
eglMakeCurrent(display, EGL_NO_SURFACE, EGL_NO_SURFACE, EGL_NO_CONTEXT)
can be used to release the current thread's ownership on the surfaces
and context.

MESA's egl implementation was only accepting the parameters when the
KHR_surfaceless_context extension is supported.

[chadv] Add quote from the EGL 1.4 spec.
Cc: "10,1, 10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Chad Versace <chad.versace@linux.intel.com>
(cherry picked from commit 0ca0d5743f)
2014-06-06 17:15:51 -07:00
Marek Olšák
767bc05309 Revert "glx: load dri driver with RTLD_LOCAL so dlclose never fails to unload"
This reverts commit e3cc0d90e1.

It breaks too many apps and completely breaks my desktop too.
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=79469

We'll probably need to re-release all stable versions after this is committed.

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 0d5ec2c615)
2014-06-06 17:13:03 -07:00
Roland Scheidegger
3aaae6056e llvmpipe: fix crash when not all attachments are populated in a fb
Framebuffers can have NULL attachments since a while. llvmpipe handled
that properly for lp_rast_shade_quads_mask but it seems the change didn't
make it to lp_rast_shade_tile.
This fixes piglit fbo-drawbuffers-none test (though I need to increase
the FB_SIZE from 32 to 256 so the tris cover some tiles fully).
https://bugs.freedesktop.org/show_bug.cgi?id=79421

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Jose Fonseca <jfonseca@vmware.com>
(cherry picked from commit 576868140b)
2014-06-06 17:06:55 -07:00
Ian Romanick
8b71741222 Bump version to 10.2-rc5
Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2014-05-30 17:11:47 -07:00
Lubomir Rintel
15ec4ef0da i915: add a missing NULL pointer check
mesaVisual can be NULL with configless context since this commit:

    commit 551d459af4
    Author: Neil Roberts <neil@linux.intel.com>
    Date:   Fri Mar 7 18:05:47 2014 +0000

    Add the EGL_MESA_configless_context extension
...
    Previously the i965 and i915 drivers were explicitly creating a zeroed visual
    whenever 0 is passed for the EGLConfig.

We attempt to dereference the visual in i915 and now we don't create a
zeroed-out one one it crashes, breaking at least weston in an i915. There's
no point in doing so as it would be zero anyway.

v2: Fixed a typo in commit message.  Added some tags.

Signed-off-by: Lubomir Rintel <lkundrak@v3.sk>
Bugzilla: https://bugzilla.redhat.com/show_bug.cgi?id=1100967
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
(cherry picked from commit 90b5747856)
2014-05-30 17:11:47 -07:00
Ian Romanick
9fde5670e2 glapi: Duplicate GLES1 prototypes in glapi_dispatch.c
These prototypes are necessary because GLES1 library builds will create
dispatch functions for them.  We can't directly include GLES/gl.h
because it would conflict the previously-included GL/gl.h.  Since GLES1
ABI is not expected to every add more functions, the path of least
resistance is to just duplicate the prototypes for the functions that
aren't already in desktop OpenGL.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=79294
Acked-by: Matt Turner <mattst88@gmail.com>
Tested-by: Andreas Boll <andreas.boll.dev@gmail.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 7b1aeec9cd)
2014-05-30 17:11:47 -07:00
Ilia Mirkin
76e112380a nvc0: revert mistaken logic to collapse color outputs to the beginning
In commit af38ef907, I added a "fix" to color outputs not being assigned
correctly when sample mask was being output. This was totally wrong --
the color indices (i.e. "si" values) were the ones that were wrong. Undo
that hunk.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Acked-by: Emil Velikov <emil.l.velikov@gmail.com>
(cherry picked from commit 0d699530ff)

Requested-by: Ilia Mirkin <imirkin@alum.mit.edu>
2014-05-30 17:11:15 -07:00
Ilia Mirkin
8ac81e5b66 mesa/st: fix color outputs in presence of sample mask output
Commit c5d822dad9 added support for sample mask incorrectly. It became
treated as a color output, and messed up the color output indices.
Revert the hunk that did that, and add explicit support just like for
depth/stencil writes.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Acked-by: Marek Olšák <marek.olsak@amd.com>
(cherry picked from commit ab7bd7093d)

Requested-by: Ilia Mirkin <imirkin@alum.mit.edu>
2014-05-30 17:11:15 -07:00
Rob Clark
6d23a0b2a6 configure: fix build error with XA
Fixes:

xa_tracker.c: In function 'xa_tracker_create':
 xa_tracker.c:147:5: error: implicit declaration of function 'pipe_loader_drm_probe_fd' [-Werror=implicit-function-declaration]

in some build configurations, as XA now implicitly depends on
gallium_drm_loader.

Signed-off-by: Rob Clark <robclark@freedesktop.org>
Reviewed-by: Jakob Bornecrantz <jakob@vmware.com>
(cherry picked from commit 20d14ef263)

Bugzilla: https://bugs.gentoo.org/show_bug.cgi?id=511700
Requested-by: Matt Turner <mattst88@gmail.com>
2014-05-30 17:11:15 -07:00
Pavel Popov
8f984928cc i965: Fix Line Stipple enable bit in 3DSTATE_SF for Haswell.
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Signed-off-by: Pavel Popov <pavel.e.popov@intel.com>
(cherry picked from commit d292d40207)
2014-05-30 17:11:15 -07:00
Jerome Glisse
7ab2363c11 glx: load dri driver with RTLD_LOCAL so dlclose never fails to unload
There is no reason anymore to load with RTLD_GLOBAL and for some driver
this even result in dlclose failing to unload leading to catastrophic
failure with swrast fallback.

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Eric Anholt <eric@anholt.net>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Signed-off-by: Jérôme Glisse <jglisse@redhat.com>
(cherry picked from commit e3cc0d90e1)
2014-05-29 15:48:53 -07:00
Brian Paul
55b9effa4a glsl: fix use-after free bug/crash in ast_declarator_list::hir()
The call to get_variable_being_redeclared() may delete 'var' so we
can't reference var->name afterward.  We fix that by examining the
var's name before making that call.

Fixes valgrind warnings and possible crash when running the piglit
tests/spec/glsl-1.30/execution/clipping/vs-clip-distance-in-param.shader_test
test (and probably others).

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>

Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
(cherry picked from commit f9cecca7a6)
2014-05-29 15:48:02 -07:00
Kenneth Graunke
5347fc5295 i965: Fix repeated usage of rectangle texture coordinate scaling.
Previously, we set up new entries in the params[] array on every access
of a rectangle texture.  Unfortunately, we only reserve space for
(2 * MaxTextureImageUnits) extra entries, so programs which accessed
rectangle textures more times than that would write off the end of the
array and likely crash.

We don't really have a decent mapping between the index returned by
_mesa_add_state_reference and our index into the params array, so we
have to manually search for it.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=78691
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Eric Anholt <eric@anholt.net>
Cc: mesa-stable@lists.freedesktop.org
(cherry picked from commit bb9623a1a8)
2014-05-29 15:47:29 -07:00
Topi Pohjolainen
e8e48889e6 meta/blit: Use gl_FragColor also in the msaa blit shader
Fixes framebuffer_blit_functionality_multisampled_to_singlesampled_blit
es3 cts test on bdw. Also fixes this on ivb when ivb is forced to use
the meta path.

No piglit regressions on IVB.

Further input from Ken:

 "Unfortunately, this doesn't fix MRT for integer data.

  In the single-sampled case, since we're directly copying data, we were
  read/copy/write data as "float" values, which actually contained the
  integer bits.  Here, we can't do that since we need to process the
  actual integer data.

  I do wonder if we could use intBitsToFloat/uintBitsToFloat to stuff the
  integer bits in the float gl_FragColor output.  Just a crazy idea.

  In the long term (post 10.2), I think we should draft an extension that
  allows you to do "layout(location = all)" on user-defined fragment
  shader outputs.  (Or some similar syntax.)"

Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Anuj Phogat <anuj.phogat@gmail.com>
(cherry picked from commit a6022e5405)
2014-05-29 15:46:26 -07:00
Topi Pohjolainen
af3d4eddc1 i965/meta: Store stencil texturing mode
Meta path needs to keep the current texture object's state. Fixes
the following gles3 cts tests on bdw:

framebuffer_blit_functionality_negative_width_blit.test: fail
framebuffer_blit_functionality_all_buffer_blit.test: fail
framebuffer_blit_functionality_negative_height_blit.test: fail
framebuffer_blit_functionality_missing_buffers_blit.test: fail
framebuffer_blit_functionality_negative_dimensions_blit.test: fail
framebuffer_blit_functionality_minifying_blit.test: fail
framebuffer_blit_functionality_magnifying_blit.test: fail

Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 57730d67f6)
2014-05-29 15:45:43 -07:00
Topi Pohjolainen
75ae4fff35 meta/blit: Add stencil texturing mode save and restore
v2 (Ken): Only restore the mode if it has changed.

Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit c246828c4d)
2014-05-29 15:44:45 -07:00
Matt Turner
c984e5bd2e Revert "i965: Don't make instructions with a null dest a barrier to scheduling."
This reverts commit 42a26cb5e4.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=78648
(cherry picked from commit 0d3f83f4ad)
2014-05-29 15:44:09 -07:00
Matt Turner
ca6b38b80a Revert "i965/fs: Simplify interference scan in register coalescing."
This reverts commit 5ff1e446d4.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=77704
(cherry picked from commit a39428cf5c)
2014-05-29 15:42:43 -07:00
Matt Turner
b814afeb6c Revert "i965/fs: Give up in interference check if we see a WHILE."
This reverts commit 55de1c035c.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit fc025a6719)
2014-05-29 15:41:53 -07:00
Matt Turner
17c7ead727 Revert "i965/fs: Reduce restrictions on interference in register coalescing."
This reverts commit f770123f58.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=78692
(cherry picked from commit ccb1ea8a15)
2014-05-29 15:40:55 -07:00
Emil Velikov
2a29dbdc6e glx: do not leak dri3Display
v2: Do not wrap the code in ifdef HAVE_DRI3 (suggested by Keith)

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Cc: Keith Packard <keithp@keithp.com>
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
(cherry picked from commit eb2241f8a9)
2014-05-29 15:40:09 -07:00
Matt Turner
03e93f6079 Revert "i965/fs: Change fs_visitor::emit_lrp to use MAC for gen<6"
This reverts commit a6860100b8.

Why this code didn't work in all circumstances is unknown and without a
working Ironlake simulator (which uses a different AUB format) we'll
probably never know, short of a lot of experimentation, and spending a
bunch of time to try to optimize a few instructions on Ironlake is not
time well spent.

Moreover, for mix(vec4, vec4, vec4) using the accumulator introduces a
dependence between the otherwise independent per-component calculations.
Not using the accumulator, even if it means an extra instruction per
component might be preferable. We don't know, we don't have data, and
we don't have the necessary register on Ironlake for shader_time to tell
us.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=77707
Acked-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit c2c639ecf6)
2014-05-29 15:17:53 -07:00
Matt Turner
bc4b9467af Revert "i965/vec4: Change vec4_visitor::emit_lrp to use MAC for gen<6"
This reverts commit 2dfbbeca50 with the
comment about MAC and implicit accumulator removed.

Why this code didn't work in all circumstances is unknown and without a
working Ironlake simulator (which uses a different AUB format) we'll
probably never know, short of a lot of experimentation, and spending a
bunch of time to try to optimize a few instructions on Ironlake is not
time well spent.

Moreover, for mix(vec4, vec4, vec4) using the accumulator introduces a
dependence between the otherwise independent per-component calculations.
Not using the accumulator, even if it means an extra instruction per
component might be preferable. We don't know, we don't have data, and
we don't have the necessary register on Ironlake for shader_time to tell
us.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=77703
Acked-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit db42dd8952)
2014-05-29 15:17:28 -07:00
Christoph Bumiller
7efdc55f5f nv50/ir/tgsi: optimize KIL
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit d479713d25)
2014-05-29 15:16:56 -07:00
Christoph Bumiller
9ea859931e nv50/ir: fix lowering of predicated instructions (without defs)
Note that predicated instructions with defs are still not supported
because transformation to SSA doesn't handle them yet.

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 452a4151aa)
2014-05-29 15:16:24 -07:00
Christoph Bumiller
4e5296208d nv50/ir/opt: fix constant folding with saturate modifier
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 3b0867f35b)
2014-05-29 15:16:03 -07:00
Christoph Bumiller
1ced952686 nv50/ir/tgsi: TGSI_OPCODE_POW replicates its result
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 2f2d1b3d9b)
2014-05-29 15:15:59 -07:00
Christoph Bumiller
afe723ce5f nv50,nvc0: set constbufs dirty on pipe context switch
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 49eccef06b)
2014-05-29 15:15:39 -07:00
Christoph Bumiller
8b74c2bdbd nv50: setup scissors on clear_render_target/depth_stencil
[imirkin: add logic to also clear the "regular" scissors]
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 200382be85)
2014-05-29 15:15:10 -07:00
Christoph Bumiller
4afbd9b0e2 nv50,nvc0: always pull out bufctx on context destruction
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 7d11b761f2)
2014-05-29 15:01:49 -07:00
Ian Romanick
697316fe06 Bump version to 10.2-rc4
Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2014-05-23 17:36:42 -07:00
Ian Romanick
bfaee5277a Merge remote-tracking branch 'robclark/freedreno-10.2' into 10.2 2014-05-23 17:21:59 -07:00
Pavel Popov
9a8f12ae03 i965: Properly return *RESET* status in glGetGraphicsResetStatusARB
The glGetGraphicsResetStatusARB from ARB_robustness extension always
returns GUILTY_CONTEXT_RESET_ARB and never returns NO_ERROR for guilty
context with LOSE_CONTEXT_ON_RESET_ARB strategy.  This is because Mesa
returns GUILTY_CONTEXT_RESET_ARB if batch_active !=0 whereas kernel
driver never reset batch_active and this variable always > 0 for guilty
context.  The same behaviour also can be observed for batch_pending and
INNOCENT_CONTEXT_RESET_ARB.

But ARB_robustness spec says:

  If a reset status other than NO_ERROR is returned and subsequent calls
  return NO_ERROR, the context reset was encountered and completed. If a
  reset status is repeatedly returned, the context may be in the process
  of resetting.

  8. How should the application react to a reset context event?
  RESOLVED: For this extension, the application is expected to query the
  reset status until NO_ERROR is returned. If a reset is encountered, at
  least one *RESET* status will be returned. Once NO_ERROR is
  encountered, the application can safely destroy the old context and
  create a new one.

The main problem is the context may be in the process of resetting and
in this case a reset status should be repeatedly returned.  But looks
like the kernel driver returns nonzero active/pending only if the
context reset has already been encountered and completed.  For this
reason the *RESET* status cannot be repeatedly returned and should be
returned only once.

The reset_count and brw->reset_count variables can be used to control
that glGetGraphicsResetStatusARB returns *RESET* status only once for
each context.  Note the i915 triggers reset_count twice which allows to
return correct reset count immediately after active/pending have been
incremented.

v2 (idr): Trivial reformatting of comments.

Signed-off-by: Pavel Popov <pavel.e.popov@intel.com>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 8dc4a98c44)
2014-05-23 09:57:18 -07:00
Emil Velikov
a31062fcb3 targets/egl-static: add missing line break in ldflags
Accidently omitted by commit 7b7944ee1c.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Jon TURNEY <jon.turney@dronecode.org.uk>
(cherry picked from commit e0372239a5)
2014-05-23 09:57:15 -07:00
James Legg
a1fff38c96 mesa: Fix unbinding GL_DEPTH_STENCIL_ATTACHMENT
glFramebufferRender(..., GL_DEPTH_STENCIL_ATTACHMENT, ..., 0) only
detached the depth buffer and not the stencil buffer.

Bugzilla: http://bugs.freedesktop.org/show_bug.cgi?id=79115
Reviewed-by: Brian Paul <brianp@vmware.com>
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 846c715abb)
2014-05-23 09:56:26 -07:00
Jordan Justen
1db3ebd8a5 meta blit: Set Z texcoord during meta blit to sample the correct layer
If the source renderbuffer has a depth > 0, then send a Z texcoord
which is set to the source attachment Z offset.

This fixes piglit's gl-3.2-layered-rendering-gl-layer-render with the
GL_TEXTURE_2D_MULTISAMPLE_ARRAY case test on i965/gen8.

Signed-off-by: Jordan Justen <jordan.l.justen@intel.com>
Reviewed-by: Anuj Phogat <anuj.phogat@gmail.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 57876fee38)
2014-05-23 09:55:23 -07:00
Kenneth Graunke
7cf3a674ea i965: Listen to BRW_NEW_FRAGMENT_PROGRAM for 3DSTATE_PS_BLEND.
brw_color_buffer_write_enabled depends on brw->fragment_program, which
means we have to listen to BRW_NEW_FRAGMENT_PROGRAM.

On most generations, this was only called from a function that already
subscribed.  However, on Broadwell, we failed to listen to the necessary
event in the atom that emits 3DSTATE_PS_BLEND.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Reviewed-by: Eric Anholt <eric@anholt.net>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 746921cbb4)
2014-05-23 09:54:41 -07:00
Kenneth Graunke
d2521a44af i965: Use WE_all for FB write header setup on Broadwell.
I forgot to disable writemasking on the OR and MOV which set the render
target index and "source 0 alpha present to render target" bit.

Using get_element_ud is equivalent and avoids a line-wrap.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Reviewed-by: Eric Anholt <eric@anholt.net>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 7d3985ca6c)
2014-05-23 09:54:15 -07:00
Anuj Phogat
00f2dcb791 meta: Use gl_FragColor to output color values to all the draw buffers
_mesa_meta_setup_blit_shader() currently generates a fragment shader
which, irrespective of the number of draw buffers, writes the color
to only one 'out' variable. Current shader rely on an undefined
behavior and possibly works by chance.

From OpenGL 4.0  spec, page 256:
  "If a fragment shader writes to gl_FragColor, DrawBuffers specifies a
   set of draw buffers into which the single fragment color defined by
   gl_FragColor is written. If a fragment shader writes to gl_FragData,
   or a user-defined varying out variable, DrawBuffers specifies a set
   of draw buffers into which each of the multiple output colors defined
   by these variables are separately written. If a fragment shader writes
   to none of gl_FragColor, gl_FragData, nor any user defined varying out
   variables, the values of the fragment colors following shader execution
   are undefined, and may differ for each fragment color."

OpenGL 4.4 spec, page 463, added an additional line in this section:
  "If some, but not all user-defined output variables are written, the
   values of fragment colors corresponding to unwritten variables are
   similarly undefined."

V2: Write color output to gl_FragColor instead of writing to multiple
    'out' variables. This'll avoid recompiling the shader every time
    draw buffers count is updated.

Cc: <mesa-stable@lists.freedesktop.org>
Signed-off-by: Anuj Phogat <anuj.phogat@gmail.com>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 46737cebd3)
2014-05-23 09:53:42 -07:00
Anuj Phogat
ed1ffa0197 meta: Refactor _mesa_meta_setup_blit_shader() to avoid duplicate shader code
Cc: <mesa-stable@lists.freedesktop.org>
Signed-off-by: Anuj Phogat <anuj.phogat@gmail.com>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit bee2915210)
2014-05-23 09:52:29 -07:00
Ilia Mirkin
5d056f51ab tgsi: add GS_INVOCATIONS to property names array
In commit 4be146b1, I neglected to add the new property to the strings
array. This leads to the string '(null)' to be printed instead when
converting a GS shader to text.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Roland Scheidegger <sroland@vmware.com>
(cherry picked from commit cdeb7004e0)
2014-05-23 09:51:49 -07:00
Ilia Mirkin
6be7789e11 nv50,nvc0: fix 3d blits with mipmap levels
Make sure to normalize the z coordinates as well as the x/y ones when
there are mipmaps present. Fixes 3d mipmap generation, which now uses
the blit path.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Ben Skeggs <bskeggs@redhat.com>
(cherry picked from commit 28360fcad7)
2014-05-23 09:51:26 -07:00
Ilia Mirkin
d6a4c3c29c nv50/ir: fix constant folding for OP_MUL subop HIGH
These instructions can come in either through IMUL_HI/UMUL_HI TGSI
opcodes, or from OP_DIV constant folding.

Also make sure that the constant foldings which delete the original
instruction still get counted as having done something.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Ben Skeggs <bskeggs@redhat.com>
(cherry picked from commit d2a3de19c6)
2014-05-23 09:51:06 -07:00
Ilia Mirkin
9028b94670 nv50/ir: fix s32 x s32 -> high s32 multiply logic
Retrieving the high 32 bits of a signed multiply is rather annoying. It
appears that the simplest way to do this is to compute the absolute
value of the arguments, and perform a u32 x u32 -> u64 operation. If the
arguments' signs differ, then negate the result. Since there is no u64
support in the cvt instruction, we have the perform the 2's complement
negation "by hand".

This logic can come into use by the IMUL_HI instruction (very unlikely
to be seen), as well as from constant folding of division by a constant.
Fixes dolphin's divisions by 255.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Ben Skeggs <bskeggs@redhat.com>
(cherry picked from commit d3a5cf052c)
2014-05-23 09:50:26 -07:00
Kenneth Graunke
085d6bd5e7 meta: Avoid _swrast_BlitFramebuffer in the meta CopyTexSubImage code.
This is a replacement for bd44ac8b5c
that should actually work.

Fixes Piglit's copyteximage-border on swrast, as well as one of
es3conform's packed_pixels_pixelstore test.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=78546
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=77705
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 2ecc7268ba)
2014-05-23 09:49:28 -07:00
Kenneth Graunke
fd0ea5be9d meta: Split _swrast_BlitFramebuffer out of the meta blit path.
Separating the software fallbacks from the rest of the meta path (which
is usually hardware accelerated) gives callers better control over their
blitting options.

For example, i965 might want to try meta blit, hardware blits, then
swrast as a last resort.  Splitting it makes that possible.

This updates all callers to maintain the existing behavior (even in the
few cases where it isn't desirable behavior - later patches can change
that).

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 54540ea691)
2014-05-23 09:48:13 -07:00
Kenneth Graunke
27d4836f35 meta: Drop unnecessary early returns in _mesa_meta_BlitFramebuffer.
These aren't necessary - all of the following code is predicated on mask
being non-zero, so no code will get executed anyway.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Courtney Goeltzenleuchter <courtney@lunarg.com>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit d89ce333cc)
2014-05-23 09:47:37 -07:00
Kenneth Graunke
e306ba9a9b Revert "i965: Don't _swrast_BlitFramebuffer when doing CopyTexSubImage."
This reverts commit bd44ac8b5c.

Fixes:
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=78842
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=78843

Re-breaks:
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=77705
but that will be fixed properly in a few commits.

Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 2fa3796bc1)
2014-05-23 09:46:57 -07:00
Topi Pohjolainen
81fb9ef112 i965/fbo: Only try stencil meta blits on gen >= 8
I don't have an ILK at hand but the fix should be trivial.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=78872
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Reviewed-and-tested-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 21dddb22c1)
2014-05-23 09:46:28 -07:00
Kenneth Graunke
32549f3f17 mesa: Disable GL_EXT_framebuffer_multisample_blit_scaled on Broadwell.
It's not properly implemented in the meta code, and we don't have time
to fix it for 10.2.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Eric Anholt <eric@anholt.net>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 0b96d362bf)
2014-05-23 09:45:52 -07:00
Ilia Mirkin
9576e17804 nv50/ir: fix integer mul lowering for u32 x u32 -> high u32
UNION appears to expect that all of its sources are conditionally
defined. Otherwise it inserts an unpredicated mov instruction which
overwrites the desired result. This fixes tests that use UMUL_HI, and
much less directly, unsigned integer division by a constant, which uses
this functionality in a peephole pass.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Ben Skeggs <bskeggs@redhat.com>
(cherry picked from commit 5b8f1a0f7c)
2014-05-23 09:45:13 -07:00
Ilia Mirkin
cc65bc4d15 nv50/ir: make sure that texprep/texquerylod's args get coalesced
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Ben Skeggs <bskeggs@redhat.com>
(cherry picked from commit 4ebaabcccb)
2014-05-23 09:40:26 -07:00
Jeremy Huddleston Sequoia
25e641213f darwin: Fix test for kCGLPFAOpenGLProfile support at runtime
Signed-off-by: Jeremy Huddleston Sequoia <jeremyhu@apple.com>
(cherry picked from commit 7a109268ab)
2014-05-20 10:55:12 -07:00
Rob Clark
e084f71548 freedreno: don't advertise texture arrays for now
I think a3xx and later should support (it is part of GLES3), but this
isn't needed for the time being and still needs to be reversed.

Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 10:55:54 -04:00
Rob Clark
cdd328639f freedreno/a3xx: shadow sampler support
Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:48:49 -04:00
Rob Clark
6440561737 freedreno/a3xx/compiler: refactor trans_samp()
Split it up into some smaller fxns so it doesn't grow into a huge
monster as we add things.

Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:48:49 -04:00
Rob Clark
fb4461b7dc freedreno: update generated headers
Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:48:20 -04:00
Rob Clark
fec2b45d02 freedreno/a3xx: use util_format_compose_swizzles()
Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:48:20 -04:00
Rob Clark
d0c813c40a freedreno/a3xx/compiler: 1D textures
Gallium already gives us height==1 for these, so the texture state is
already setup correctly to emulate 1D textures as a Nx1 2D texture.  We
just need to supply the .y coord.

Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:48:20 -04:00
Rob Clark
a05c073d79 freedreno: fix caps
In particular, we want mesa to emulate primitive restart for us.

Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:48:20 -04:00
Rob Clark
031ee21961 freedreno: fix index buffer offset
Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:48:20 -04:00
Rob Clark
b7604eff4c freedreno/a3xx: add sRBG texture support
That was easy.  Turns out it is just a matter of setting one bit.
Enable sampling from sRGB texture, and therefore enable GL 2.1 :-)

Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:48:20 -04:00
Rob Clark
80da86c650 freedreno: update generated headers
Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:48:20 -04:00
Rob Clark
3c0ca023dd freedreno/a3xx: fix write to bogus register
The loops for updating the multiple packed fields in SP_VS_OUT[] and
SP_VS_VPC_DST[] will zero out one register beyond the last that on
required.  Which is normally not a problem (and is kinda convenient
when looking at cmdstream dumps) unless we have maximum (16) varyings.

Fix loop termination condition so that this does not happen.

Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:47:20 -04:00
Rob Clark
516db26e1e freedreno/a3xx: account for special inputs/outputs
We need to size input/output tables big enough for special inputs/
outputs (gl_Position, gl_FrontFacing, etc) which, while they don't
count towards the hw limit of 16 attributes or 16 varyings, we do
still need to track them all the same.

Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:47:19 -04:00
Rob Clark
d5d9984c2b freedreno/a3xx: fix MAX_INPUTS shader cap
Hardware only supports 16.  Which fd3_shader_variant properly reflected,
but the pipe cap did not, leading to array overflow (and shaders that
could not possibly work).

Also a bunch of asserts to make problems like this easier to see.

Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:47:19 -04:00
Ryan Houdek
6db6f05fae freedreno/a3xx/compiler: add KILL_IF
The KILL_IF opcode could potentially be merged in to the regular KILL
opcode function.  It was a pain to do so, so I've left is separated
for cleanliness.

Signed-off-by: Ryan Houdek <Sonicadvance1@gmail.com>
Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:47:19 -04:00
Ryan Houdek
c338759051 freedreno/a3xx/compiler: start adding integer support
Adds a large sum of TGSI opcodes to the a3xx compiler.

For integer opcodes we have 28 opcodes added.
Adds 4 floating point compare opcodes

If GLSL 1.30 is enabled, this allows the GLSL 1.30 piglits to have a
completion amount of 432/641.

Signed-off-by: Ryan Houdek <Sonicadvance1@gmail.com>
Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:46:38 -04:00
Rob Clark
47a6830e22 freedreno/a3xx: occlusion query support
Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:46:38 -04:00
Rob Clark
3ffc507c94 freedreno: add support for hw queries
Real GPU queries need some infrastructure to track samples per tile and
accumulate the results.  But fortunately this can be shared across GPU
generation.

See:
https://github.com/freedreno/freedreno/wiki/Queries#hardware-queries

Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:46:38 -04:00
Rob Clark
c94e339adc freedreno/query: allow multiple query implementations
Split out fd_query into an abstract base class, to allow multiple
implementations.  The current sw based queries are moved into
fd_sw_query.

Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:45:50 -04:00
Rob Clark
a5951d09a5 freedreno/a3xx: add point-size
Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:45:50 -04:00
Rob Clark
3475ca1f00 freedreno: update generated headers
Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:45:50 -04:00
Rob Clark
3733cc3e8f freedreno/a2xx: fix compiler warning
Signed-off-by: Rob Clark <robclark@freedesktop.org>
2014-05-20 08:45:50 -04:00
Jeremy Huddleston Sequoia
ac49f97f12 glapi: Avoid heap corruption in _glapi_table
Signed-off-by: Jeremy Huddleston Sequoia <jeremyhu@apple.com>
Reviewed-by: Chia-I Wu <olv@lunarg.com>
(cherry picked from commit ff5456d1ac)
2014-05-20 01:39:17 -07:00
Ian Romanick
d0aa394741 Bump version to 10.2-rc3
Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2014-05-16 23:48:44 -07:00
Brian Paul
4baf6f12a5 mesa: fix double-freeing of dispatch tables inside glBegin/End.
We allocate dispatch tables for BeginEnd and OutsideBeginEnd.  But
when we destroy the context we were freeing the BeginEnd and Exec
tables.  If Exec==BeginEnd we did a double-free.  This would happen
if the context was destroyed while inside a glBegin/End pair.  Now
free the BeginEnd and OutsideBeginEnd pointers.

Cc: "10.1", "10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Michel Dänzer <michel.daenzer@amd.com>
(cherry picked from commit ef6b6658f9)
2014-05-16 23:46:34 -07:00
Michel Dänzer
21792665c7 glsl_to_tgsi: Make sure the 'shader' member is always initialized
Fixes the valgrind report below and random crashes with piglit on radeonsi.

==30005== Conditional jump or move depends on uninitialised value(s)
==30005==    at 0xB13584E: st_translate_program (st_glsl_to_tgsi.cpp:5100)
==30005==    by 0xB14698B: st_translate_fragment_program (st_program.c:747)
==30005==    by 0xB14777D: st_get_fp_variant (st_program.c:824)
==30005==    by 0xB11219C: get_color_fp_variant (st_cb_drawpixels.c:1042)
==30005==    by 0xB1131AE: st_DrawPixels (st_cb_drawpixels.c:1154)
==30005==    by 0xAFF8806: _mesa_DrawPixels (drawpix.c:162)
==30005==    by 0x4EB86DB: stub_glDrawPixels (generated_dispatch.c:6640)
==30005==    by 0x4F1DF08: piglit_visualize_image (piglit-util-gl.c:1574)
==30005==    by 0x40691D: draw_image_to_window_system_fb(int, bool) (draw-buffers-common.cpp:733)
==30005==    by 0x406C8B: draw_reference_image(bool, bool) (draw-buffers-common.cpp:854)
==30005==    by 0x40722A: piglit_display (alpha-to-coverage-dual-src-blend.cpp:117)
==30005==    by 0x4EA7168: run_test (piglit_fbo_framework.c:52)

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>

Reviewed-by: Brian Paul <brianp@vmware.com>
Reviewed-by: Roland Scheidegger <sroland@vmware.com>
(cherry picked from commit 2bab95973d)
2014-05-16 23:45:50 -07:00
Topi Pohjolainen
872ea423ac i965/fb: Use meta path for stencil up/downsampling
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
(cherry picked from commit d45fadf11a)
2014-05-16 23:45:24 -07:00
Topi Pohjolainen
ad8ad99eff i965/meta: Stencil blit for miptree updownsampling
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 475216a4f0)
2014-05-16 23:43:16 -07:00
Topi Pohjolainen
62f1509070 i965/fb: Use meta path for stencil blits
This is effective only on gen8 for now as previous generations still
go through blorp.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit b18f6b9b86)
2014-05-16 23:42:08 -07:00
Topi Pohjolainen
eb2ef1641c i965/meta: Stencil blits
v2: Create the intel renderbuffer with level hardcoded to zero instead
    of overriding it in the surface state configuration. Also moved the
    dimension adjustments for tiling, mip level, msaa into the render
    buffer creation. Finally prepares for another blit path needed for
    miptree updownsampling.
v3 (Ken): Dropped unnecessary memory context for "ralloc_asprintf()"

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
(cherry picked from commit d1829badf5)
2014-05-16 23:41:56 -07:00
Topi Pohjolainen
947b60d19e meta: Refactor state save/restore for framebuffer texture blits
Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
(cherry picked from commit 2a549c43a8)

Note: This patch was cherry picked so that the next patch would build.
2014-05-16 23:41:40 -07:00
Topi Pohjolainen
cb37016f89 i965: Extend brw_get_rb_for_first_slice() for specified level/layer
v2: Configure stencil directly for final dimensions instead of
    adjusting bit by bit for tiling, mip level and msaa.
v3 (Ken): Used non-static constant for horizontal alignment

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 9d752c098c)
2014-05-16 23:31:05 -07:00
Topi Pohjolainen
43ea5f9347 i965/gen8: Surface state overriding for stencil
v2: Allow hardware to offset accesses to individual layers. Also leave
    the mip-level overriding for the creator of the intel renderbuffer
    to handle. Merged with "i965/gen8: Allow stencil buffers to be
    configured as single sampled"

Ken: I left the "_mesa_problem()" still in place. I think it is clearer
     to remove it in a separate patch.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 36caae48b2)
2014-05-16 23:28:04 -07:00
Topi Pohjolainen
b5e717a618 i965/wm: Surface state overrides for configuring w-tiled as y-tiled
v2: Use intel_mipmap_tree::total_width in order to get correct alignment
    automatically. Also use "mt->total_height / mt->physical_depth0" as
    surface height allowing hardware to offset to correct slice.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 6aefaa4eb2)
2014-05-16 23:27:29 -07:00
Jordan Justen
f5848ec2e4 i965 meta up/downsample: Fix renderbuffer _BaseFormat
mt->format is of type mesa_format, and therefore can't be
used with _mesa_base_fbo_format which requires a GLenum input.

On gen8, this fixes various piglit fbo-depthstencil tests with
samples > 1.

Signed-off-by: Jordan Justen <jordan.l.justen@intel.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 103057b2b7)
2014-05-16 23:26:58 -07:00
Roland Scheidegger
79a34441d5 mesa/st: fix number of ubos being declared in a shader
Previously the code used the total number of ubos being declared in the
linked program (so the ubos of all shaders combined), use the number
from the particular shader instead.
This fixes an assertion failure with piglit arb_uniform_buffer_object-maxblocks
seen in llvmpipe since 8a9f5ecdb1 as it now emits
code for each declared buffer, not just the ones actually used.

CC: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Brian Paul <brianp@vmware.com>
(cherry picked from commit 3e817e7e56)
2014-05-16 23:17:47 -07:00
Emil Velikov
1041fb86c0 docs: Add a note about llvm-shared-libs and libxatracker
Both changes landed in 10.2, and for people not following the
development cycle these will come as a surprise. Note that the
pipe_* interface is not stable.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
Acked-by: Rob Clark <robclark@freedesktop.org>
(cherry picked from commit e48054d036)
2014-05-16 23:15:14 -07:00
Emil Velikov
b1aa25907a configure: correctly set LD_NO_UNDEFINED
Commit 11623be934 was meant to have this hunk, which
I accidently dropped during git rebase.

Cc: 10.2 <mesa-stable@lists.freedesktop.org>
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Julien Cristau <jcristau@debian.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Reviewed-by: Jonathan Gray <jsg@jsg.id.au>
(cherry picked from commit f57d092199)
2014-05-16 23:15:09 -07:00
Michel Dänzer
5d6e822d03 radeonsi: Fix anisotropic filtering state setup
Bring it back in line with r600g. I broke this in the original radeonsi
bringup. :(

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=78537

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>

Reviewed-by: Marek Olšák <marek.olsak@amd.com>
Reviewed-by: Alex Deucher <alexander.deucher@amd.com>
(cherry picked from commit c5828b0599)
2014-05-16 23:14:36 -07:00
Jonathan Gray
26d5b22039 glsl: simplify the M_PI*f macros, fixes build on OpenBSD
The M_PI*f macros used a preprocessor paste to append 'f'
to M_PI defines, which works if the values are only numbers
but breaks on OpenBSD where M_PI definitions have casts
and brackets to meet requirements of a future version of POSIX,

http://austingroupbugs.net/view.php?id=801
http://austingroupbugs.net/view.php?id=828

Simplify the M_PI*f macros by using casts directly in the defines
as suggested by Kenneth Graunke.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=78665
Reviewed-by: Matt Turner <mattst88@gmail.com>
Signed-off-by: Jonathan Gray <jsg@jsg.id.au>
(cherry picked from commit 0c0bbe77d0)
2014-05-16 23:13:37 -07:00
Kenneth Graunke
3171da3402 i965: Don't _swrast_BlitFramebuffer when doing CopyTexSubImage.
The point of copytexsubimage_using_blit_framebuffer is to use a hardware
accelerated BlitFramebuffer path.  If that fails, we shouldn't do a
swrast blit---we should try our CTSI fallback code.

This is especially important for i965 and GLES, where we don't even
create a swrast context.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=77705
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Eric Anholt <eric@anholt.net>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit bd44ac8b5c)
2014-05-16 23:13:04 -07:00
Kristian Høgsberg
875fd92d16 wayland: Move version 2 request to end of interface specification
We're moving towards requiring interface additions to be appended to the
end of the interface block.  No functional change, opcodes are assigned as
before, but version 2 additions are now grouped together, which prevents
a scanner warning.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Kristian Høgsberg <krh@bitplanet.net>
(cherry picked from commit 06842d436e)
2014-05-16 23:12:45 -07:00
Topi Pohjolainen
fb5c68d312 meta: Refactor configuration of renderbuffer sampling
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 4dc9c314c8)
2014-05-16 23:07:02 -07:00
Topi Pohjolainen
0e7b0f2a0a meta: Refactor binding of renderbuffer as texture image
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit a2952315ac)
2014-05-16 23:05:22 -07:00
Topi Pohjolainen
5f495b85a0 meta: Merge compiling and linking of blit program
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit ac4db0aa55)
2014-05-16 23:04:22 -07:00
Topi Pohjolainen
253834cbf6 i965/blorp: Expose coordinate scissoring and mirroring
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 3a43cd0c3e)
2014-05-16 23:00:40 -07:00
Topi Pohjolainen
f5c083dbc3 i965/gen8: Use helper variables for surface parameters
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 4a92ad5531)
2014-05-16 22:55:44 -07:00
Jordan Justen
2b4a871e05 i965/gen8: Set depth extent field
The depth extent field is used to limit the allowed slice range that
can be rendered to.

With the previous setting, only slice 0 could be rendered.

This fixes piglit amd_vertex_shader_layer-layered-depth-texture-render.

Signed-off-by: Jordan Justen <jordan.l.justen@intel.com>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
(cherry picked from commit c51c192891)
2014-05-14 12:19:16 -07:00
Jordan Justen
27da0bbeb4 i965/gen8 depth: Set depth size based on LOD0 for 3D textures
Signed-off-by: Jordan Justen <jordan.l.justen@intel.com>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
(cherry picked from commit 294ada2fef)
2014-05-14 12:19:14 -07:00
Jordan Justen
91e2808c41 i965/gen7 depth: Set depth size based on LOD0 for 3D textures
Signed-off-by: Jordan Justen <jordan.l.justen@intel.com>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
(cherry picked from commit e6d6ed55ab)
2014-05-14 12:19:13 -07:00
Jordan Justen
6cad93daab i965/gen8 renderbuffer: Set depth size based on LOD0 for 3D textures
Fixes piglit's
'gl-3.2-layered-rendering-clear-color-all-types 3d mipmapped'

Signed-off-by: Jordan Justen <jordan.l.justen@intel.com>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
(cherry picked from commit e47d08adef)
2014-05-14 12:19:12 -07:00
Jordan Justen
71f78bb87e i965/gen7 renderbuffer: Set depth size based on LOD0 for 3D textures
If blorp is disabled for color clears, then piglit's
'gl-3.2-layered-rendering-clear-color-all-types 3d mipmapped'
will fail.

Currently, gen8 fails similarly on this test because gen8
does not use blorp.

Signed-off-by: Jordan Justen <jordan.l.justen@intel.com>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
(cherry picked from commit b875f39e29)
2014-05-14 12:19:08 -07:00
Chris Forbes
ab43a98fcf i965/Gen8: Set up layer constraints properly for depth buffers
Same issues as the previous commit fixed for Gen7:
- Bogus physical->logical layer conversion; depth/stencil surfaces
  are still IMS layout on Gen8.
- mt_layer ignored in layered rendering case, which breaks handling
  of views with MinLayer.
- Render target array extent not set correctly for arrays.

I'm not able to test this one since I can't get a Broadwell yet, but
it's the same set of fixes as for Gen7.

V2: Restore the MAX2() to account for zero depth/layer_count.

Signed-off-by: Chris Forbes <chrisf@ijw.co.nz>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 23e9f06569)
2014-05-14 12:16:54 -07:00
Chris Forbes
af228e999c i965/Gen7: Set up layer constraints properly for depth buffers
Again, a few problems:
- Layered attachments did not honor MinLayer.
- Non-layered MSAA attachments rendered to the wrong layer due to
  dividing by the layer count. All depth buffers use the IMS layout, so
  the physical layer count == logical layer count.
- Layered attachments were not limited to irb->layer_count, so we could
  render off the end of the texture.

V2: Restore the MAX2() to account for zero depth/layer_count.

Signed-off-by: Chris Forbes <chrisf@ijw.co.nz>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 77d55ef481)
2014-05-14 12:16:51 -07:00
Chris Forbes
725a27e04d i965/Gen8: Set up layer constraints properly for renderbuffers
Fixing the same issues the previous commit does for Gen7.

Note that I can't test this one, since I don't have a Broadwell.

V2: Restore the MAX2() to account for zero depth/layer_count.

Signed-off-by: Chris Forbes <chrisf@ijw.co.nz>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 9269ea599c)
2014-05-14 12:16:50 -07:00
Chris Forbes
b0609b715b i965/Gen7: Set up layer constraints properly for renderbuffers
There were a few problems here, which mostly just broke layered
rendering into a view:

- Render target view extent was always set to be == depth. This is
  benign for non-layered-rendering, but allows writes off the end of the
  render target for layered rendering, which ends badly.
- Layered rendering did not honor the mt_layer setting, so would not
  properly handle MinLayer being set on a view.

V2: Restore the MAX2() to account for zero depth/layer_count.

Signed-off-by: Chris Forbes <chrisf@ijw.co.nz>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit dd43900b7b)
2014-05-14 12:16:47 -07:00
Ilia Mirkin
ca549a0f19 nv50,nvc0: fix blit 3d path for 1d array textures
Need to adjust coordinates since the shader receives the array index as
depth in z, but the TEX instruction expects it to be the second
coordinate for a 1D array texture. This fixes fbo-generatemipmap-array.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Ben Skeggs <bskeggs@redhat.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 8baed87212)
2014-05-13 10:19:04 -07:00
Ilia Mirkin
407bff9db0 nv50,nvc0: leave queries on during blit, turn them on for 2d engine
Fixes the new logic of the conditional rendering piglit test.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Ben Skeggs <bskeggs@redhat.com>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 4467c0c9fb)
2014-05-13 10:18:05 -07:00
Ilia Mirkin
0e14b19492 mesa/st: leave current query enabled during glBlitFramebuffer
Also make sure that pipe_blit_info gets zero'd out so that query isn't
accidentally left enabled.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Marek Olšák <marek.olsak@amd.com>
(cherry picked from commit 64a7ddf40d)
2014-05-13 10:11:00 -07:00
Ilia Mirkin
a233f4c303 gallium: add bit to pipe_blit_info to leave current query enabled
Previously the implication was that queries should be disabled during
blits. However glBlitFramebuffer() is supposed to obey the current
query, and this new bit will indicate that to the driver.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Marek Olšák <marek.olsak@amd.com>
(cherry picked from commit 752ce0affb)
2014-05-13 10:08:33 -07:00
Ilia Mirkin
7a81788c67 nv50: fix setting of texture ms info to be per-stage
Different textures may be bound to each slot for each stage. So we need
to be able to upload ms parameters for each one without stages
overwriting each other.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Ben Skeggs <bskeggs@redhat.com>
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 863573b9cb)
2014-05-13 10:08:01 -07:00
Ilia Mirkin
13bb2bc84b nv50/ir: make sure to reverse cond codes on all the OP_SET variants
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Ben Skeggs <bskeggs@redhat.com>
Cc: "10.2 10.1" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 68f47cad0d)
2014-05-13 09:57:28 -07:00
Ian Romanick
98b66e8d96 Add .cherry-ignore file
e696727 adds a change, and 155f98d reverts that change.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2014-05-13 09:55:23 -07:00
Ian Romanick
0b3126bddd mesa: Bump version to 10.2-rc2
Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2014-05-09 20:10:38 -07:00
Emil Velikov
f2682b3b9f glx/tests: Partially revert commit 51e3569573
C++ does not support designated initializers, thus compilation
is not guaranteed to succeed. Surprisingly gcc 4.6.3 fails to
build the code, while version 4.9.0 compiles it without a hitch.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=78403
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
Tested-by: Vinson Lee <vlee@freedesktop.org>
(cherry picked from commit 326b8e253e)
2014-05-09 20:10:38 -07:00
Emil Velikov
d259928a56 configure: error out if building GBM without dri
Both backends require --enable-dri, and building an empty libgbm
makes little to no sense. Error out at configure to prevent the
user from shooting themselves in the foot.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=78225
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit e477d12c33)
2014-05-09 20:10:38 -07:00
Kenneth Graunke
ec6bd21162 i965: Fix GPU hangs on Broadwell in shaders with some control flow.
According to the documentation, we need to set the source 0 register
type to IMM for flow control instructions that have both JIP and UIP.

Fixes GPU hangs in approximately 10 Piglit tests, 5 es3conform tests,
Unigine Crypt, a WebGL raytracer demo, and several Steam titles.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=75478
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=75878
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=76939
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Tested-by: Topi Pohjolainen <topi.pohjolainen@intel.com>
Tested-by: Kristian Høgsberg <krh@bitplanet.net>
Reviewed-by: Jordan Justen <jordan.l.justen@intel.com>
Reviewed-by: Matt Turner <mattst88@gmail.com>
(cherry picked from commit 9584959123)
2014-05-09 20:10:37 -07:00
Tom Stellard
53a0f9d0ba radeonsi: Enable geometry shaders with LLVM 3.4.1
Reviewed-by: Michel Dänzer <michel.daenzer@amd.com>

CC: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 93c2ebbd83)
2014-05-09 20:10:37 -07:00
Tom Stellard
0f0f1106b6 configure.ac: Add LLVM_VERSION_PATCH to DEFINES
Reviewed-by: Michel Dänzer <michel.daenzer@amd.com>

CC: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit c5d0008325)
2014-05-09 20:10:37 -07:00
Thomas Hellstrom
2b34277bbd st/xa: Fix performance regression introduced by commit "Cache render target surface"
The mentioned commit has the nasty side-effect of turning off accelerated
copies.

Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
Reviewed-by: Jakob Bornecrantz <jakob@vmware.com>
Reviewed-by: Rob Clark <robdclark@gmail.com>
(cherry picked from commit 9306b7c171)
2014-05-09 20:10:37 -07:00
Tom Stellard
e29daf82cc clover: Destory pipe_screen when device does not support compute v2
v2:
  - Make sure screen was successfully created before destroying it.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Francisco Jerez <currojerez@riseup.net>
(cherry picked from commit c5f0c98c49)
2014-05-09 20:10:37 -07:00
Tom Stellard
03673bcf6c pipe-loader: Don't destroy the winsys in the sw loader
The screen takes ownership of the winsys, and is responsible for
destroying it.  Users of pipe-loader should make sure they destory
and  screens they've created to avoid memory leaks.

This fixes a crash in clover introduced by
ce6c17c083 where the pipe-loader was
destroying the winsys while a screen was still using it.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Emil Velikov <emil.l.velikov@gmail.com>
(cherry picked from commit c650033b86)
2014-05-09 20:10:37 -07:00
Roland Scheidegger
af47859aed draw: do not use draw_get_option_use_llvm() inside draw execution paths
1c73e919a4 made it possible to not allocate
the tgsi machine if llvm was used. However, draw_get_option_use_llvm() is
not reliable after draw context creation, since drivers can explicitly
request a non-llvm draw context even if draw_get_option_use_llvm() would
return true (and softpipe does just that) which leads to crashes.
Thus use draw->llvm to determine if we're using llvm or not instead (and
make draw->llvm available even if HAVE_LLVM is false so we don't have to put
even more ifdefs).

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Brian Paul <brianp@vmware.com>
(cherry picked from commit 9af68e9b1d)
2014-05-09 20:10:37 -07:00
Kenneth Graunke
e120f1a958 mesa: Fix MaxNumLayers for 1D array textures.
1D array targets store the number of slices in the Height field.

Cc: "10.2 10.1 10.0" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Brian Paul <brianp@vmware.com>
Reviewed-by: Marek Olšák <marek.olsak@amd.com>
Reviewed-by: Jordan Justen <jordan.l.justen@intel.com>
(cherry picked from commit 5c399ca8e4)
2014-05-09 18:27:26 -07:00
Kenneth Graunke
cc92276cb8 i965: Enable GL_ARB_texture_view on Broadwell.
This is a port of commit c9c08867ed.
A tiny bit of extra work was necessary to not break stencil texturing.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
(cherry picked from commit ecfc418b68)
2014-05-08 14:57:12 -07:00
Ilia Mirkin
fac042fa05 nv50/ir/gk110: fix set with f32 dest
Should fix comparison opcodes like SGE/SLT/etc which expected a float to
be returned. These were previously getting integer 0/-1 values.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Ben Skeggs <bskeggs@redhat.com>
Cc: 10.2 <mesa-stable@lists.freedesktop.org>
(cherry picked from commit e7047f2917)
2014-05-08 14:50:33 -07:00
Ian Romanick
d26b59ec27 linker: Fix consumer_inputs_with_locations indexing
In an earlier incarnation of populate_consumer_input_sets and
get_matching_input, the consumer_inputs_with_locations array was indexed
using the user-specified location.  In that version, only user-defined
varyings were included in the array.

In the current incarnation, the Mesa location is used to index the
array, and built-in varyings are included.

This change fixes the unit test to exepect gl_ClipDistance in the array,
and it resizes the arrays to actually be big enough.  It's just dumb
luck that the existing piglit tests use small enough locations to not
stomp the stack. :(

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=78258
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Cc: Vinson Lee <vlee@freedesktop.org>
(cherry picked from commit f7bf37cb13)
2014-05-07 09:50:52 -07:00
Kenneth Graunke
c2c15a9a37 meta: Only clear the requested color buffers.
This path is used to implement both glClear and glClearBuffer; the
latter is only supposed to clear particular buffers.  Core Mesa provides
us that information in the buffers bitmask; we must only clear buffers
mentioned there.

To accomplish this, we save/restore the color draw buffers state, and
use glDrawBuffers to restrict drawing to the relevant buffers.

Fixes Piglit's spec/!OpenGL 3.0/clearbuffer-mixed-formats and
spec/ARB_framebuffer_object/fbo-drawbuffers-none glClearBuffer tests
for drivers using meta clears (such as Broadwell).

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=77852
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=77856
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Anuj Phogat <anuj.phogat@gmail.com>
Reviewed-by: Eric Anholt <eric@anholt.net>
(cherry picked from commit 9701c6984d)
2014-05-07 09:49:13 -07:00
Kenneth Graunke
e6c98309c6 meta: Add infrastructure for saving/restoring the DrawBuffers state.
Sometimes we need to configure what draw buffers we render to, without
creating a new FBO.  This path will make that possible.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Anuj Phogat <anuj.phogat@gmail.com>
Reviewed-by: Eric Anholt <eric@anholt.net>
(cherry picked from commit c1c1cf5f92)
2014-05-07 09:48:34 -07:00
Kenneth Graunke
ffc0cc027a meta: Add a new MESA_META_DRAW_BUFFERS bit.
This will be used for saving/restoring the glDrawBuffers state.
For now, make sure that existing users of MESA_META_ALL don't get
the new bit, since they probably won't want it.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Anuj Phogat <anuj.phogat@gmail.com>
Reviewed-by: Eric Anholt <eric@anholt.net>
(cherry picked from commit e526ebf35c)
2014-05-07 09:48:34 -07:00
Kenneth Graunke
658d0410d0 meta: Unify the GLSL and fixed-function clear paths.
The majority of _mesa_meta_Clear and _mesa_meta_glsl_Clear was the same;
adding a boolean for whether to use GLSL allows us to share most of it
without polluting either path too much.

Tested for regressions by hacking i965 to always use the non-GLSL path.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Anuj Phogat <anuj.phogat@gmail.com>
Reviewed-by: Eric Anholt <eric@anholt.net>
(cherry picked from commit 7c8df60f31)
2014-05-07 09:48:34 -07:00
Kenneth Graunke
a1dd1e62fa i965: Always intel_prepare_render() after invalidating front buffers.
Fixes glean/texture_srgb, which hit recursive-flush prevention
assertions in vbo_exec_FlushVertices.

This probably hurts the performance of front buffer rendering, but
very few people in their right mind do front buffer rendering.

Fixes Glean's texture_srgb test.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Acked-by: Anuj Phogat <anuj.phogat@gmail.com>
Reviewed-by: Eric Anholt <eric@anholt.net>
(cherry picked from commit cde8bad1c9)
2014-05-07 09:48:34 -07:00
Tapani Pälli
c7a3c2d29d glsl: fix bogus layout qualifier warnings
Print out GL_ARB_explicit_attrib_location warnings only
when parsing attribute that uses "location" qualifier.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=77245
Signed-off-by: Tapani Pälli <tapani.palli@intel.com>
Reviewed-by: Anuj Phogat <anuj.phogat@gmail.com>
Cc: "10.1 10.2" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit e65917f94e)
2014-05-07 09:48:34 -07:00
Kenneth Graunke
0a5034517a i965: Set miptree target field when creating from a BO.
Prior to commit 8435b60a35, the region
equivalent of this function called intel_miptree_create_layout, which
set mt->target to target.  With that commit, it no longer copied target.

Piglit's ext_image_dma_buf_import-sample_[xa]rgb8888 tests would then
hit an assertion failure, where image->TexObject->Target was
GL_TEXTURE_EXTERNAL_OES, and mt->target was GL_TEXTURE_2D.

Copying the target fixes this assertion failure.

Cc: "10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Jordan Justen <jordan.l.justen@intel.com>
Reviewed-by: Eric Anholt <eric@anholt.net>
(cherry picked from commit 829cb0423d)
2014-05-05 10:10:54 -07:00
Ian Romanick
e8f6150320 mesa: Bump version to 10.2-rc1
Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2014-05-02 21:17:00 -07:00
3070 changed files with 168652 additions and 276036 deletions

View File

@@ -1,4 +1,4 @@
((prog-mode
((nil
(indent-tabs-mode . nil)
(tab-width . 8)
(c-basic-offset . 3)

2
.gitignore vendored
View File

@@ -18,7 +18,6 @@
*.tar
*.tar.bz2
*.tar.gz
*.tar.xz
*.trs
*.zip
*~
@@ -45,4 +44,3 @@ manifest.txt
.libs/
Makefile
Makefile.in
.install-mesa-links

View File

@@ -24,17 +24,16 @@
# use c99 compiler by default
ifeq ($(LOCAL_CC),)
ifeq ($(LOCAL_IS_HOST_MODULE),true)
LOCAL_CC := $(HOST_CC) -std=c99 -D_GNU_SOURCE
LOCAL_CC := $(HOST_CC) -std=c99
else
LOCAL_CC := $(TARGET_CC) -std=c99
endif
endif
LOCAL_C_INCLUDES += \
$(MESA_TOP)/src \
$(MESA_TOP)/include
MESA_VERSION := $(shell cat $(MESA_TOP)/VERSION)
MESA_VERSION=$(shell cat $(MESA_TOP)/VERSION)
# define ANDROID_VERSION (e.g., 4.0.x => 0x0400)
LOCAL_CFLAGS += \
-DPACKAGE_VERSION=\"$(MESA_VERSION)\" \
@@ -42,19 +41,6 @@ LOCAL_CFLAGS += \
-DANDROID_VERSION=0x0$(MESA_ANDROID_MAJOR_VERSION)0$(MESA_ANDROID_MINOR_VERSION)
LOCAL_CFLAGS += \
-DHAVE___BUILTIN_EXPECT \
-DHAVE___BUILTIN_FFS \
-DHAVE___BUILTIN_FFSLL \
-DHAVE_FUNC_ATTRIBUTE_FLATTEN \
-DHAVE_FUNC_ATTRIBUTE_UNUSED \
-DHAVE_FUNC_ATTRIBUTE_FORMAT \
-DHAVE_FUNC_ATTRIBUTE_PACKED \
-DHAVE___BUILTIN_CTZ \
-DHAVE___BUILTIN_POPCOUNT \
-DHAVE___BUILTIN_POPCOUNTLL \
-DHAVE___BUILTIN_CLZ \
-DHAVE___BUILTIN_CLZLL \
-DHAVE___BUILTIN_UNREACHABLE \
-DHAVE_PTHREAD=1 \
-fvisibility=hidden \
-Wno-sign-compare

View File

@@ -24,7 +24,7 @@
# BOARD_GPU_DRIVERS should be defined. The valid values are
#
# classic drivers: i915 i965
# gallium drivers: swrast freedreno i915g ilo nouveau r300g r600g radeonsi vmwgfx
# gallium drivers: swrast i915g ilo nouveau r300g r600g radeonsi vmwgfx
#
# The main target is libGLES_mesa. For each classic driver enabled, a DRI
# module will also be built. DRI modules will be loaded by libGLES_mesa.
@@ -34,21 +34,15 @@ MESA_TOP := $(call my-dir)
MESA_ANDROID_MAJOR_VERSION := $(word 1, $(subst ., , $(PLATFORM_VERSION)))
MESA_ANDROID_MINOR_VERSION := $(word 2, $(subst ., , $(PLATFORM_VERSION)))
MESA_ANDROID_VERSION := $(MESA_ANDROID_MAJOR_VERSION).$(MESA_ANDROID_MINOR_VERSION)
ifeq ($(filter 1 2 3 4,$(MESA_ANDROID_MAJOR_VERSION)),)
MESA_LOLLIPOP_BUILD := true
else
define local-generated-sources-dir
$(call local-intermediates-dir)
endef
endif
MESA_COMMON_MK := $(MESA_TOP)/Android.common.mk
MESA_PYTHON2 := python
DRM_TOP := external/drm
DRM_GRALLOC_TOP := hardware/drm_gralloc
classic_drivers := i915 i965
gallium_drivers := swrast freedreno i915g ilo nouveau r300g r600g radeonsi vmwgfx
gallium_drivers := swrast i915g ilo nouveau r300g r600g radeonsi vmwgfx
MESA_GPU_DRIVERS := $(strip $(BOARD_GPU_DRIVERS))
@@ -88,7 +82,6 @@ SUBDIRS := \
src/mapi \
src/glsl \
src/mesa \
src/util \
src/egl/main
ifeq ($(strip $(MESA_BUILD_CLASSIC)),true)
@@ -101,6 +94,7 @@ ifeq ($(strip $(MESA_BUILD_GALLIUM)),true)
SUBDIRS += src/gallium
endif
include $(call all-named-subdir-makefiles,$(SUBDIRS))
mkfiles := $(patsubst %,$(MESA_TOP)/%/Android.mk,$(SUBDIRS))
include $(mkfiles)
endif

View File

@@ -1,15 +0,0 @@
$(call add-clean-step, rm -rf $(PRODUCT_OUT)/obj/STATIC_LIBRARIES/libmesa_*_intermediates)
$(call add-clean-step, rm -rf $(PRODUCT_OUT)/obj/SHARED_LIBRARIES/i9*5_dri_intermediates)
$(call add-clean-step, rm -rf $(PRODUCT_OUT)/obj/SHARED_LIBRARIES/libglapi_intermediates)
$(call add-clean-step, rm -rf $(PRODUCT_OUT)/obj/SHARED_LIBRARIES/libGLES_mesa_intermediates)
$(call add-clean-step, rm -rf $(OUT_DIR)/host/$(HOST_OS)-$(HOST_ARCH)/obj/EXECUTABLES/mesa_*_intermediates)
$(call add-clean-step, rm -rf $(OUT_DIR)/host/$(HOST_OS)-$(HOST_ARCH)/obj/EXECUTABLES/glsl_compiler_intermediates)
$(call add-clean-step, rm -rf $(OUT_DIR)/host/$(HOST_OS)-$(HOST_ARCH)/obj/STATIC_LIBRARIES/libmesa_glsl_utils_intermediates)
$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/STATIC_LIBRARIES/libmesa_*_intermediates)
$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/SHARED_LIBRARIES/i9?5_dri_intermediates)
$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/SHARED_LIBRARIES/libglapi_intermediates)
$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/SHARED_LIBRARIES/libGLES_mesa_intermediates)
$(call add-clean-step, rm -rf $(HOST_OUT_release)/*/EXECUTABLES/mesa_*_intermediates)
$(call add-clean-step, rm -rf $(HOST_OUT_release)/*/EXECUTABLES/glsl_compiler_intermediates)
$(call add-clean-step, rm -rf $(HOST_OUT_release)/*/STATIC_LIBRARIES/libmesa_*_intermediates)

View File

@@ -21,41 +21,86 @@
SUBDIRS = src
AM_DISTCHECK_CONFIGURE_FLAGS = \
--enable-dri3 \
--enable-gallium-tests \
--enable-gbm \
--enable-gles1 \
--enable-gles2 \
--enable-glx-tls \
--enable-va \
--enable-vdpau \
--enable-xa \
--enable-xvmc \
--with-egl-platforms=x11,wayland,drm
ACLOCAL_AMFLAGS = -I m4
EXTRA_DIST = \
autogen.sh \
common.py \
docs \
doxygen \
scons \
SConstruct
doxygen:
cd doxygen && $(MAKE)
noinst_HEADERS = \
include/c99_alloca.h \
include/c99_compat.h \
include/c99_math.h \
include/c99 \
include/c11 \
include/D3D9 \
include/HaikuGL \
include/no_extern_c.h \
include/pci_ids
.PHONY: doxygen
# We list some directories in EXTRA_DIST, but don't actually want to include
# the .gitignore files in the tarball.
dist-hook:
find $(distdir) -name .gitignore -exec $(RM) {} +
# Rules for making release tarballs
PACKAGE_DIR = Mesa-$(PACKAGE_VERSION)
PACKAGE_NAME = MesaLib-$(PACKAGE_VERSION)
EXTRA_FILES = \
aclocal.m4 \
configure \
bin/ar-lib \
bin/compile \
bin/config.sub \
bin/config.guess \
bin/depcomp \
bin/install-sh \
bin/ltmain.sh \
bin/missing \
bin/ylwrap \
bin/test-driver \
src/glsl/glsl_parser.cpp \
src/glsl/glsl_parser.h \
src/glsl/glsl_lexer.cpp \
src/glsl/glcpp/glcpp-lex.c \
src/glsl/glcpp/glcpp-parse.c \
src/glsl/glcpp/glcpp-parse.h \
src/mesa/program/lex.yy.c \
src/mesa/program/program_parse.tab.c \
src/mesa/program/program_parse.tab.h \
`git ls-files | grep "Makefile.am" | sed -e "s/Makefile.am/Makefile.in/"`
IGNORE_FILES = \
-x autogen.sh
parsers: configure
$(MAKE) -C src/glsl glsl_parser.cpp glsl_parser.h glsl_lexer.cpp glcpp/glcpp-lex.c glcpp/glcpp-parse.c glcpp/glcpp-parse.h
$(MAKE) -C src/mesa program/lex.yy.c program/program_parse.tab.c program/program_parse.tab.h
# Everything for new a Mesa release:
ARCHIVES = $(PACKAGE_NAME).tar.gz \
$(PACKAGE_NAME).tar.bz2 \
$(PACKAGE_NAME).zip
tarballs: md5
rm -f ../$(PACKAGE_DIR) $(PACKAGE_NAME).tar
manifest.txt: .git
( \
ls -1 $(EXTRA_FILES) ; \
git ls-files $(IGNORE_FILES) \
) | sed -e '/^\(.*\/\)\?\./d' -e "s@^@$(PACKAGE_DIR)/@" > $@
../$(PACKAGE_DIR):
ln -s $(PWD) $@
$(PACKAGE_NAME).tar: parsers ../$(PACKAGE_DIR) manifest.txt
cd .. ; tar -cf $(PACKAGE_DIR)/$(PACKAGE_NAME).tar -T $(PACKAGE_DIR)/manifest.txt
$(PACKAGE_NAME).tar.gz: $(PACKAGE_NAME).tar ../$(PACKAGE_DIR)
gzip --stdout --best $(PACKAGE_NAME).tar > $(PACKAGE_NAME).tar.gz
$(PACKAGE_NAME).tar.bz2: $(PACKAGE_NAME).tar
bzip2 --stdout --best $(PACKAGE_NAME).tar > $(PACKAGE_NAME).tar.bz2
$(PACKAGE_NAME).zip: parsers ../$(PACKAGE_DIR) manifest.txt
rm -f $(PACKAGE_NAME).zip ; \
cd .. ; \
zip -q -@ $(PACKAGE_NAME).zip < $(PACKAGE_DIR)/manifest.txt ; \
mv $(PACKAGE_NAME).zip $(PACKAGE_DIR)
md5: $(ARCHIVES)
@-md5sum $(PACKAGE_NAME).tar.gz
@-md5sum $(PACKAGE_NAME).tar.bz2
@-md5sum $(PACKAGE_NAME).zip
.PHONY: tarballs md5

View File

@@ -1 +1 @@
10.6.5
10.2.2

View File

@@ -6,8 +6,8 @@ test -z "$srcdir" && srcdir=.
ORIGDIR=`pwd`
cd "$srcdir"
autoreconf --force --verbose --install || exit 1
cd "$ORIGDIR" || exit $?
autoreconf -v --install || exit 1
cd $ORIGDIR || exit $?
if test -z "$NOCONFIGURE"; then
"$srcdir"/configure "$@"

3
bin/.cherry-ignore Normal file
View File

@@ -0,0 +1,3 @@
# The first is the change, and the second is the revert of that change.
e6967270c75a5b669152127bb7a746d55f4407a6 i965: Fix depth (array slices) computation for 1D_ARRAY render targets.
155f98d49fdc2f46c760f8214327b3804ee60079 Revert "i965: Fix depth (array slices) computation for 1D_ARRAY render targets."

View File

@@ -15,14 +15,17 @@
# $ DRYRUN=yes bin/bugzilla_mesa.sh mesa-9.0.2..mesa-9.0.3 | wc -l
# regex pattern: trim before bug number
trim_before='s/.*show_bug.cgi?id=\([0-9]*\).*/\1/'
# regex pattern: trim before url
trim_before='s/.*\(http\)/\1/'
# regex pattern: reconstruct the url
use_after='s,^,https://bugs.freedesktop.org/show_bug.cgi?id=,'
# regex pattern: trim after url
trim_after='s/\(show_bug.cgi?id=[0-9]*\).*/\1/'
# regex pattern: always use https
use_https='s/http:/https:/'
# extract fdo urls from commit log
urls=$(git log $* | grep 'bugs.freedesktop.org/show_bug' | sed -e $trim_before | sort -n -u | sed -e $use_after)
urls=$(git log $* | grep 'bugs.freedesktop.org/show_bug' | sed -e $trim_before -e $trim_after -e $use_https | sort | uniq)
# if DRYRUN is set to "yes", simply print the URLs and don't fetch the
# details from fdo bugzilla.

View File

@@ -26,28 +26,28 @@ else:
target_platform = host_platform
_machine_map = {
'x86': 'x86',
'i386': 'x86',
'i486': 'x86',
'i586': 'x86',
'i686': 'x86',
'BePC': 'x86',
'Intel': 'x86',
'ppc': 'ppc',
'BeBox': 'ppc',
'BeMac': 'ppc',
'AMD64': 'x86_64',
'x86_64': 'x86_64',
'sparc': 'sparc',
'sun4u': 'sparc',
'x86': 'x86',
'i386': 'x86',
'i486': 'x86',
'i586': 'x86',
'i686': 'x86',
'BePC': 'x86',
'Intel': 'x86',
'ppc' : 'ppc',
'BeBox': 'ppc',
'BeMac': 'ppc',
'AMD64': 'x86_64',
'x86_64': 'x86_64',
'sparc': 'sparc',
'sun4u': 'sparc',
}
# find host_machine value
if 'PROCESSOR_ARCHITECTURE' in os.environ:
host_machine = os.environ['PROCESSOR_ARCHITECTURE']
host_machine = os.environ['PROCESSOR_ARCHITECTURE']
else:
host_machine = _platform.machine()
host_machine = _platform.machine()
host_machine = _machine_map.get(host_machine, 'generic')
default_machine = host_machine
@@ -65,8 +65,7 @@ else:
default_llvm = 'no'
try:
if target_platform != 'windows' and \
subprocess.call(['llvm-config', '--version'],
stdout=subprocess.PIPE) == 0:
subprocess.call(['llvm-config', '--version'], stdout=subprocess.PIPE) == 0:
default_llvm = 'yes'
except:
pass
@@ -76,38 +75,30 @@ else:
# Common options
def AddOptions(opts):
try:
from SCons.Variables.BoolVariable import BoolVariable as BoolOption
except ImportError:
from SCons.Options.BoolOption import BoolOption
try:
from SCons.Variables.EnumVariable import EnumVariable as EnumOption
except ImportError:
from SCons.Options.EnumOption import EnumOption
opts.Add(EnumOption('build', 'build type', 'debug',
allowed_values=('debug', 'checked', 'profile',
'release')))
opts.Add(BoolOption('verbose', 'verbose output', 'no'))
opts.Add(EnumOption('machine', 'use machine-specific assembly code',
default_machine,
allowed_values=('generic', 'ppc', 'x86', 'x86_64')))
opts.Add(EnumOption('platform', 'target platform', host_platform,
allowed_values=('cygwin', 'darwin', 'freebsd', 'haiku',
'linux', 'sunos', 'windows')))
opts.Add(BoolOption('embedded', 'embedded build', 'no'))
opts.Add(BoolOption('analyze',
'enable static code analysis where available', 'no'))
opts.Add('toolchain', 'compiler toolchain', default_toolchain)
opts.Add(BoolOption('gles', 'EXPERIMENTAL: enable OpenGL ES support',
'no'))
opts.Add(BoolOption('llvm', 'use LLVM', default_llvm))
opts.Add(BoolOption('openmp', 'EXPERIMENTAL: compile with openmp (swrast)',
'no'))
opts.Add(BoolOption('debug', 'DEPRECATED: debug build', 'yes'))
opts.Add(BoolOption('profile', 'DEPRECATED: profile build', 'no'))
opts.Add(BoolOption('quiet', 'DEPRECATED: profile build', 'yes'))
opts.Add(BoolOption('texture_float',
'enable floating-point textures and renderbuffers',
'no'))
if host_platform == 'windows':
opts.Add('MSVC_VERSION', 'Microsoft Visual C/C++ version')
try:
from SCons.Variables.BoolVariable import BoolVariable as BoolOption
except ImportError:
from SCons.Options.BoolOption import BoolOption
try:
from SCons.Variables.EnumVariable import EnumVariable as EnumOption
except ImportError:
from SCons.Options.EnumOption import EnumOption
opts.Add(EnumOption('build', 'build type', 'debug',
allowed_values=('debug', 'checked', 'profile', 'release')))
opts.Add(BoolOption('verbose', 'verbose output', 'no'))
opts.Add(EnumOption('machine', 'use machine-specific assembly code', default_machine,
allowed_values=('generic', 'ppc', 'x86', 'x86_64')))
opts.Add(EnumOption('platform', 'target platform', host_platform,
allowed_values=('cygwin', 'darwin', 'freebsd', 'haiku', 'linux', 'sunos', 'windows')))
opts.Add(BoolOption('embedded', 'embedded build', 'no'))
opts.Add(BoolOption('analyze', 'enable static code analysis where available', 'no'))
opts.Add('toolchain', 'compiler toolchain', default_toolchain)
opts.Add(BoolOption('gles', 'EXPERIMENTAL: enable OpenGL ES support', 'no'))
opts.Add(BoolOption('llvm', 'use LLVM', default_llvm))
opts.Add(BoolOption('openmp', 'EXPERIMENTAL: compile with openmp (swrast)', 'no'))
opts.Add(BoolOption('debug', 'DEPRECATED: debug build', 'yes'))
opts.Add(BoolOption('profile', 'DEPRECATED: profile build', 'no'))
opts.Add(BoolOption('quiet', 'DEPRECATED: profile build', 'yes'))
opts.Add(BoolOption('texture_float', 'enable floating-point textures and renderbuffers', 'no'))
if host_platform == 'windows':
opts.Add('MSVC_VERSION', 'Microsoft Visual C/C++ version')

File diff suppressed because it is too large Load Diff

View File

@@ -18,26 +18,27 @@ are exposed in the 3.0 context as extensions.
Feature Status
----------------------------------------------------- ------------------------
GL 3.0, GLSL 1.30 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe
GL 3.0 --- all DONE: i965, nv50, nvc0, r600, radeonsi
GLSL 1.30 DONE ()
glBindFragDataLocation, glGetFragDataLocation DONE
Conditional rendering (GL_NV_conditional_render) DONE ()
Map buffer subranges (GL_ARB_map_buffer_range) DONE ()
Clamping controls (GL_ARB_color_buffer_float) DONE ()
Float textures, renderbuffers (GL_ARB_texture_float) DONE ()
Conditional rendering (GL_NV_conditional_render) DONE (r300, swrast)
Map buffer subranges (GL_ARB_map_buffer_range) DONE (r300, swrast)
Clamping controls (GL_ARB_color_buffer_float) DONE (r300)
Float textures, renderbuffers (GL_ARB_texture_float) DONE (r300)
GL_EXT_packed_float DONE ()
GL_EXT_texture_shared_exponent DONE ()
GL_EXT_texture_shared_exponent DONE (swrast)
Float depth buffers (GL_ARB_depth_buffer_float) DONE ()
Framebuffer objects (GL_ARB_framebuffer_object) DONE ()
Framebuffer objects (GL_ARB_framebuffer_object) DONE (r300, swrast)
GL_ARB_half_float_pixel DONE (all drivers)
GL_ARB_half_float_vertex DONE ()
GL_ARB_half_float_vertex DONE (r300, swrast)
GL_EXT_texture_integer DONE ()
GL_EXT_texture_array DONE ()
Per-buffer blend and masks (GL_EXT_draw_buffers2) DONE ()
GL_EXT_texture_compression_rgtc DONE ()
GL_ARB_texture_rg DONE ()
Per-buffer blend and masks (GL_EXT_draw_buffers2) DONE (swrast)
GL_EXT_texture_compression_rgtc DONE (r300, swrast)
GL_ARB_texture_rg DONE (r300, swrast)
Transform feedback (GL_EXT_transform_feedback) DONE ()
Vertex array objects (GL_ARB_vertex_array_object) DONE ()
Vertex array objects (GL_ARB_vertex_array_object) DONE (all drivers)
sRGB framebuffer format (GL_EXT_framebuffer_sRGB) DONE ()
glClearBuffer commands DONE
glGetStringi command DONE
@@ -45,197 +46,151 @@ GL 3.0, GLSL 1.30 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, soft
glVertexAttribI commands DONE
Depth format cube textures DONE ()
GLX_ARB_create_context (GLX 1.4 is required) DONE
Multisample anti-aliasing DONE (llvmpipe (*), softpipe (*))
(*) llvmpipe and softpipe have fake Multisample anti-aliasing support
Multisample anti-aliasing DONE (r300)
GL 3.1, GLSL 1.40 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe
GL 3.1 --- all DONE: i965, nv50, nvc0, r600, radeonsi
GLSL 1.40 DONE ()
Forward compatible context support/deprecations DONE ()
Instanced drawing (GL_ARB_draw_instanced) DONE ()
Buffer copying (GL_ARB_copy_buffer) DONE ()
Primitive restart (GL_NV_primitive_restart) DONE ()
Instanced drawing (GL_ARB_draw_instanced) DONE (swrast)
Buffer copying (GL_ARB_copy_buffer) DONE (r300, swrast)
Primitive restart (GL_NV_primitive_restart) DONE (r300)
16 vertex texture image units DONE ()
Texture buffer objs (GL_ARB_texture_buffer_object) DONE for OpenGL 3.1 contexts ()
Rectangular textures (GL_ARB_texture_rectangle) DONE ()
Uniform buffer objs (GL_ARB_uniform_buffer_object) DONE ()
Signed normalized textures (GL_EXT_texture_snorm) DONE ()
Rectangular textures (GL_ARB_texture_rectangle) DONE (r300, swrast)
Uniform buffer objs (GL_ARB_uniform_buffer_object) DONE (swrast)
Signed normalized textures (GL_EXT_texture_snorm) DONE (r300)
GL 3.2, GLSL 1.50 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe
GL 3.2 --- all DONE: i965, nv50, nvc0, r600, radeonsi
Core/compatibility profiles DONE
GLSL 1.50 DONE ()
Geometry shaders DONE ()
BGRA vertex order (GL_ARB_vertex_array_bgra) DONE ()
Base vertex offset(GL_ARB_draw_elements_base_vertex) DONE ()
Frag shader coord (GL_ARB_fragment_coord_conventions) DONE ()
Provoking vertex (GL_ARB_provoking_vertex) DONE ()
BGRA vertex order (GL_ARB_vertex_array_bgra) DONE (r300, swrast)
Base vertex offset(GL_ARB_draw_elements_base_vertex) DONE (r300, swrast)
Frag shader coord (GL_ARB_fragment_coord_conventions) DONE (r300, swrast)
Provoking vertex (GL_ARB_provoking_vertex) DONE (r300, swrast)
Seamless cubemaps (GL_ARB_seamless_cube_map) DONE ()
Multisample textures (GL_ARB_texture_multisample) DONE ()
Frag depth clamp (GL_ARB_depth_clamp) DONE ()
Fence objects (GL_ARB_sync) DONE ()
Frag depth clamp (GL_ARB_depth_clamp) DONE (swrast)
Fence objects (GL_ARB_sync) DONE (r300, swrast)
GLX_ARB_create_context_profile DONE
GL 3.3, GLSL 3.30 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe
GL 3.3 --- all DONE: i965, nv50, nvc0, r600, radeonsi
GL_ARB_blend_func_extended DONE ()
GLSL 3.30 DONE ()
GL_ARB_blend_func_extended DONE (softpipe)
GL_ARB_explicit_attrib_location DONE (all drivers that support GLSL)
GL_ARB_occlusion_query2 DONE ()
GL_ARB_occlusion_query2 DONE (r300, swrast)
GL_ARB_sampler_objects DONE (all drivers)
GL_ARB_shader_bit_encoding DONE ()
GL_ARB_texture_rgb10_a2ui DONE ()
GL_ARB_texture_swizzle DONE ()
GL_ARB_texture_swizzle DONE (r300, swrast)
GL_ARB_timer_query DONE ()
GL_ARB_instanced_arrays DONE ()
GL_ARB_instanced_arrays DONE (r300)
GL_ARB_vertex_type_2_10_10_10_rev DONE ()
GL 4.0, GLSL 4.00:
GL 4.0:
GL_ARB_draw_buffers_blend DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_draw_indirect DONE (i965, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_gpu_shader5 DONE (i965, nvc0)
- 'precise' qualifier DONE
- Dynamically uniform sampler array indices DONE (r600)
- Dynamically uniform UBO array indices DONE (r600)
- Implicit signed -> unsigned conversions DONE
- Fused multiply-add DONE ()
- Packing/bitfield/conversion functions DONE (r600, radeonsi)
- Enhanced textureGather DONE (r600, radeonsi)
- Geometry shader instancing DONE (r600)
- Geometry shader multiple streams DONE ()
- Enhanced per-sample shading DONE (r600, radeonsi)
- Interpolation functions DONE (r600)
- New overload resolution rules DONE
GL_ARB_gpu_shader_fp64 DONE (nvc0, softpipe)
GL_ARB_sample_shading DONE (i965, nv50, nvc0, r600, radeonsi)
GL_ARB_shader_subroutine started (Dave)
GL_ARB_tessellation_shader started (Chris, Ilia)
GL_ARB_texture_buffer_object_rgb32 DONE (i965, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_texture_cube_map_array DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_texture_gather DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe)
GL_ARB_texture_query_lod DONE (i965, nv50, nvc0, r600, radeonsi)
GL_ARB_transform_feedback2 DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_transform_feedback3 DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GLSL 4.0 not started
GL_ARB_texture_query_lod DONE (i965, nv50, nvc0)
GL_ARB_draw_buffers_blend DONE (i965, nv50, nvc0, r600, radeonsi, softpipe)
GL_ARB_draw_indirect DONE (i965)
GL_ARB_gpu_shader5 started
- 'precise' qualifier not started
- Dynamically uniform sampler array indices not started
- Dynamically uniform UBO array indices not started
- Implicit signed -> unsigned conversions not started
- Fused multiply-add DONE
- Packing/bitfield/conversion functions DONE
- Enhanced textureGather DONE
- Geometry shader instancing DONE
- Geometry shader multiple streams not started
- Enhanced per-sample shading DONE
- Interpolation functions started
- New overload resolution rules not started
GL_ARB_gpu_shader_fp64 not started
GL_ARB_sample_shading DONE (i965, nv50, nvc0)
GL_ARB_shader_subroutine not started
GL_ARB_tessellation_shader not started
GL_ARB_texture_buffer_object_rgb32 DONE (i965, nvc0, r600, radeonsi, softpipe)
GL_ARB_texture_cube_map_array DONE (i965, nv50, nvc0, r600, softpipe)
GL_ARB_texture_gather DONE (i965, nv50, nvc0)
GL_ARB_transform_feedback2 DONE (i965, nv50, nvc0, r600, radeonsi)
GL_ARB_transform_feedback3 DONE (i965, nv50, nvc0, r600, radeonsi)
GL 4.1, GLSL 4.10:
GL 4.1:
GL_ARB_ES2_compatibility DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GLSL 4.1 not started
GL_ARB_ES2_compatibility DONE (i965, nv50, nvc0, r300, r600, radeonsi)
GL_ARB_get_program_binary DONE (0 binary formats)
GL_ARB_separate_shader_objects DONE (all drivers)
GL_ARB_shader_precision started (Micah)
GL_ARB_vertex_attrib_64bit DONE (nvc0, softpipe)
GL_ARB_viewport_array DONE (i965, nv50, nvc0, r600, llvmpipe)
GL_ARB_shader_precision not started
GL_ARB_vertex_attrib_64bit not started
GL_ARB_viewport_array DONE (i965, nv50, r600)
GL 4.2, GLSL 4.20:
GL 4.2:
GL_ARB_texture_compression_bptc DONE (i965, nvc0, r600, radeonsi)
GL_ARB_compressed_texture_pixel_storage DONE (all drivers)
GLSL 4.2 not started
GL_ARB_texture_compression_bptc not started
GL_ARB_compressed_texture_pixel_storage not started
GL_ARB_shader_atomic_counters DONE (i965)
GL_ARB_texture_storage DONE (all drivers)
GL_ARB_transform_feedback_instanced DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_base_instance DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_transform_feedback_instanced DONE (i965, nv50, nvc0, r600, radeonsi)
GL_ARB_base_instance DONE (i965, nv50, nvc0, r600, radeonsi)
GL_ARB_shader_image_load_store in progress (curro)
GL_ARB_conservative_depth DONE (all drivers that support GLSL 1.30)
GL_ARB_shading_language_420pack DONE (all drivers that support GLSL 1.30)
GL_ARB_shading_language_packing DONE (all drivers)
GL_ARB_internalformat_query DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_internalformat_query DONE (i965, nv50, nvc0, r300, r600, radeonsi)
GL_ARB_map_buffer_alignment DONE (all drivers)
GL 4.3, GLSL 4.30:
GL 4.3:
GL_ARB_arrays_of_arrays started (Timothy)
GL_ARB_ES3_compatibility DONE (all drivers that support GLSL 3.30)
GLSL 4.3 not started
GL_ARB_arrays_of_arrays started
GL_ARB_ES3_compatibility DONE (i965)
GL_ARB_clear_buffer_object DONE (all drivers)
GL_ARB_compute_shader in progress (jljusten)
GL_ARB_copy_image DONE (i965)
GL_ARB_compute_shader started (Paul Berry)
GL_ARB_copy_image not started
GL_KHR_debug DONE (all drivers)
GL_ARB_explicit_uniform_location DONE (all drivers that support GLSL)
GL_ARB_fragment_layer_viewport DONE (nv50, nvc0, r600, llvmpipe)
GL_ARB_explicit_uniform_location not started
GL_ARB_fragment_layer_viewport not started
GL_ARB_framebuffer_no_attachments not started
GL_ARB_internalformat_query2 not started
GL_ARB_invalidate_subdata DONE (all drivers)
GL_ARB_multi_draw_indirect DONE (i965, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_program_interface_query DONE (all drivers)
GL_ARB_multi_draw_indirect DONE (i965)
GL_ARB_program_interface_query not started
GL_ARB_robust_buffer_access_behavior not started
GL_ARB_shader_image_size in progress (Martin Peres)
GL_ARB_shader_image_size not started
GL_ARB_shader_storage_buffer_object not started
GL_ARB_stencil_texturing DONE (i965/gen8+, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_texture_buffer_range DONE (nv50, nvc0, i965, r600, radeonsi, llvmpipe)
GL_ARB_texture_query_levels DONE (all drivers that support GLSL 1.30)
GL_ARB_stencil_texturing DONE (i965/gen8+)
GL_ARB_texture_buffer_range DONE (nv50, nvc0, i965, r600, radeonsi)
GL_ARB_texture_query_levels DONE (i965)
GL_ARB_texture_storage_multisample DONE (all drivers that support GL_ARB_texture_multisample)
GL_ARB_texture_view DONE (i965, nv50, nvc0, llvmpipe, softpipe)
GL_ARB_texture_view DONE (i965)
GL_ARB_vertex_attrib_binding DONE (all drivers)
GL 4.4, GLSL 4.40:
GL 4.4:
GL_MAX_VERTEX_ATTRIB_STRIDE DONE (all drivers)
GL_ARB_buffer_storage DONE (i965, nv50, nvc0, r600, radeonsi)
GL_ARB_clear_texture DONE (i965)
GLSL 4.4 not started
GL_MAX_VERTEX_ATTRIB_STRIDE not started
GL_ARB_buffer_storage DONE (i965, nv30, nv50, nvc0, r300, r600, radeonsi)
GL_ARB_clear_texture not started
GL_ARB_enhanced_layouts not started
GL_ARB_multi_bind DONE (all drivers)
GL_ARB_query_buffer_object not started
GL_ARB_texture_mirror_clamp_to_edge DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_texture_stencil8 DONE (nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_vertex_type_10f_11f_11f_rev DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_texture_mirror_clamp_to_edge DONE (i965, nv30, nv50, nvc0, r300, r600, radeonsi, swrast)
GL_ARB_texture_stencil8 not started
GL_ARB_vertex_type_10f_11f_11f_rev DONE (i965, nv50, nvc0, r600, radeonsi)
GL 4.5, GLSL 4.50:
GL_ARB_ES3_1_compatibility not started
GL_ARB_clip_control DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_conditional_render_inverted DONE (i965, nv50, nvc0, llvmpipe, softpipe)
GL_ARB_cull_distance not started
GL_ARB_derivative_control DONE (i965, nv50, nvc0, r600)
GL_ARB_direct_state_access DONE (all drivers)
- Transform Feedback object DONE
- Buffer object DONE
- Framebuffer object DONE
- Renderbuffer object DONE
- Texture object DONE
- Vertex array object DONE
- Sampler object DONE
- Program Pipeline object DONE
- Query object DONE (will require changes when GL_ARB_query_buffer_object lands)
GL_ARB_get_texture_sub_image started (Brian Paul)
GL_ARB_shader_texture_image_samples not started
GL_ARB_texture_barrier DONE (nv50, nvc0, r600, radeonsi)
GL_KHR_context_flush_control DONE (all - but needs GLX/EXT extension to be useful)
GL_KHR_robust_buffer_access_behavior not started
GL_KHR_robustness 90% done (the ARB variant)
GL_EXT_shader_integer_mix DONE (all drivers that support GLSL)
These are the extensions cherry-picked to make GLES 3.1
GLES3.1, GLSL ES 3.1
GL_ARB_arrays_of_arrays started (Timothy)
GL_ARB_compute_shader in progress (jljusten)
GL_ARB_draw_indirect DONE (i965, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_explicit_uniform_location DONE (all drivers that support GLSL)
GL_ARB_framebuffer_no_attachments not started
GL_ARB_program_interface_query DONE (all drivers)
GL_ARB_shader_atomic_counters DONE (i965)
GL_ARB_shader_image_load_store in progress (curro)
GL_ARB_shader_image_size in progress (Martin Peres)
GL_ARB_shader_storage_buffer_object not started
GL_ARB_shading_language_packing DONE (all drivers)
GL_ARB_separate_shader_objects DONE (all drivers)
GL_ARB_stencil_texturing DONE (i965/gen8+, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
Multisample textures (GL_ARB_texture_multisample) DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_texture_storage_multisample DONE (all drivers that support GL_ARB_texture_multisample)
GL_ARB_vertex_attrib_binding DONE (all drivers)
GS5 Enhanced textureGather DONE (i965, nvc0, r600, radeonsi)
GS5 Packing/bitfield/conversion functions DONE (i965, nvc0, r600, radeonsi)
GL_EXT_shader_integer_mix DONE (all drivers that support GLSL)
Additional functions not covered above:
glMemoryBarrierByRegion
glGetTexLevelParameter[fi]v - needs updates to restrict to GLES enums
glGetBooleani_v - needs updates to restrict to GLES enums
More info about these features and the work involved can be found at
http://dri.freedesktop.org/wiki/MissingFunctionality

View File

@@ -11,6 +11,10 @@ no longer shipped or supported.
Run
scons osmesa mesagdi
to build classic mesa Windows GDI drivers; or
scons libgl-gdi
to build gallium based GDI driver.

View File

@@ -103,7 +103,7 @@ Mesa Version History
- Stencil-related functions now work in display lists
Changes:
- renamed aux.h as glaux.h (MS-DOS names can't start with aux)
- most filenames are in 8.3 format to accommodate MS-DOS
- most filenames are in 8.3 format to accomodate MS-DOS
- use GLubytes to store arrays of colors instead of GLints
1.2.2 August 2, 1995
@@ -1007,7 +1007,7 @@ Mesa Version History
- glGetTexImage was using pixel unpacking instead of packing params
- auto-mipmap generation for cube maps was incorrect
Changes:
- max texture units reduced to six to accommodate texture rectangles
- max texture units reduced to six to accomodate texture rectangles
- removed unfinished GL_MESA_sprite_point extension code

View File

@@ -97,22 +97,20 @@ shared libraries in a single pass.</p>
<dt><code>CC, CFLAGS, CXX, CXXFLAGS</code></dt>
<dd><p>These environment variables
control the C and C++ compilers used during the build. By default,
<code>gcc</code> and <code>g++</code> are used and the debug/optimisation
level is left unchanged.</p>
<code>gcc</code> and <code>g++</code> are used with the options
<code>"-g -O2"</code>.</p>
</dd>
<dt><code>LDFLAGS</code></dt>
<dd><p>An environment variable specifying flags to
pass when linking programs. These should be empty and
<code>PKG_CONFIG_PATH</code> is recommended to be used instead. If needed
it can be used to direct the linker to use libraries in nonstandard
directories. For example, <code>LDFLAGS="-L/usr/X11R6/lib"</code>.</p>
pass when linking programs. These are normally empty, but can be used
to direct the linker to use libraries in nonstandard directories. For
example, <code>LDFLAGS="-L/usr/X11R6/lib"</code>.</p>
</dd>
<dt><code>PKG_CONFIG_PATH</code></dt>
<dd><p>The
<code>pkg-config</code> utility is a hard requirement for cofiguring and
building mesa. It is used to search for external libraries
<dd><p>When available, the
<code>pkg-config</code> utility is used to search for external libraries
on the system. This environment variable is used to control the search
path for <code>pkg-config</code>. For instance, setting
<code>PKG_CONFIG_PATH=/usr/X11R6/lib/pkgconfig</code> will search for
@@ -137,32 +135,14 @@ one of these architectures is detected. This option ensures that
assembly will not be used.</p>
</dd>
<dt><code>--build=</code></dt>
<dt><code>--host=</code></dt>
<dd><p>By default, the build will compile code for the architecture that
it's running on. In order to build cross-compile Mesa on a x86-64 machine
that is to run on a i686, one would need to set the options to:</p>
<p><code>--build=x86_64-pc-linux-gnu --host=i686-pc-linux-gnu</code></p>
Note that these can vary from distribution to distribution. For more
information check with the
<a href="https://www.gnu.org/savannah-checkouts/gnu/autoconf/manual/autoconf-2.69/html_node/Specifying-Target-Triplets.html">
autoconf manual</a>.
Note that you will need to correctly set <code>PKG_CONFIG_PATH</code> as well.
<p>In some cases a single compiler is capable of handling both architectures
(multilib) in that case one would need to set the <code>CC,CXX</code> variables
appending the correct machine options. Seek your compiler documentation for
further information -
<a href="https://gcc.gnu.org/onlinedocs/gcc/Submodel-Options.html"> gcc
machine dependent options</a></p>
<p>In addition to specifying correct <code>PKG_CONFIG_PATH</code> for the target
architecture, the following should be sufficient to configure multilib Mesa</p>
<code>./configure CC="gcc -m32" CXX="g++ -m32" --build=x86_64-pc-linux-gnu --host=i686-pc-linux-gnu ...</code>
<dt><code>--enable-32-bit</code></dt>
<dt><code>--enable-64-bit</code></dt>
<dd><p>By default, the build will compile code as directed by the environment
variables
<code>CC</code>, <code>CFLAGS</code>, etc. If the compiler is
<code>gcc</code>, these options offer a helper to add the compiler flags
to force 32- or 64-bit code generation as used on the x86 and x86_64
architectures. Note that these options are mutually exclusive.</p>
</dd>
</dl>
@@ -214,9 +194,7 @@ kernel DRM modules are not available.
<dt><code>--enable-glx-tls</code> <dd><p>
Enable Thread Local Storage (TLS) in
GLX.
<dt><code>--with-expat=DIR</code>
<dd><p><strong>DEPRECATED</strong>, use <code>PKG_CONFIG_PATH</code> instead.</p>
<p>The DRI-enabled libGL uses expat to
<dt><code>--with-expat=DIR</code> <dd> The DRI-enabled libGL uses expat to
parse the DRI configuration files in <code>/etc/drirc</code> and
<code>~/.drirc</code>. This option allows a specific expat installation
to be used. For example, <code>--with-expat=/usr/local</code> will

View File

@@ -61,6 +61,7 @@
<li><a href="shading.html" target="_parent">Shading Language</a>
<li><a href="egl.html" target="_parent">EGL</a>
<li><a href="opengles.html" target="_parent">OpenGL ES</a>
<li><a href="openvg.html" target="_parent">OpenVG / Vega</a>
<li><a href="envvars.html" target="_parent">Environment Variables</a>
<li><a href="osmesa.html" target="_parent">Off-Screen Rendering</a>
<li><a href="debugging.html" target="_parent">Debugging Tips</a>

View File

@@ -218,93 +218,15 @@ commit ID of the commit of interest (as it appears in the mesa master branch).
The latest set of patches that have been nominated, accepted, or rejected for
the upcoming stable release can always be seen on the
<a href="http://cworth.org/~cworth/mesa-stable-queue/">Mesa Stable Queue</a>
<a href=http://cworth.org/~cworth/mesa-stable-queue/">Mesa Stable Queue</a>
page.
<h2>Criteria for accepting patches to the stable branch</h2>
<h2>Cherry-picking candidates for a stable branch</h2>
Mesa has a designated release manager for each stable branch, and the release
manager is the only developer that should be pushing changes to these
branches. Everyone else should simply nominate patches using the mechanism
described above.
The stable-release manager will work with the list of nominated patches, and
for each patch that meets the crtieria below will cherry-pick the patch with:
<code>git cherry-pick -x &lt;commit&gt;</code>. The <code>-x</code> option is
important so that the picked patch references the comit ID of the original
patch.
The stable-release manager may at times need to force-push changes to the
stable branches, for example, to drop a previously-picked patch that was later
identified as causing a regression). These force-pushes may cause changes to
be lost from the stable branch if developers push things directly. Consider
yourself warned.
The stable-release manager is also given broad discretion in rejecting patches
that have been nominated for the stable branch. The most basic rule is that
the stable branch is for bug fixes only, (no new features, no
regressions). Here is a non-exhaustive list of some reasons that a patch may
be rejected:
<ul>
<li>Patch introduces a regression. Any reported build breakage or other
regression caused by a particular patch, (game no longer work, piglit test
changes from PASS to FAIL), is justification for rejecting a patch.</li>
<li>Patch is too large, (say, larger than 100 lines)</li>
<li>Patch is not a fix. For example, a commit that moves code around with no
functional change should be rejected.</li>
<li>Patch fix is not clearly described. For example, a commit message
of only a single line, no description of the bug, no mention of bugzilla,
etc.</li>
<li>Patch has not obviously been reviewed, For example, the commit message
has no Reviewed-by, Signed-off-by, nor Tested-by tags from anyone but the
author.</li>
<li>Patch has not already been merged to the master branch. As a rule, bug
fixes should never be applied first to a stable branch. Patches should land
first on the master branch and then be cherry-picked to a stable
branch. (This is to avoid future releases causing regressions if the patch
is not also applied to master.) The only things that might look like
exceptions would be backports of patches from master that happen to look
significantly different.</li>
<li>Patch depends on too many other patches. Ideally, all stable-branch
patches should be self-contained. It sometimes occurs that a single, logical
bug-fix occurs as two separate patches on master, (such as an original
patch, then a subsequent fix-up to that patch). In such a case, these two
patches should be squashed into a single, self-contained patch for the
stable branch. (Of course, if the squashing makes the patch too large, then
that could be a reason to reject the patch.)</li>
<li>Patch includes new feature development, not bug fixes. New OpenGL
features, extensions, etc. should be applied to Mesa master and included in
the next major release. Stable releases are intended only for bug fixes.
Note: As an exception to this rule, the stable-release manager may accept
hardware-enabling "features". For example, backports of new code to support
a newly-developed hardware product can be accepted if they can be reasonably
determined to not have effects on other hardware.</li>
<li>Patch is a performance optimization. As a rule, performance patches are
not candidates for the stable branch. The only exception might be a case
where an application's performance was recently severely impacted so as to
become unusable. The fix for this performance regression could then be
considered for a stable branch. The optimization must also be
non-controversial and the patches still need to meet the other criteria of
being simple and self-contained</li>
<li>Patch introduces a new failure mode (such as an assert). While the new
assert might technically be correct, for example to make Mesa more
conformant, this is not the kind of "bug fix" we want in a stable
release. The potential problem here is that an OpenGL program that was
previously working, (even if technically non-compliant with the
specification), could stop working after this patch. So that would be a
regression that is unaacceptable for the stable branch.</li>
</ul>
<p>
Please use <code>git cherry-pick -x &lt;commit&gt;</code> for cherry-picking a commit
from master to a stable branch.
</p>
<h2>Making a New Mesa Release</h2>
@@ -315,205 +237,64 @@ These are the instructions for making a new Mesa release.
<h3>Get latest source files</h3>
<p>
Use git to get the latest Mesa files from the git repository, from whatever
branch is relevant. This document uses the convention X.Y.Z for the release
being created, which should be created from a branch named X.Y.
branch is relevant.
</p>
<h3>Perform basic testing</h3>
<h3>Verify and update version info in VERSION</h3>
<p>
The release manager should, at the very least, test the code by compiling it,
installing it, and running the latest piglit to ensure that no piglit tests
have regressed since the previous release.
Create a docs/relnotes/x.y.z.html file.
The bin/bugzilla_mesa.sh and bin/shortlog_mesa.sh scripts can be used to
create the HTML-formatted lists of bugfixes and changes to include in the file.
Link the new docs/relnotes/x.y.z.html file into the main <a href="relnotes.html">relnotes.html</a> file.
</p>
<p>
The release manager should do this testing with at least one hardware driver,
(say, whatever is contained in the local development machine), as well as on
both Gallium and non-Gallium software drivers. The software testing can be
performed by running piglit with the following environment-variable set:
</p>
<pre>
LIBGL_ALWAYS_SOFTWARE=1
</pre>
And Gallium vs. non-Gallium software drivers can be obtained by using the
following configure flags on separate builds:
<pre>
--with-dri-drivers=swrast
--with-gallium-drivers=swrast
</pre>
<p>
Note: If both options are given in one build, both swrast_dri.so drivers will
be compiled, but only one will be installed. The following command can be used
to ensure the correct driver is being tested:
</p>
<pre>
LIBGL_ALWAYS_SOFTWARE=1 glxinfo | grep "renderer string"
</pre>
If any regressions are found in this testing with piglit, stop here, and do
not perform a release until regressions are fixed.
<h3>Update version in file VERSION</h3>
<p>
Increment the version contained in the file VERSION at Mesa's top-level, then
commit this change.
</p>
<h3>Create release notes for the new release</h3>
<p>
Create a new file docs/relnotes/X.Y.Z.html, (follow the style of the previous
release notes). Note that the sha256sums section of the release notes should
be empty at this point.
Update <a href="index.html">docs/index.html</a>.
</p>
<p>
Two scripts are available to help generate portions of the release notes:
<pre>
./bin/bugzilla_mesa.sh
./bin/shortlog_mesa.sh
</pre>
<p>
The first script identifies commits that reference bugzilla bugs and obtains
the descriptions of those bugs from bugzilla. The second script generates a
log of all commits. In both cases, HTML-formatted lists are printed to stdout
to be included in the release notes.
Tag the files with the release name (in the form <b>mesa-x.y</b>)
with: <code>git tag -s mesa-x.y -m "Mesa x.y Release"</code>
Then: <code>git push origin mesa-x.y</code>
</p>
<p>
Commit these changes
</p>
<h3>Make the release archives, signatures, and the release tag</h3>
<h3>Make the tarballs</h3>
<p>
From inside the Mesa directory:
Make the distribution files. From inside the Mesa directory:
<pre>
./autogen.sh
make -j1 tarballs
make tarballs
</pre>
<p>
After the tarballs are created, the sha256 checksums for the files will
be computed and printed. These will be used in a step below.
After the tarballs are created, the md5 checksums for the files will
be computed.
Add them to the docs/relnotes/x.y.html file.
</p>
<p>
It's important at this point to also verify that the constructed tar file
actually builds:
Copy the distribution files to a temporary directory, unpack them,
compile everything, and run some demos to be sure everything works.
</p>
<pre>
tar xjf MesaLib-X.Y.Z.tar.bz2
cd Mesa-X.Y.Z
./configure --enable-gallium-llvm
make -j6
make install
</pre>
<h3>Update the website and announce the release</h3>
<p>
Some touch testing should also be performed at this point, (run glxgears or
more involved OpenGL programs against the installed Mesa).
Make a new directory for the release on annarchy.freedesktop.org with:
<br>
<code>
mkdir /srv/ftp.freedesktop.org/pub/mesa/x.y
</code>
</p>
<p>
Create detached GPG signatures for each of the archive files created above:
</p>
<pre>
gpg --sign --detach MesaLib-X.Y.Z.tar.gz
gpg --sign --detach MesaLib-X.Y.Z.tar.bz2
gpg --sign --detach MesaLib-X.Y.Z.zip
</pre>
<p>
Tag the commit used for the build:
</p>
<pre>
git tag -s mesa-X.Y.X -m "Mesa X.Y.Z release"
</pre>
<p>
Note: It would be nice to investigate and fix the issue that causes the
tarballs target to fail with multiple build process, such as with "-j4". It
would also be nice to incorporate all of the above commands into a single
makefile target. And instead of a custom "tarballs" target, we should
incorporate things into the standard "make dist" and "make distcheck" targets.
</p>
<h3>Add the sha256sums to the release notes</h3>
<p>
Edit docs/relnotes/X.Y.Z.html to add the sha256sums printed as part of "make
tarballs" in the previous step. Commit this change.
</p>
<h3>Push all commits and the tag creates above</h3>
<p>
This is the first step that cannot easily be undone. The release is going
forward from this point:
</p>
<pre>
git push origin X.Y --tags
</pre>
<h3>Install the release files and signatures on the distribution server</h3>
<p>
The following commands can be used to copy the release archive files and
signatures to the freedesktop.org server:
</p>
<pre>
scp MesaLib-X.Y.Z* people.freedesktop.org:
ssh people.freedesktop.org
cd /srv/ftp.freedesktop.org/pub/mesa
mkdir X.Y.Z
cd X.Y.Z
mv ~/MesaLib-X.Y.Z* .
</pre>
<h3>Back on mesa master, andd the new release notes into the tree</h3>
<p>
Something like the following steps will do the trick:
</p>
<pre>
cp docs/relnotes/X.Y.Z.html /tmp
git checkout master
cp /tmp/X.Y.Z.html docs/relnotes
git add docs/relnotes/X.Y.Z.html
</pre>
<p>
Also, edit docs/relnotes.html to add a link to the new release notes, and edit
docs/index.html to add a news entry. Then commit and push:
</p>
<pre>
git commit -a -m "docs: Import X.Y.Z release notes, add news item."
git push origin
</pre>
<h3>Update the mesa3d.org website</h3>
<p>
NOTE: The recent release managers have not been performing this step
themselves, but leaving this to Brian Paul, (who has access to the
sourceforge.net hosting for mesa3d.org). Brian is more than willing to grant
the permission necessary to future release managers to do this step on their
own.
Basically, to upload the tarball files with:
<br>
<code>
rsync -avP -e ssh MesaLib-x.y.* USERNAME@annarchy.freedesktop.org:/srv/ftp.freedesktop.org/pub/mesa/x.y/
</code>
</p>
<p>
@@ -525,22 +306,13 @@ sftp USERNAME,mesa3d@web.sourceforge.net
</code>
</p>
<h3>Announce the release</h3>
<p>
Make an announcement on the mailing lists:
<em>mesa-dev@lists.freedesktop.org</em>,
<em>mesa-users@lists.freedesktop.org</em>
and
<em>mesa-announce@lists.freedesktop.org</em>
Follow the template of previously-sent release announcements. The following
command can be used to generate the log of changes to be included in the
release announcement:
<pre>
git shortlog mesa-X.Y.Z-1..mesa-X.Y.Z
</pre>
</p>
</div>

View File

@@ -204,8 +204,9 @@ terribly relevant.</p>
few preprocessor defines.</p>
<ul>
<li>If <tt>GLX_USE_TLS</tt> is defined, method #3 is used.</li>
<li>If <tt>HAVE_PTHREAD</tt> is defined, method #2 is used.</li>
<li>If <tt>GLX_USE_TLS</tt> is defined, method #4 is used.</li>
<li>If <tt>HAVE_PTHREAD</tt> is defined, method #3 is used.</li>
<li>If <tt>WIN32_THREADS</tt> is defined, method #2 is used.</li>
<li>If none of the preceding are defined, method #1 is used.</li>
</ul>

View File

@@ -77,6 +77,13 @@ drivers will be installed to <code>${libdir}/egl</code>.</p>
</dd>
<dt><code>--enable-gallium-egl</code></dt>
<dd>
<p>Enable the optional <code>egl_gallium</code> driver.</p>
</dd>
<dt><code>--with-egl-platforms</code></dt>
<dd>
@@ -88,11 +95,8 @@ types such as <code>EGLNativeDisplayType</code> or
<code>EGLNativeWindowType</code> defined for.</p>
<p>The available platforms are <code>x11</code>, <code>drm</code>,
<code>wayland</code>, <code>null</code>, <code>android</code>,
<code>haiku</code>, and <code>gdi</code>. The <code>android</code> platform
can only be built as a system component, part of AOSP, while the
<code>haiku</code> and <code>gdi</code> platforms can only be built with SCons.
Unless for special needs, the build system should
<code>fbdev</code>, and <code>gdi</code>. The <code>gdi</code> platform can
only be built with SCons. Unless for special needs, the build system should
select the right platforms automatically.</p>
</dd>
@@ -115,6 +119,13 @@ is required if applications mix OpenGL and OpenGL ES.</p>
</dd>
<dt><code>--enable-openvg</code></dt>
<dd>
<p>OpenVG must be explicitly enabled by this option.</p>
</dd>
</dl>
<h2>Use EGL</h2>
@@ -183,6 +194,14 @@ probably required only for some of the demos found in mesa/demo repository.</p>
values are: <code>debug</code>, <code>info</code>, <code>warning</code>, and
<code>fatal</code>.</p>
</dd>
<dt><code>EGL_SOFTWARE</code></dt>
<dd>
<p>For drivers that support both hardware and software rendering, setting this
variable to true forces the use of software rendering.</p>
</dd>
</dl>
@@ -200,15 +219,38 @@ the X server directly using (XCB-)DRI2 protocol.</p>
</dd>
<dt><code>egl_gallium</code></dt>
<dd>
<p>This driver is based on Gallium3D. It supports all rendering APIs and
hardware supported by Gallium3D. It is the only driver that supports OpenVG.
The supported platforms are X11, DRM, FBDEV, and GDI.</p>
<p>This driver comes with its own hardware drivers
(<code>pipe_&lt;hw&gt;</code>) and client API modules
(<code>st_&lt;api&gt;</code>).</p>
</dd>
<h2>Packaging</h2>
<p>The ABI between the main library and its drivers are not stable. Nor is
there a plan to stabilize it at the moment.</p>
there a plan to stabilize it at the moment. Of the EGL drivers,
<code>egl_gallium</code> has its own hardware drivers and client API modules.
They are considered internal to <code>egl_gallium</code> and there is also no
stable ABI between them. These should be kept in mind when packaging for
distribution.</p>
<p>Generally, <code>egl_dri2</code> is preferred over <code>egl_gallium</code>
when the system already has DRI drivers. As <code>egl_gallium</code> is loaded
before <code>egl_dri2</code> when both are available, <code>egl_gallium</code>
is disabled by default.</p>
<h2>Developers</h2>
<p>The sources of the main library and drivers can be found at
<code>src/egl/</code>.</p>
<p>The sources of the main library and the classic drivers can be found at
<code>src/egl/</code>. The sources of the <code>egl</code> state tracker can
be found at <code>src/gallium/state_trackers/egl/</code>.</p>
<h3>Lifetime of Display Resources</h3>

View File

@@ -34,7 +34,6 @@ sometimes be useful for debugging end-user issues.
<li>LIBGL_NO_DRAWARRAYS - if set do not use DrawArrays GLX protocol (for debugging)
<li>LIBGL_SHOW_FPS - print framerate to stdout based on the number of glXSwapBuffers
calls per second.
<li>LIBGL_DRI3_DISABLE - disable DRI3 if set (the value does not matter)
</ul>

View File

@@ -327,6 +327,19 @@ Basically, applying a translation of (0.375, 0.375, 0.0) to your coordinates
will fix the problem.
</p>
<h2>3.6 How can I change the maximum framebuffer size in Mesa's
<tt>swrast</tt> backend?</h2>
<p>
These can be overridden by using the <tt>--with-max-width</tt> and
<tt>--with-max-height</tt> options. The two need not be equal.
</p><p>
Do note that Mesa uses these values to size some internal buffers,
so increasing these sizes will cause Mesa to require additional
memory. Furthermore, increasing these limits beyond <tt>4096</tt>
may introduce rasterization artifacts; see the leading comments in
<tt>src/mesa/swrast/s_tritemp.h</tt>.
</p>
<br>
<br>

View File

@@ -16,193 +16,6 @@
<h1>News</h1>
<h2>May 11, 2015</h2>
<p>
<a href="relnotes/10.5.5.html">Mesa 10.5.5</a> is released.
This is a bug-fix release.
</p>
<h2>April 24, 2015</h2>
<p>
<a href="relnotes/10.5.4.html">Mesa 10.5.4</a> is released.
This is a bug-fix release.
</p>
<h2>April 12, 2015</h2>
<p>
<a href="relnotes/10.5.3.html">Mesa 10.5.3</a> is released.
This is a bug-fix release.
</p>
<h2>March 28, 2015</h2>
<p>
<a href="relnotes/10.5.2.html">Mesa 10.5.2</a> is released.
This is a bug-fix release.
</p>
<h2>March 20, 2015</h2>
<p>
<a href="relnotes/10.4.7.html">Mesa 10.4.7</a> is released.
This is a bug-fix release.
</p>
<h2>March 13, 2015</h2>
<p>
<a href="relnotes/10.5.1.html">Mesa 10.5.1</a> is released.
This is a bug-fix release.
</p>
<h2>March 06, 2015</h2>
<p>
<a href="relnotes/10.5.0.html">Mesa 10.5.0</a> is released. This is a new
development release. See the release notes for more information about
the release.
</p>
<h2>March 06, 2015</h2>
<p>
<a href="relnotes/10.4.6.html">Mesa 10.4.6</a> is released.
This is a bug-fix release.
</p>
<h2>February 21, 2015</h2>
<p>
<a href="relnotes/10.4.5.html">Mesa 10.4.5</a> is released.
This is a bug-fix release.
</p>
<h2>February 06, 2015</h2>
<p>
<a href="relnotes/10.4.4.html">Mesa 10.4.4</a> is released.
This is a bug-fix release.
</p>
<h2>January 24, 2015</h2>
<p>
<a href="relnotes/10.4.3.html">Mesa 10.4.3</a> is released.
This is a bug-fix release.
</p>
<h2>January 12, 2015</h2>
<p>
<a href="relnotes/10.3.7.html">Mesa 10.3.7</a>
and <a href="relnotes/10.4.2.html">Mesa 10.4.2</a> are released.
These are bug-fix releases from the 10.3 and 10.4 branches, respectively.
<br>
NOTE: It is anticipated that 10.3.7 will be the final release in the 10.3
series. Users of 10.3 are encouraged to migrate to the 10.4 series in order
to obtain future fixes.
</p>
<h2>December 29, 2014</h2>
<p>
<a href="relnotes/10.3.6.html">Mesa 10.3.6</a>
and <a href="relnotes/10.4.1.html">Mesa 10.4.1</a> are released.
These are bug-fix releases from the 10.3 and 10.4 branches, respectively.
</p>
<h2>December 14, 2014</h2>
<p>
<a href="relnotes/10.4.html">Mesa 10.4</a> is released. This is a new
development release. See the release notes for more information about
the release.
</p>
<h2>December 5, 2014</h2>
<p>
<a href="relnotes/10.3.5.html">Mesa 10.3.5</a> is released.
This is a bug-fix release.
</p>
<h2>November 21, 2014</h2>
<p>
<a href="relnotes/10.3.4.html">Mesa 10.3.4</a> is released.
This is a bug-fix release.
</p>
<h2>November 8, 2014</h2>
<p>
<a href="relnotes/10.3.3.html">Mesa 10.3.3</a> is released.
This is a bug-fix release.
</p>
<h2>October 24, 2014</h2>
<p>
<a href="relnotes/10.3.2.html">Mesa 10.3.2</a> is released.
This is a bug-fix release.
</p>
<h2>October 12, 2014</h2>
<p>
<a href="relnotes/10.2.9.html">Mesa 10.2.9</a>
and <a href="relnotes/10.3.1.html">Mesa 10.3.1</a> are released.
These are bug-fix releases from the 10.2 and 10.3 branches, respectively.
<br>
NOTE: It is anticipated that 10.2.9 will be the final release in the 10.2
series. Users of 10.2 are encouraged to migrate to the 10.3 series in order
to obtain future fixes.
</p>
<h2>September 19, 2014</h2>
<p>
<a href="relnotes/10.3.html">Mesa 10.3</a> is released. This is a new
development release. See the release notes for more information about
the release.
</p>
<p>
Also, <a href="relnotes/10.2.8.html">Mesa 10.2.8</a> is released.
This is a bug fix release from the 10.2 branch.
</p>
<h2>September 6, 2014</h2>
<p>
<a href="relnotes/10.2.7.html">Mesa 10.2.7</a> is released.
This is a bug-fix release.
</p>
<h2>August 19, 2014</h2>
<p>
<a href="relnotes/10.2.6.html">Mesa 10.2.6</a> is released.
This is a bug-fix release.
</p>
<h2>August 2, 2014</h2>
<p>
<a href="relnotes/10.2.5.html">Mesa 10.2.5</a> is released.
This is a bug-fix release.
</p>
<h2>July 18, 2014</h2>
<p>
<a href="relnotes/10.2.4.html">Mesa 10.2.4</a> is released.
This is a bug-fix release.
</p>
<h2>July 7, 2014</h2>
<p>
<a href="relnotes/10.2.3.html">Mesa 10.2.3</a> is released.
This is a bug-fix release.
</p>
<h2>July 5, 2014</h2>
<p>
Mesa demos 8.2.0 is released.
See the <a href="http://lists.freedesktop.org/archives/mesa-announce/2014-July/000100.html">announcement</a> for more information about the release.
You can download it from <a href="ftp://ftp.freedesktop.org/pub/mesa/demos/8.2.0/">ftp.freedesktop.org/pub/mesa/demos/8.2.0/</a>.
</p>
<h2>June 24, 2014</h2>
<p>
<a href="relnotes/10.1.6.html">Mesa 10.1.6</a>
and <a href="relnotes/10.2.2.html">Mesa 10.2.2</a> are released.
These are bug-fix releases from the 10.1 and 10.2 branches, respectively.
</p>
<h2>June 6, 2014</h2>
<p>
<a href="relnotes/10.2.1.html">Mesa 10.2.1</a> is released. This release
@@ -216,31 +29,6 @@ only fixes a build error in the radeonsi driver that was introduced between
development release. See the release notes for more information about
the release.
</p>
<p>
Also, <a href="relnotes/10.1.5.html">Mesa 10.1.5</a> is released.
This is a bug fix release from the 10.1 branch.
</p>
<h2>May 20, 2014</h2>
<p>
<a href="relnotes/10.1.4.html">Mesa 10.1.4</a> is released.
This is a bug-fix release.
</p>
<h2>May 9, 2014</h2>
<p>
<a href="relnotes/10.1.3.html">Mesa 10.1.3</a> is released.
This is a bug-fix release, and is being released sooner than
originally scheduled to fix a performance regression (vmware
swapbuffers falling back to software) introduced to the
10.1.2 release.
</p>
<h2>May 5, 2014</h2>
<p>
<a href="relnotes/10.1.2.html">Mesa 10.1.2</a> is released.
This is a bug-fix release.
</p>
<h2>April 18, 2014</h2>
<p>
@@ -1372,7 +1160,7 @@ The <a href="faq.html">Mesa FAQ</a> has been rewritten.
- glGetTexImage was using pixel unpacking instead of packing params
- auto-mipmap generation for cube maps was incorrect
Changes:
- max texture units reduced to six to accommodate texture rectangles
- max texture units reduced to six to accomodate texture rectangles
- removed unfinished GL_MESA_sprite_point extension code
</pre>

View File

@@ -34,29 +34,16 @@
<h2>1.1 General</h2>
<ul>
<li><a href="http://www.python.org/">Python</a> - Python is required.
Version 2.6.4 or later should work.
</li>
<br>
<li><a href="http://www.makotemplates.org/">Python Mako module</a> -
Python Mako module is required. Version 0.7.3 or later should work.
</li>
</br>
<li><a href="http://www.scons.org/">SCons</a> is required for building on
Windows and optional for Linux (it's an alternative to autoconf/automake.)
</li>
<br>
<li>lex / yacc - for building the GLSL compiler.
<br>
<br>
On Linux systems, flex and bison are used.
Versions 2.5.35 and 2.4.1, respectively, (or later) should work.
<br>
<br>
On Windows with MinGW, install flex and bison with:
<pre>mingw-get install msys-flex msys-bison</pre>
For MSVC on Windows, install
<a href="http://winflexbison.sourceforge.net/">Win flex-bison</a>.
</li>
<li>python - Python is needed for building the Gallium components.
Version 2.6.4 or later should work.
</li>
</ul>
@@ -82,7 +69,7 @@ the needed dependencies:
<pre>
sudo yum install flex bison imake libtool xorg-x11-proto-devel libdrm-devel \
gcc-c++ xorg-x11-server-devel libXi-devel libXmu-devel libXdamage-devel git \
expat-devel llvm-devel python-mako
expat-devel llvm-devel
</pre>
@@ -127,13 +114,14 @@ by -debug for debug builds.
To build Mesa with SCons for Windows on Linux using the MinGW crosscompiler toolchain do
</p>
<pre>
scons platform=windows toolchain=crossmingw machine=x86 libgl-gdi
scons platform=windows toolchain=crossmingw machine=x86 mesagdi libgl-gdi
</pre>
<p>
This will create:
</p>
<ul>
<li>build/windows-x86-debug/gallium/targets/libgl-gdi/opengl32.dll &mdash; Mesa + Gallium + softpipe (or llvmpipe), binary compatible with Windows's opengl32.dll
<li>build/windows-x86-debug/mesa/drivers/windows/gdi/opengl32.dll &mdash; Mesa + swrast, binary compatible with Windows's opengl32.dll
<li>build/windows-x86-debug/gallium/targets/libgl-gdi/opengl32.dll &mdash; Mesa + Gallium + softpipe, binary compatible with Windows's opengl32.dll
</ul>
<p>
Put them all in the same directory to test them.

View File

@@ -49,7 +49,7 @@ stderr if the LIBGL_DEBUG environment variable is defined.
libGL.so is thread safe. The overhead of thread safety for common,
single-thread clients is negligible. However, the overhead of thread
safety for multi-threaded clients is significant. Each GL API call
requires two calls to pthread_get_specific() which can noticeably
requires two calls to pthread_get_specific() which can noticably
impact performance. Warning: libGL.so is thread safe but individual
DRI drivers may not be. Please consult the documentation for a driver
to learn if it is thread safe.

View File

@@ -43,7 +43,11 @@ It's the fastest software rasterizer for Mesa.
</p>
</li>
<li>
<p>LLVM: version 3.4 recommended; 3.3 or later required.</p>
<p>LLVM: version 2.9 recommended; 2.6 or later required.</p>
<p><b>NOTE</b>: LLVM 2.8 and earlier will not work on systems that support the
Intel AVX extensions (e.g. Sandybridge). LLVM's code generator will
fail when trying to emit AVX instructions. This was fixed in LLVM 2.9.
</p>
<p>
For Linux, on a recent Debian based distribution do:
</p>
@@ -58,37 +62,15 @@ It's the fastest software rasterizer for Mesa.
</pre>
<p>
For Windows you will need to build LLVM from source with MSVC or MINGW
(either natively or through cross compilers) and CMake, and set the LLVM
environment variable to the directory you installed it to.
For Windows you will need to build LLVM from source with MSVC or MINGW
(either natively or through cross compilers) and CMake, and set the LLVM
environment variable to the directory you installed it to.
LLVM will be statically linked, so when building on MSVC it needs to be
built with a matching CRT as Mesa, and you'll need to pass
<code>-DLLVM_USE_CRT_xxx=yyy</code> as described below.
</p>
-DLLVM_USE_CRT_RELEASE=MTd for debug and checked builds,
-DLLVM_USE_CRT_RELEASE=MTd for profile and release builds.
<table border="1">
<tr>
<th rowspan="2">LLVM build-type</th>
<th colspan="2" align="center">Mesa build-type</th>
</tr>
<tr>
<th>debug,checked</th>
<th>release,profile</th>
</tr>
<tr>
<th>Debug</th>
<td><code>-DLLVM_USE_CRT_DEBUG=MTd</code></td>
<td><code>-DLLVM_USE_CRT_DEBUG=MT</code></td>
</tr>
<tr>
<th>Release</th>
<td><code>-DLLVM_USE_CRT_RELEASE=MTd</code></td>
<td><code>-DLLVM_USE_CRT_RELEASE=MT</code></td>
</tr>
</table>
<p>
You can build only the x86 target by passing -DLLVM_TARGETS_TO_BUILD=X86
to cmake.
</p>
@@ -119,15 +101,13 @@ but the rest of these instructions assume that scons is used.
For Windows the procedure is similar except the target:
<pre>
scons platform=windows build=debug libgl-gdi
scons build=debug libgl-gdi
</pre>
<h1>Using</h1>
<h2>Linux</h2>
<p>On Linux, building will create a drop-in alternative for libGL.so into</p>
On Linux, building will create a drop-in alternative for libGL.so into
<pre>
build/foo/gallium/targets/libgl-xlib/libGL.so
@@ -137,45 +117,15 @@ or
lib/gallium/libGL.so
</pre>
<p>To use it set the LD_LIBRARY_PATH environment variable accordingly.</p>
To use it set the LD_LIBRARY_PATH environment variable accordingly.
<p>For performance evaluation pass build=release to scons, and use the corresponding
lib directory without the "-debug" suffix.</p>
For performance evaluation pass debug=no to scons, and use the corresponding
lib directory without the "-debug" suffix.
<h2>Windows</h2>
<p>
On Windows, building will create
<code>build/windows-x86-debug/gallium/targets/libgl-gdi/opengl32.dll</code>
which is a drop-in alternative for system's <code>opengl32.dll</code>. To use
it put it in the same directory as your application. It can also be used by
On Windows, building will create a drop-in alternative for opengl32.dll. To use
it put it in the same directory as the application. It can also be used by
replacing the native ICD driver, but it's quite an advanced usage, so if you
need to ask, don't even try it.
</p>
<p>
There is however an easy way to replace the OpenGL software renderer that comes
with Microsoft Windows 7 (or later) with llvmpipe (that is, on systems without
any OpenGL drivers):
</p>
<ul>
<li><p>copy build/windows-x86-debug/gallium/targets/libgl-gdi/opengl32.dll to C:\Windows\SysWOW64\mesadrv.dll</p></li>
<li><p>load this registry settings:</p>
<pre>REGEDIT4
; http://technet.microsoft.com/en-us/library/cc749368.aspx
; http://www.msfn.org/board/topic/143241-portable-windows-7-build-from-winpe-30/page-5#entry942596
[HKEY_LOCAL_MACHINE\SOFTWARE\Wow6432Node\Microsoft\Windows NT\CurrentVersion\OpenGLDrivers\MSOGL]
"DLL"="mesadrv.dll"
"DriverVersion"=dword:00000001
"Flags"=dword:00000001
"Version"=dword:00000002
</pre>
</li>
<li>Ditto for 64 bits drivers if you need them.</li>
</ul>
<h1>Profiling</h1>

59
docs/openvg.html Normal file
View File

@@ -0,0 +1,59 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>OpenVG State Tracker</title>
<link rel="stylesheet" type="text/css" href="mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="contents.html"></iframe>
<div class="content">
<h1>OpenVG State Tracker</h1>
<p>
The current version of the OpenVG state tracker implements OpenVG 1.1.
</p>
<p>
More information about OpenVG can be found at
<a href="http://www.khronos.org/openvg/">
http://www.khronos.org/openvg/</a> .
</p>
<p>
The OpenVG state tracker depends on the Gallium architecture and a working EGL implementation.
Please refer to <a href="egl.html">Mesa EGL</a> for more information about EGL.
</p>
<h2>Building the library</h2>
<ol>
<li>Run <code>configure</code> with <code>--enable-openvg</code> and
<code>--enable-gallium-egl</code>. If you do not need OpenGL, you can add
<code>--disable-opengl</code> to save the compilation time.</li>
<li>Build and install Mesa as usual.</li>
</ol>
<h3>Sample build</h3>
A sample build looks as follows:
<pre>
$ ./configure --disable-opengl --enable-openvg --enable-gallium-egl
$ make
$ make install
</pre>
<p>It will install <code>libOpenVG.so</code>, <code>libEGL.so</code>, and one
or more EGL drivers.</p>
<h2>OpenVG Demos</h2>
<p>OpenVG demos can be found in mesa/demos repository.</p>
</div>
</body>
</html>

View File

@@ -21,43 +21,8 @@ The release notes summarize what's new or changed in each Mesa release.
</p>
<ul>
<li><a href="relnotes/10.5.5.html">10.5.5 release notes</a>
<li><a href="relnotes/10.5.4.html">10.5.4 release notes</a>
<li><a href="relnotes/10.5.3.html">10.5.3 release notes</a>
<li><a href="relnotes/10.5.2.html">10.5.2 release notes</a>
<li><a href="relnotes/10.4.7.html">10.4.7 release notes</a>
<li><a href="relnotes/10.5.1.html">10.5.1 release notes</a>
<li><a href="relnotes/10.5.0.html">10.5.0 release notes</a>
<li><a href="relnotes/10.4.6.html">10.4.6 release notes</a>
<li><a href="relnotes/10.4.5.html">10.4.5 release notes</a>
<li><a href="relnotes/10.4.4.html">10.4.4 release notes</a>
<li><a href="relnotes/10.4.3.html">10.4.3 release notes</a>
<li><a href="relnotes/10.4.2.html">10.4.2 release notes</a>
<li><a href="relnotes/10.3.7.html">10.3.7 release notes</a>
<li><a href="relnotes/10.4.1.html">10.4.1 release notes</a>
<li><a href="relnotes/10.3.6.html">10.3.6 release notes</a>
<li><a href="relnotes/10.4.html">10.4 release notes</a>
<li><a href="relnotes/10.3.5.html">10.3.5 release notes</a>
<li><a href="relnotes/10.3.4.html">10.3.4 release notes</a>
<li><a href="relnotes/10.3.3.html">10.3.3 release notes</a>
<li><a href="relnotes/10.3.2.html">10.3.2 release notes</a>
<li><a href="relnotes/10.3.1.html">10.3.1 release notes</a>
<li><a href="relnotes/10.2.9.html">10.2.9 release notes</a>
<li><a href="relnotes/10.3.html">10.3 release notes</a>
<li><a href="relnotes/10.2.8.html">10.2.8 release notes</a>
<li><a href="relnotes/10.2.7.html">10.2.7 release notes</a>
<li><a href="relnotes/10.2.6.html">10.2.6 release notes</a>
<li><a href="relnotes/10.2.5.html">10.2.5 release notes</a>
<li><a href="relnotes/10.2.4.html">10.2.4 release notes</a>
<li><a href="relnotes/10.2.3.html">10.2.3 release notes</a>
<li><a href="relnotes/10.2.2.html">10.2.2 release notes</a>
<li><a href="relnotes/10.2.1.html">10.2.1 release notes</a>
<li><a href="relnotes/10.2.html">10.2 release notes</a>
<li><a href="relnotes/10.1.6.html">10.1.6 release notes</a>
<li><a href="relnotes/10.1.5.html">10.1.5 release notes</a>
<li><a href="relnotes/10.1.4.html">10.1.4 release notes</a>
<li><a href="relnotes/10.1.3.html">10.1.3 release notes</a>
<li><a href="relnotes/10.1.2.html">10.1.2 release notes</a>
<li><a href="relnotes/10.1.1.html">10.1.1 release notes</a>
<li><a href="relnotes/10.1.html">10.1 release notes</a>
<li><a href="relnotes/10.0.5.html">10.0.5 release notes</a>

View File

@@ -104,7 +104,7 @@ a07b4b6b9eb449b88a6cb5061e51c331 MesaLib-10.0.3.zip
<li>Add md5sums for 10.0.2. release.</li>
<li>cherry-ignore: Ignore several patches not yet ready for the stable branch</li>
<li>Drop another couple of patches.</li>
<li>cherry-ignore: Ignore 4 patches at the request of the author, (Anuj).</li>
<li>cherry-ignore: Ignore 4 patches at teh request of the author, (Anuj).</li>
<li>Update version to 10.0.3</li>
</ul>

View File

@@ -1,179 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.1.2 Release Notes / (May 5, 2014)</h1>
<p>
Mesa 10.1.2 is a bug fix release which fixes bugs found since the 10.1.1 release.
</p>
<p>
Mesa 10.1.2 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>MD5 checksums</h2>
<pre>
37d79f94b1f41852a89d1fc3900bea76 MesaLib-10.1.2.tar.gz
28b60d15ac9f364da1e0155911eaf44e MesaLib-10.1.2.tar.bz2
05300039085a65fc53c5472c4bb5747a MesaLib-10.1.2.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=27499">Bug 27499</a> - [855GM i915] GL_LINE_STIPPLE displays incorrect colors</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=75723">Bug 75723</a> - (regression since Linux 3.14?) brw_get_graphics_reset_status: Assertion `brw-&gt;hw_ctx != ((void *)0)' failed</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76894">Bug 76894</a> - Piglit/spec/EXT_framebuffer_object/fbo-bind-renderbuffer failed</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77702">Bug 77702</a> - [i965 Bisected]Piglit spec/NV_conditional_render_blitframebuffer fails</li>
</ul>
<h2>Changes</h2>
<p>Ander Conselvan de Oliveira (2):</p>
<ul>
<li>gbm/dri: Fix out-of-memory error path in dri_device_create()</li>
<li>egl: Protect use of gbm_dri with ifdef HAVE_DRM_PLATFORM</li>
</ul>
<p>Anuj Phogat (27):</p>
<ul>
<li>mesa: Fix glGetVertexAttribi(GL_VERTEX_ATTRIB_ARRAY_SIZE)</li>
<li>swrast: Add glBlitFramebuffer to commands affected by conditional rendering</li>
<li>mesa: Fix error condition for multisample proxy texture targets</li>
<li>i965: Put an assertion to check valid varying_to_slot[varying]</li>
<li>i965: Fix component mask and varying_to_slot mapping for gl_Layer</li>
<li>i965: Fix component mask and varying_to_slot mapping for gl_ViewportIndex</li>
<li>mesa: Add helper function _mesa_is_format_integer()</li>
<li>mesa: Add error condition for integer formats in glGetTexImage()</li>
<li>mesa: Add an error condition in glGetFramebufferAttachmentParameteriv()</li>
<li>mesa: Fix error code generation in glReadPixels()</li>
<li>glsl: Allow overlapping locations for vertex input attributes</li>
<li>mesa: Fix querying location of nth element of an array variable</li>
<li>mesa: Use location VERT_ATTRIB_GENERIC0 for vertex attribute 0</li>
<li>glsl: Compile error if fs defines conflicting qualifiers for gl_FragCoord</li>
<li>glsl: Compile error if fs uses gl_FragCoord before first redeclaration</li>
<li>mesa: Add entry for extension ARB_texture_stencil8</li>
<li>mesa: Add error condition for format=STENCIL_INDEX in glGetTexImage()</li>
<li>i965: Fix crash in do_blit_readpixels()</li>
<li>mesa: Add missing types in _mesa_texstore_xx_xx() functions</li>
<li>mesa: Allow srcFormat=GL_DEPTH_STENCIL in _mesa_texstore_xx_xx() functions</li>
<li>mesa: Add new helper function _mesa_unpack_depth_stencil_row()</li>
<li>mesa: Add support to unpack depth-stencil texture in to FLOAT_32_UNSIGNED_INT_24_8_REV</li>
<li>mesa: Allow FLOAT_32_UNSIGNED_INT_24_8_REV in get_tex_depth_stencil()</li>
<li>i965: Add glBlitFramebuffer to commands affected by conditional rendering</li>
<li>glsl: Use switch to allow adding more shader types</li>
<li>glsl: Link error if fs defines conflicting qualifiers for gl_FragCoord</li>
<li>glsl: Apply the link error conditions to GL_ARB_fragment_coord_conventions</li>
</ul>
<p>Benjamin Bellec (1):</p>
<ul>
<li>mesa: fix GetStringi error message with correct function name</li>
</ul>
<p>Brian Paul (1):</p>
<ul>
<li>swrast: allocate swrast_texture_image::ImageSlices array if needed</li>
</ul>
<p>Carl Worth (4):</p>
<ul>
<li>docs: Add the MD5 sums for the 10.1.1 release tar files.</li>
<li>cherry-ignore: Ignore a patch causing a regression</li>
<li>cherry-ignore: Drop an ignored patch now that piglit has been updated.</li>
<li>Update VERSION to 10.1.2</li>
</ul>
<p>Chris Forbes (1):</p>
<ul>
<li>glsl: Only allow `invariant` on shader in/out between stages.</li>
</ul>
<p>Eric Anholt (1):</p>
<ul>
<li>i965: Fix render-to-texture in non-FinishRenderTexture cases.</li>
</ul>
<p>Ian Romanick (1):</p>
<ul>
<li>dri3: Enable GLX_MESA_query_renderer on DRI3 too</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>i965: Don't enable reset notification support on Gen4-5.</li>
<li>i965: Actually emit PIPELINE_SELECT and 3DSTATE_VF_STATISTICS.</li>
</ul>
<p>Marek Olšák (10):</p>
<ul>
<li>r300g: don't crash when getting NULL colorbuffers</li>
<li>st/mesa: remove trailing NULL colorbuffers</li>
<li>r600g: fix edge flags and layered rendering on R600-R700</li>
<li>r600g: disable async DMA on R700</li>
<li>r600g: fix MSAA resolve on R6xx when the destination is 1D-tiled</li>
<li>r600g: fix flushing on RV670, RS780, RS880 again</li>
<li>r600g: fix buffer copying on R600-R700</li>
<li>r600g: fix for broken CULL_FRONT behavior on R6xx</li>
<li>r600g: fix for an MSAA hang on RV770</li>
<li>r600g: fix hang on RV740 by using DX_RASTERIZATION_KILL instead of SX_MISC</li>
</ul>
<p>Michel Dänzer (2):</p>
<ul>
<li>r600g: Disable LLVM by default at runtime for graphics</li>
<li>st/mesa: Fix NULL pointer dereference for incomplete framebuffers</li>
</ul>
<p>Neil Roberts (1):</p>
<ul>
<li>wayland: Fix the logic in disabling the prime capability</li>
</ul>
<p>Samuel Iglesias Gonsalvez (1):</p>
<ul>
<li>mesa: fix check for dummy renderbuffer in _mesa_FramebufferRenderbufferEXT()</li>
</ul>
<p>Thomas Hellstrom (1):</p>
<ul>
<li>st/xa: Cache render target surface</li>
</ul>
<p>nick (1):</p>
<ul>
<li>swrast: Fix vertex color in _swsetup_Translate()</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,90 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.1.3 Release Notes / (May 9, 2014)</h1>
<p>
Mesa 10.1.3 is a bug fix release which fixes bugs found since the 10.1.2 release.
</p>
<p>
Note: Mesa 10.1.3 is being released sooner than originally scheduled to make
available a fix for a performance rgression that was inadvertently introduced
to Mesa 10.1.2. The performance regression is reported to make vmware
swapbuffers fall back to software.
</p>
<p>
Mesa 10.1.3 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>MD5 checksums</h2>
<pre>
665fe1656aaa2c37b32042068aff92cb MesaLib-10.1.3.tar.gz
ba6dbe2b9cab0b4de840c996b9b6a3ad MesaLib-10.1.3.tar.bz2
4e6f26330a63d3c47e62ac4bdead39e8 MesaLib-10.1.3.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77245">Bug 77245</a> - Bogus GL_ARB_explicit_attrib_location layout identifier warnings</li>
</ul>
<h2>Changes</h2>
<p>Carl Worth (3):</p>
<ul>
<li>docs: Add MD5 sums for Mesa 10.1.2</li>
<li>get-pick-list.sh: Require explicit "10.1" for nominating stable patches</li>
<li>VERSION: Update to 10.1.3</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>mesa: Fix MaxNumLayers for 1D array textures.</li>
<li>i965: Fix depth (array slices) computation for 1D_ARRAY render targets.</li>
</ul>
<p>Tapani Pälli (1):</p>
<ul>
<li>glsl: fix bogus layout qualifier warnings</li>
</ul>
<p>Thomas Hellstrom (1):</p>
<ul>
<li>st/xa: Fix performance regression introduced by commit "Cache render target surface"</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,100 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.1.4 Release Notes / (May 20, 2014)</h1>
<p>
Mesa 10.1.4 is a bug fix release which fixes bugs found since the 10.1.3 release.
</p>
<p>
Mesa 10.1.4 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>MD5 checksums</h2>
<pre>
e934365d77f384bfaec844999440bef8 MesaLib-10.1.4.tar.gz
6fddee101f49b7409cd29994c34ddee7 MesaLib-10.1.4.tar.bz2
ba5f48e7d5e373922c804c2651fec6c1 MesaLib-10.1.4.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78225">Bug 78225</a> - Compile error due to undefined reference to `gbm_dri_backend', fix attached</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78537">Bug 78537</a> - no anisotropic filtering in a native Half-Life 2</li>
</ul>
<h2>Changes</h2>
<p>Brian Paul (1):</p>
<ul>
<li>mesa: fix double-freeing of dispatch tables inside glBegin/End.</li>
</ul>
<p>Carl Worth (3):</p>
<ul>
<li>docs: Add MD5 sums for 10.1.3</li>
<li>cherry-ignore: Roland and Michel agreed to drop these patches.</li>
<li>VERSION: Update to 10.1.4</li>
</ul>
<p>Emil Velikov (1):</p>
<ul>
<li>configure: error out if building GBM without dri</li>
</ul>
<p>Eric Anholt (1):</p>
<ul>
<li>i965/vs: Use samplers for UBOs in the VS like we do for non-UBO pulls.</li>
</ul>
<p>Ilia Mirkin (3):</p>
<ul>
<li>nv50/ir: make sure to reverse cond codes on all the OP_SET variants</li>
<li>nv50: fix setting of texture ms info to be per-stage</li>
<li>nv50/ir: fix integer mul lowering for u32 x u32 -&gt; high u32</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>radeonsi: Fix anisotropic filtering state setup</li>
</ul>
<p>Tom Stellard (2):</p>
<ul>
<li>configure.ac: Add LLVM_VERSION_PATCH to DEFINES</li>
<li>radeonsi: Enable geometry shaders with LLVM 3.4.1</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,105 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.1.5 Release Notes / (June 6, 2014)</h1>
<p>
Mesa 10.1.5 is a bug fix release which fixes bugs found since the 10.1.4 release.
</p>
<p>
Mesa 10.1.5 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
b0aceaa75bc9a9b2d9215a113e2ad488b5cf85c99005a7624f8cf7c37c5d0eaa MesaLib-10.1.5.tar.gz
bc6c5ec7836f254a49d055a29d9aa34c97c54c038f47ad3a00fa57a5fef15bbc MesaLib-10.1.5.tar.bz2
78b7255cab0af7918945452a84de7989096ebcdd27e99b31c56c0589274cbc77 MesaLib-10.1.5.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79115">Bug 79115</a> - </li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79421">Bug 79421</a> - </li>
</ul>
<h2>Changes</h2>
<p>Brian Paul (1):</p>
<ul>
<li>glsl: fix use-after free bug/crash in ast_declarator_list::hir()</li>
</ul>
<p>Carl Worth (5):</p>
<ul>
<li>docs: Add md5sums for 10.1.4 release</li>
<li>Merge remote-tracking branch 'origin/10.1' into 10.1</li>
<li>cherry-ignore: Ignore two commits.</li>
<li>Ignore a patch that is not needed for the 10.1 branch.</li>
<li>Update version to 10.1.5</li>
</ul>
<p>Emil Velikov (1):</p>
<ul>
<li>glx: do not leak dri3Display</li>
</ul>
<p>Ilia Mirkin (2):</p>
<ul>
<li>nv50/ir: fix s32 x s32 -&gt; high s32 multiply logic</li>
<li>nv50/ir: fix constant folding for OP_MUL subop HIGH</li>
</ul>
<p>James Legg (1):</p>
<ul>
<li>mesa: Fix unbinding GL_DEPTH_STENCIL_ATTACHMENT</li>
</ul>
<p>Jeremy Huddleston Sequoia (2):</p>
<ul>
<li>glapi: Avoid heap corruption in _glapi_table</li>
<li>darwin: Fix test for kCGLPFAOpenGLProfile support at runtime</li>
</ul>
<p>Pavel Popov (2):</p>
<ul>
<li>i965: Properly return *RESET* status in glGetGraphicsResetStatusARB</li>
<li>i965: Fix Line Stipple enable bit in 3DSTATE_SF for Haswell.</li>
</ul>
<p>Roland Scheidegger (1):</p>
<ul>
<li>llvmpipe: fix crash when not all attachments are populated in a fb</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,138 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.1.6 Release Notes / (June 24, 2014)</h1>
<p>
Mesa 10.1.6 is a bug fix release which fixes bugs found since the 10.1.5 release.
</p>
<p>
Mesa 10.1.6 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
cde60e06b340d7598802fe4a4484b3fb8befd714f9ab9caabe1f27d3149e8815 MesaLib-10.1.6.tar.bz2
e4e726d7805a442f7ed07d12f71335e6126796ec85328a5989eb5348a8042d00 MesaLib-10.1.6.tar.gz
bf7e3f721a7ad0c2057a034834b6fea688e64f26a66cf8d1caa2827e405e72dd MesaLib-10.1.6.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=54372">Bug 54372</a> - GLX_INTEL_swap_event crashes driver when swapping window buffers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=74005">Bug 74005</a> - [i965 Bisected]Piglit/glx_glx-make-glxdrawable-current fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78581">Bug 78581</a> - </li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79729">Bug 79729</a> - [i965] glClear on a multisample texture doesn't work</li>
</ul>
<h2>Changes</h2>
<p>Adrian Negreanu (7):</p>
<ul>
<li>add megadriver_stub_FILES</li>
<li>android: adapt to the megadriver mechanism</li>
<li>android: add libloader to libGLES_mesa and libmesa_egl_dri2</li>
<li>android: add src/gallium/auxiliary as include path for libmesa_dricore</li>
<li>android, egl: add correct drm include for libmesa_egl_dri2</li>
<li>android, mesa_gen_matypes: pull in timespec POSIX definition</li>
<li>android, dricore: undefined reference to _mesa_streaming_load_memcpy</li>
</ul>
<p>Beren Minor (1):</p>
<ul>
<li>egl/main: Fix eglMakeCurrent when releasing context from current thread.</li>
</ul>
<p>Carl Worth (3):</p>
<ul>
<li>docs: Add SHA256 checksums for the 10.1.5 release</li>
<li>cherry-ignore: Add a patch to ignore</li>
<li>Update VERSION to 10.1.6</li>
</ul>
<p>Daniel Manjarres (1):</p>
<ul>
<li>glx: Don't crash on swap event for a Window (non-GLXWindow)</li>
</ul>
<p>Emil Velikov (1):</p>
<ul>
<li>configure: error out when building opencl without LLVM</li>
</ul>
<p>Iago Toral Quiroga (1):</p>
<ul>
<li>mesa: Copy Geom.UsesEndPrimitive when cloning a geometry program.</li>
</ul>
<p>José Fonseca (3):</p>
<ul>
<li>mesa/main: Make get_hash.c values constant.</li>
<li>mesa: Make glGetIntegerv(GL_*_ARRAY_SIZE) return GL_BGRA.</li>
<li>mesa/main: Prevent sefgault on glGetIntegerv(GL_ATOMIC_COUNTER_BUFFER_BINDING).</li>
</ul>
<p>Kristian Høgsberg (1):</p>
<ul>
<li>mesa: Remove glClear optimization based on drawable size</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>configure: Only check for OpenCL without LLVM when the latter is certain</li>
</ul>
<p>Neil Roberts (1):</p>
<ul>
<li>i965: Set the fast clear color value for texture surfaces</li>
</ul>
<p>Roland Scheidegger (1):</p>
<ul>
<li>draw: (trivial) fix clamping of viewport index</li>
</ul>
<p>Tobias Klausmann (1):</p>
<ul>
<li>nv50/ir: clear subop when folding constant expressions</li>
</ul>
<p>Tom Stellard (2):</p>
<ul>
<li>clover: Prevent Clang from printing number of errors and warnings to stderr.</li>
<li>clover: Don't use llvm's global context</li>
</ul>
</div>
</body>
</html>

View File

@@ -17,7 +17,7 @@
<h1>Mesa 10.2.1 Release Notes / June 6, 2014</h1>
<p>
Mesa 10.2.1 is a bug fix release which fixes bugs found since the 10.2 release.
Mesa 10.2.1 is a bug fix release which fixes bugs found since the 10.1 release.
</p>
<p>
Mesa 10.2.1 implements the OpenGL 3.3 API, but the version reported by

View File

@@ -31,9 +31,6 @@ because compatibility contexts are not supported.
<h2>SHA256 checksums</h2>
<pre>
38c4a40364000f89cddaa1694f6f3cfb444981d1110238ce603093585477399c MesaLib-10.2.2.tar.bz2
2af2ec8b4db624c352e961eefbcce6c8d1f86d44c5542f6f378c50e1b958d453 MesaLib-10.2.2.tar.gz
d4c0372da59367a344d62ebcdf5cf61039c9cae6925f40f2dab8f8d95cf22da9 MesaLib-10.2.2.zip
</pre>

View File

@@ -1,130 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.2.3 Release Notes / July 7, 2014</h1>
<p>
Mesa 10.2.3 is a bug fix release which fixes bugs found since the 10.2.2 release.
</p>
<p>
Mesa 10.2.3 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
e482a96170c98b17d6aba0d6e4dda4b9a2e61c39587bb64ac38cadfa4aba4aeb MesaLib-10.2.3.tar.bz2
96cffacaa1c52ae659b3b0f91be2eebf5528b748934256751261fb79ea3d6636 MesaLib-10.2.3.tar.gz
82cab6ff14c8038ee39842dbdea0d447a78d119efd8d702d1497bc7c246434e9 MesaLib-10.2.3.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76223">Bug 76223</a> - </li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79823">Bug 79823</a> - </li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80015">Bug 80015</a> - </li>
</ul>
<h2>Changes</h2>
<p>Aaron Watry (1):</p>
<ul>
<li>radeon/llvm: Allocate space for kernel metadata operands</li>
</ul>
<p>Carl Worth (2):</p>
<ul>
<li>docs: Add sha256 sums for the 10.2.2 release</li>
<li>cherry-ignore: Add a patch that's been rejected</li>
</ul>
<p>Ilia Mirkin (4):</p>
<ul>
<li>nouveau: dup fd before passing it to device</li>
<li>nv50: disable dedicated ubo upload method</li>
<li>nv50: do an explicit flush on draw when there are persistent buffers</li>
<li>nvc0: add a memory barrier when there are persistent UBOs</li>
</ul>
<p>Jasper St. Pierre (1):</p>
<ul>
<li>glxext: Send the Drawable's ID in the GLX_BufferSwapComplete event</li>
</ul>
<p>Kenneth Graunke (3):</p>
<ul>
<li>i965: Don't emit SURFACE_STATEs for gather workarounds on Broadwell.</li>
<li>i965: Include marketing names for Broadwell GPUs.</li>
<li>i965/disasm: Fix INTEL_DEBUG=fs on Broadwell for ARB_fp applications.</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>radeon/llvm: Use the llvm.rsq.clamped intrinsic for RSQ</li>
</ul>
<p>Rob Clark (9):</p>
<ul>
<li>xa: fix segfault</li>
<li>freedreno: use OUT_RELOCW when buffer is written</li>
<li>freedreno/a3xx: fix depth/stencil GMEM positioning</li>
<li>freedreno/a3xx: fix depth/stencil gmem restore</li>
<li>freedreno/a3xx: fix blend opcode</li>
<li>freedreno: few caps fixes</li>
<li>freedreno/a3xx: texture fixes</li>
<li>freedreno: fix for null textures</li>
<li>freedreno/a3xx: vtx formats</li>
</ul>
<p>Roland Scheidegger (1):</p>
<ul>
<li>draw: (trivial) fix clamping of viewport index</li>
</ul>
<p>Takashi Iwai (1):</p>
<ul>
<li>llvmpipe: Fix zero-division in llvmpipe_texture_layout()</li>
</ul>
<p>Thomas Hellstrom (1):</p>
<ul>
<li>st/xa: Don't close the drm fd on failure v2</li>
</ul>
<p>Tobias Klausmann (1):</p>
<ul>
<li>nv50/ir: allow gl_ViewportIndex to work on non-provoking vertices</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,127 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.2.4 Release Notes / July 18, 2014</h1>
<p>
Mesa 10.2.4 is a bug fix release which fixes bugs found since the 10.2.3 release.
</p>
<p>
Mesa 10.2.4 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
06a2341244eb85c283f59f70161e06ded106f835ed9b6be1ef0243bd9344811a MesaLib-10.2.4.tar.bz2
33e3c8b4343503e7d7d17416c670438860a2fd99ec93ea3327f73c3abe33b5e4 MesaLib-10.2.4.tar.gz
e26791a4a62a61b82e506e6ba031812d09697d1a831e8239af67e5722a8ee538 MesaLib-10.2.4.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81157">Bug 81157</a> - [BDW]Piglit some spec_glsl-1.50_execution_built-in-functions* cases fail</li>
</ul>
<h2>Changes</h2>
<p>Abdiel Janulgue (3):</p>
<ul>
<li>i965/fs: Refactor check for potential copy propagated instructions.</li>
<li>i965/fs: skip copy-propate for logical instructions with negated src entries</li>
<li>i965/vec4: skip copy-propate for logical instructions with negated src entries</li>
</ul>
<p>Brian Paul (3):</p>
<ul>
<li>mesa: fix geometry shader memory leaks</li>
<li>st/mesa: fix geometry shader memory leak</li>
<li>gallium/u_blitter: fix some shader memory leaks</li>
</ul>
<p>Carl Worth (2):</p>
<ul>
<li>docs: Add sha256 checksums for the 10.2.3 release</li>
<li>Update VERSION to 10.2.4</li>
</ul>
<p>Eric Anholt (1):</p>
<ul>
<li>i965: Generalize the pixel_x/y workaround for all UW types.</li>
</ul>
<p>Ilia Mirkin (4):</p>
<ul>
<li>nv50/ir: retrieve shadow compare from first arg</li>
<li>nv50/ir: ignore bias for samplerCubeShadow on nv50</li>
<li>nvc0/ir: do quadops on the right texture coordinates for TXD</li>
<li>nvc0/ir: use manual TXD when offsets are involved</li>
</ul>
<p>Jordan Justen (1):</p>
<ul>
<li>i965: Add auxiliary surface field #defines for Broadwell.</li>
</ul>
<p>Kenneth Graunke (9):</p>
<ul>
<li>i965: Don't copy propagate abs into Broadwell logic instructions.</li>
<li>i965: Set execution size to 8 for instructions with force_sechalf set.</li>
<li>i965/fs: Set force_uncompressed and force_sechalf on samplepos setup.</li>
<li>i965/fs: Use WE_all for gl_SampleID header register munging.</li>
<li>i965: Add plumbing for Broadwell's auxiliary surface support.</li>
<li>i965: Drop SINT workaround for CMS layout on Broadwell.</li>
<li>i965: Hook up the MCS buffers in SURFACE_STATE on Broadwell.</li>
<li>i965: Add 2x MSAA support to the MCS allocation function.</li>
<li>i965: Enable compressed multisample support (CMS) on Broadwell.</li>
</ul>
<p>Marek Olšák (4):</p>
<ul>
<li>gallium: fix u_default_transfer_inline_write for textures</li>
<li>st/mesa: fix samplerCubeShadow with bias</li>
<li>radeonsi: fix samplerCubeShadow with bias</li>
<li>radeonsi: add support for TXB2</li>
</ul>
<p>Matt Turner (8):</p>
<ul>
<li>i965/vec4: Don't return void from a void function.</li>
<li>i965/vec4: Don't fix_math_operand() on Gen &gt;= 8.</li>
<li>i965/fs: Don't fix_math_operand() on Gen &gt;= 8.</li>
<li>i965/fs: Make try_constant_propagate() static.</li>
<li>i965/fs: Constant propagate into 2-src math instructions on Gen8.</li>
<li>i965/vec4: Constant propagate into 2-src math instructions on Gen8.</li>
<li>i965/fs: Don't use brw_imm_* unnecessarily.</li>
<li>i965/fs: Set correct number of regs_written for MCS fetches.</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,188 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.2.5 Release Notes / August 2, 2014</h1>
<p>
Mesa 10.2.5 is a bug fix release which fixes bugs found since the 10.2.4 release.
</p>
<p>
Mesa 10.2.5 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
b4459f0bf7f4a3c8fb78ece3c9d2eac3d0e5bf38cb470f2a72705e744bd0310d MesaLib-10.2.5.tar.bz2
7b4dd0cb683f8c7dc48a3e7a315742bed58ddcd7b756c462aca4177bd1acdc79 MesaLib-10.2.5.tar.gz
6180565914fb238dd77ccdaff96b6155d9a6e1b3e981ebbf6a6851301b384fed MesaLib-10.2.5.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80991">Bug 80991</a> - [BDW]Piglit spec_ARB_sample_shading_builtin-gl-sample-mask_2 fails</li>
</ul>
<h2>Changes</h2>
<p>Abdiel Janulgue (3):</p>
<ul>
<li>i965/fs: Refactor check for potential copy propagated instructions.</li>
<li>i965/fs: skip copy-propate for logical instructions with negated src entries</li>
<li>i965/vec4: skip copy-propate for logical instructions with negated src entries</li>
</ul>
<p>Adel Gadllah (1):</p>
<ul>
<li>i915: Fix up intelInitScreen2 for DRI3</li>
</ul>
<p>Anuj Phogat (2):</p>
<ul>
<li>i965: Fix z_offset computation in intel_miptree_unmap_depthstencil()</li>
<li>mesa: Don't use memcpy() in _mesa_texstore() for float depth texture data</li>
</ul>
<p>Brian Paul (3):</p>
<ul>
<li>mesa: fix geometry shader memory leaks</li>
<li>st/mesa: fix geometry shader memory leak</li>
<li>gallium/u_blitter: fix some shader memory leaks</li>
</ul>
<p>Carl Worth (6):</p>
<ul>
<li>docs: Add sha256 checksums for the 10.2.3 release</li>
<li>Update VERSION to 10.2.4</li>
<li>Add release notes for 10.2.4</li>
<li>docs: Add SHA256 checksums for the 10.2.4 release</li>
<li>cherry-ignore: Ignore a few patches picked in the previous stable release</li>
<li>Update version to 10.2.5</li>
</ul>
<p>Christian König (1):</p>
<ul>
<li>radeonsi: fix order of r600_need_dma_space and r600_context_bo_reloc</li>
</ul>
<p>Eric Anholt (1):</p>
<ul>
<li>i965: Generalize the pixel_x/y workaround for all UW types.</li>
</ul>
<p>Ian Romanick (2):</p>
<ul>
<li>mesa: Don't allow GL_TEXTURE_BORDER queries outside compat profile</li>
<li>mesa: Don't allow GL_TEXTURE_{LUMINANCE,INTENSITY}_* queries outside compat profile</li>
</ul>
<p>Ilia Mirkin (5):</p>
<ul>
<li>nv50/ir: retrieve shadow compare from first arg</li>
<li>nv50/ir: ignore bias for samplerCubeShadow on nv50</li>
<li>nvc0/ir: do quadops on the right texture coordinates for TXD</li>
<li>nvc0/ir: use manual TXD when offsets are involved</li>
<li>nvc0: make sure that the local memory allocation is aligned to 0x10</li>
</ul>
<p>Jason Ekstrand (2):</p>
<ul>
<li>main/format_pack: Fix a wrong datatype in pack_ubyte_R8G8_UNORM</li>
<li>main/get_hash_params: Add GL_SAMPLE_SHADING_ARB</li>
</ul>
<p>Jordan Justen (1):</p>
<ul>
<li>i965: Add auxiliary surface field #defines for Broadwell.</li>
</ul>
<p>José Fonseca (1):</p>
<ul>
<li>st/wgl: Clamp wglChoosePixelFormatARB's output nNumFormats to nMaxFormats.</li>
</ul>
<p>Kenneth Graunke (13):</p>
<ul>
<li>i965: Don't copy propagate abs into Broadwell logic instructions.</li>
<li>i965: Set execution size to 8 for instructions with force_sechalf set.</li>
<li>i965/fs: Set force_uncompressed and force_sechalf on samplepos setup.</li>
<li>i965/fs: Use WE_all for gl_SampleID header register munging.</li>
<li>i965: Add plumbing for Broadwell's auxiliary surface support.</li>
<li>i965: Drop SINT workaround for CMS layout on Broadwell.</li>
<li>i965: Hook up the MCS buffers in SURFACE_STATE on Broadwell.</li>
<li>i965: Add 2x MSAA support to the MCS allocation function.</li>
<li>i965: Enable compressed multisample support (CMS) on Broadwell.</li>
<li>i965: Add missing persample_shading field to brw_wm_debug_recompile.</li>
<li>i965/fs: Fix gl_SampleID for 2x MSAA and SIMD16 mode.</li>
<li>i965/fs: Fix gl_SampleMask handling for SIMD16 on Gen8+.</li>
<li>i965/fs: Set LastRT on the final FB write on Broadwell.</li>
</ul>
<p>Marek Olšák (14):</p>
<ul>
<li>gallium: fix u_default_transfer_inline_write for textures</li>
<li>st/mesa: fix samplerCubeShadow with bias</li>
<li>radeonsi: fix samplerCubeShadow with bias</li>
<li>radeonsi: add support for TXB2</li>
<li>r600g: switch SNORM conversion to DX and GLES behavior</li>
<li>radeonsi: fix CMASK and HTILE calculations for Hawaii</li>
<li>gallium/util: add a helper for calculating primitive count from vertex count</li>
<li>radeonsi: fix a hang with instancing on Hawaii</li>
<li>radeonsi: fix a hang with streamout on Hawaii</li>
<li>winsys/radeon: fix vram_size overflow with Hawaii</li>
<li>radeonsi: fix occlusion queries on Hawaii</li>
<li>r600g,radeonsi: switch all occurences of array_size to util_max_layer</li>
<li>radeonsi: fix build because of lack of draw_indirect infrastructure in 10.2</li>
<li>radeonsi: use DRAW_PREAMBLE on CIK</li>
</ul>
<p>Matt Turner (8):</p>
<ul>
<li>i965/vec4: Don't return void from a void function.</li>
<li>i965/vec4: Don't fix_math_operand() on Gen &gt;= 8.</li>
<li>i965/fs: Don't fix_math_operand() on Gen &gt;= 8.</li>
<li>i965/fs: Make try_constant_propagate() static.</li>
<li>i965/fs: Constant propagate into 2-src math instructions on Gen8.</li>
<li>i965/vec4: Constant propagate into 2-src math instructions on Gen8.</li>
<li>i965/fs: Don't use brw_imm_* unnecessarily.</li>
<li>i965/fs: Set correct number of regs_written for MCS fetches.</li>
</ul>
<p>Thorsten Glaser (1):</p>
<ul>
<li>nv50: fix build failure on m68k due to invalid struct alignment assumptions</li>
</ul>
<p>Tom Stellard (1):</p>
<ul>
<li>clover: Call end_query before getting timestamp result v2</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,118 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.2.6 Release Notes / August 19, 2014</h1>
<p>
Mesa 10.2.6 is a bug fix release which fixes bugs found since the 10.2.5 release.
</p>
<p>
Mesa 10.2.6 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
193314d2adba98e43697d726739ac46b4299aae324fa1821aa226890c28ac806 MesaLib-10.2.6.tar.bz2
f7a45a5977b485eb95ac024205c584a0c112fe3951c2313c797579bb16a7a448 MesaLib-10.2.6.tar.gz
6d086d6fcda8f317adfaaae40011decf2f2e2dc80819c4a7a77c76f73512e8d8 MesaLib-10.2.6.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81450">Bug 81450</a> - [BDW]Piglit spec_glsl-1.30_execution_tex-miplevel-selection_textureGrad_1DArray cases intel_do_flush_locked failed</li>
</ul>
<h2>Changes</h2>
<p>Anuj Phogat (15):</p>
<ul>
<li>mesa: Fix error condition for valid texture targets in glTexStorage* functions</li>
<li>mesa: Turn target_can_be_compressed() in to a utility function</li>
<li>mesa: Add error condition for using compressed internalformat in glTexStorage3D()</li>
<li>mesa: Fix condition for using compressed internalformat in glCompressedTexImage3D()</li>
<li>mesa: Add utility function _mesa_is_enum_format_snorm()</li>
<li>mesa: Don't allow snorm internal formats in glCopyTexImage*() in GLES3</li>
<li>mesa: Add a helper function _mesa_is_enum_format_unsized()</li>
<li>mesa: Add a gles3 error condition for sized internalformat in glCopyTexImage*()</li>
<li>mesa: Add gles3 error condition for GL_RGBA10_A2 buffer format in glCopyTexImage*()</li>
<li>mesa: Add utility function _mesa_is_enum_format_unorm()</li>
<li>mesa: Add gles3 condition for normalized internal formats in glCopyTexImage*()</li>
<li>mesa: Allow GL_TEXTURE_CUBE_MAP target with compressed internal formats</li>
<li>meta: Use _mesa_get_format_bits() to get the GL_RED_BITS</li>
<li>egl: Fix OpenGL ES version checks in _eglParseContextAttribList()</li>
<li>meta: Fix datatype computation in get_temp_image_type()</li>
</ul>
<p>Brian Paul (1):</p>
<ul>
<li>mesa: fix assertion in _mesa_drawbuffers()</li>
</ul>
<p>Carl Worth (2):</p>
<ul>
<li>docs: Add sha256 sums to the 10.2.5 release notes</li>
<li>Update VERSION to 10.2.6</li>
</ul>
<p>Ilia Mirkin (1):</p>
<ul>
<li>mesa/st: only convert AND(a, NOT(b)) into MAD when not using native integers</li>
</ul>
<p>Jordan Justen (1):</p>
<ul>
<li>i965/miptree: Layout 1D Array as 2D Array with height of 1</li>
</ul>
<p>Maarten Lankhorst (1):</p>
<ul>
<li>configure.ac: Do not require llvm on x32</li>
</ul>
<p>Marek Olšák (4):</p>
<ul>
<li>st/mesa: fix blit-based partial TexSubImage for 1D arrays</li>
<li>radeon,r200: fix buffer validation after CS flush</li>
<li>radeonsi: fix a hang with instancing in Unigine Heaven/Valley on Hawaii</li>
<li>radeonsi: fix CMASK and HTILE allocation on Tahiti</li>
</ul>
<p>Pali Rohár (1):</p>
<ul>
<li>configure: check for dladdr via AC_CHECK_FUNC/AC_CHECK_LIB</li>
</ul>
<p>Roland Scheidegger (1):</p>
<ul>
<li>gallivm: fix up out-of-bounds level when using conformant out-of-bound behavior</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,211 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.2.7 Release Notes / September 06, 2014</h1>
<p>
Mesa 10.2.7 is a bug fix release which fixes bugs found since the 10.2.6 release.
</p>
<p>
Mesa 10.2.7 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
cb67dfaabf88acba29aa2cf0dd58ee17b21ebf9594f8d1226c41794da8de3e9d MesaLib-10.2.7.tar.gz
27b958063a4c002071f14ed45c7d2a1ee52cd85e4ac8876e8a1c273495a7d43f MesaLib-10.2.7.tar.bz2
a2796a2d5bbbc2edd22857ecc267cba68dfe5d0296f5d84ba7510877b216cc40 MesaLib-10.2.7.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=36193">Bug 36193</a> - [i965] brw_eu_emit.c:182: validate_reg: Assertion `execsize &gt;= width' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=66184">Bug 66184</a> - src/mesa/state_tracker/st_glsl_to_tgsi.cpp:3216:simplify_cmp: Assertion `inst-&gt;dst.index &lt; 4096' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=70441">Bug 70441</a> - [Gen4-5 clip] Piglit spec_OpenGL_1.1_polygon-offset hits (execsize &gt;= width) assertion</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76188">Bug 76188</a> - EGL_EXT_image_dma_buf_import fd ownership is incorrect</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76789">Bug 76789</a> - [radeonsi] si_descriptors.c requires -std=gnu99 or -fms-extensions</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82139">Bug 82139</a> - [r600g, bisected] multiple ubo piglit regressions</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82255">Bug 82255</a> - [VP2] Chroma planes are vertically stretched during VDPAU playback</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82671">Bug 82671</a> - [r600g-evergreen][compute]Empty kernel execution causes crash</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82709">Bug 82709</a> - OpenCL not working on radeon hainan</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82814">Bug 82814</a> - glDrawBuffers(0, NULL) segfaults in _mesa_drawbuffers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83079">Bug 83079</a> - [NVC0] Dota 2 (Linux native and Wine) crash with Nouveau Drivers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83355">Bug 83355</a> - FTBFS: src/mesa/program/program_lexer.l:122:64: error: unknown type name 'YYSTYPE'</li>
</ul>
<h2>Changes</h2>
<p>Adam Jackson (1):</p>
<ul>
<li>radeonsi: Don't use anonymous struct trick in atom tracking</li>
</ul>
<p>Alex Deucher (2):</p>
<ul>
<li>radeonsi: add new CIK pci ids</li>
<li>radeonsi: add new SI pci ids</li>
</ul>
<p>Andreas Boll (1):</p>
<ul>
<li>winsys/radeon: fix nop packet padding for hawaii</li>
</ul>
<p>Anuj Phogat (1):</p>
<ul>
<li>i965: Bail on vec4 copy propagation for scratch writes with source modifiers</li>
</ul>
<p>Brian Paul (1):</p>
<ul>
<li>mesa: fix NULL pointer deref bug in _mesa_drawbuffers()</li>
</ul>
<p>Carl Worth (2):</p>
<ul>
<li>docs: Add sha256 sums for the 10.2.6 release</li>
<li>Makefile: Switch from md5sums to sha256sums</li>
</ul>
<p>Dave Airlie (1):</p>
<ul>
<li>i965: add missing parens in vec4 visitor</li>
</ul>
<p>Emil Velikov (17):</p>
<ul>
<li>configure.ac: bail out if building gallium_gbm without gallium_egl</li>
<li>android: gallium/nouveau: fix include folders, link against libstlport</li>
<li>android: egl/main: fixup the nouveau build</li>
<li>automake: gallium/freedreno: drop spurious include dirs</li>
<li>android: gallium/freedreno: add preliminary build</li>
<li>android: egl/main: add/enable freedreno</li>
<li>android: gallium/auxiliary: drop log2/log2f redefitions</li>
<li>android: drop HAL_PIXEL_FORMAT_RGBA_{5551,4444}</li>
<li>android: glsl: the stlport over the limited Android STL</li>
<li>android: dri/i915: do not build an 'empty' driver</li>
<li>cherry-ignore: remove patch that lacking previous dependencies</li>
<li>cherry-ignore: PIPE_SHADER_CAP_MAX_CONST_BUFFER_SIZE is not it 10.2</li>
<li>cherry-ignore: drop whitespace fix</li>
<li>cherry-ignore: reject a15088338eb</li>
<li>get-pick-list.sh: Require explicit "10.2" for nominating stable patches</li>
<li>mesa: fix make tarballs</li>
<li>Update VERSION to 10.2.7</li>
</ul>
<p>Ian Romanick (1):</p>
<ul>
<li>mesa: Handle uninitialized textures like other textures in get_tex_level_parameter_image</li>
</ul>
<p>Ilia Mirkin (9):</p>
<ul>
<li>nouveau: make sure to invalidate any vbo state as well</li>
<li>nouveau: don't keep stale pointer to free'd data</li>
<li>nvc0/ir: avoid infinite recursion when finding first uses of tex</li>
<li>nv50: zero out unbound samplers</li>
<li>nvc0: don't make 1d staging textures linear</li>
<li>nv50/ir: avoid creating instructions that can't be emitted</li>
<li>nv50: set the miptree address when clearing bo's in vp2 init</li>
<li>nv50: mt address may not be the underlying bo's start address</li>
<li>nv50: attach the buffer bo to the miptree structures</li>
</ul>
<p>Jan Vesely (1):</p>
<ul>
<li>gallivm: Fix build with latest LLVM</li>
</ul>
<p>José Fonseca (1):</p>
<ul>
<li>mesa: Move declaration to top of block.</li>
</ul>
<p>Kenneth Graunke (3):</p>
<ul>
<li>i965/vec4: Set NoMask for GS_OPCODE_SET_VERTEX_COUNT on Gen8+.</li>
<li>i965/vec4: Respect ir-&gt;force_writemask_all in Gen8 code generation.</li>
<li>i965/clip: Fix brw_clip_unfilled.c/compute_offset's assembly.</li>
</ul>
<p>Marek Olšák (3):</p>
<ul>
<li>r600g: fix constant buffer fetches</li>
<li>radeonsi: save scissor state and sample mask for u_blitter</li>
<li>glsl_to_tgsi: allocate and enlarge arrays for temporaries on demand</li>
</ul>
<p>Paulo Sergio Travaglia (2):</p>
<ul>
<li>android: gallium/radeon: attempt to fix the android build</li>
<li>android: egl/main: resolve radeon linking issues</li>
</ul>
<p>Pekka Paalanen (1):</p>
<ul>
<li>egl_dri2: fix EXT_image_dma_buf_import fds</li>
</ul>
<p>Robert Bragg (1):</p>
<ul>
<li>meta: save and restore swizzle for _GenerateMipmap</li>
</ul>
<p>Tom Stellard (7):</p>
<ul>
<li>radeon/compute: Fix reported values for MAX_GLOBAL_SIZE and MAX_MEM_ALLOC_SIZE</li>
<li>radeonsi/compute: Update reference counts for buffers in si_set_global_binding()</li>
<li>radeonsi/compute: Call si_pm4_free_state() after emitting compute state</li>
<li>clover: Flush the command queue in clReleaseCommandQueue()</li>
<li>radeon: Add work-around for missing Hainan support in clang &lt; 3.6 v2</li>
<li>pipe-loader: Fix memory leak v2</li>
<li>r600g/compute: Don't initialize vertex_buffer_state masks to 0x2</li>
</ul>
<p>Vinson Lee (1):</p>
<ul>
<li>gallivm: Fix build with LLVM &gt;= 3.6 r215967.</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,130 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.2.8 Release Notes / September 19, 2014</h1>
<p>
Mesa 10.2.8 is a bug fix release which fixes bugs found since the 10.2.7 release.
</p>
<p>
Mesa 10.2.8 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
4c5a25ccaf1a9734bbd10d62a1420cc8fd35a1060ce679f2fc846769a25fbeec MesaLib-10.2.8.tar.gz
1ef9ad3f241788d454f2ff8c9d65b6849dfc31c8fe91f70fd2930b81c8af1398 MesaLib-10.2.8.tar.bz2
d26218da3b44734b1d555267b4c63c48803c4c8b14d2bc53071be57014da37fa MesaLib-10.2.8.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77493">Bug 77493</a> - lp_test_arit fails with llvm &gt;= llvm-3.5svn r206094</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82539">Bug 82539</a> - vmw_screen_dri.lo In file included from vmw_screen_dri.c:41: vmwgfx_drm.h:32:17: error: drm.h: No such file or directory</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82882">Bug 82882</a> - [swrast] piglit glsl-fs-uniform-bool-1 regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83432">Bug 83432</a> - r600_query.c:269:r600_emit_query_end: Assertion `ctx-&gt;num_pipelinestat_queries &gt; 0' failed [Gallium HUD]</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83567">Bug 83567</a> - Mesa 10.2.6 does not compile with llvm 3.5</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83735">Bug 83735</a> - [mesa-10.2.x] broken with llvm-3.5 and old CPUs</li>
</ul>
<h2>Changes</h2>
<p>Aaron Watry (1):</p>
<ul>
<li>gallivm: Fix build after LLVM commit 211259</li>
</ul>
<p>Christoph Bumiller (2):</p>
<ul>
<li>nv50/ir/util: fix BitSet issues</li>
<li>nvc0/ir: clarify recursion fix to finding first tex uses</li>
</ul>
<p>Emil Velikov (3):</p>
<ul>
<li>docs: Add sha256 sums for the 10.2.7 release</li>
<li>configure: bail out if building svga without libdrm</li>
<li>Update VERSION to 10.2.8</li>
</ul>
<p>Ilia Mirkin (4):</p>
<ul>
<li>nv50/ir: avoid array overrun when checking for supported mods</li>
<li>nouveau: only enable the depth test if there actually is a depth buffer</li>
<li>nouveau: only enable stencil func if the visual has stencil bits</li>
<li>nouveau: change internal variables to avoid conflicts with macro args</li>
</ul>
<p>Jonathan Gray (1):</p>
<ul>
<li>configure.ac: strip _GNU_SOURCE from llvm-config output</li>
</ul>
<p>José Fonseca (1):</p>
<ul>
<li>gallivm: Disable workaround for PR12833 on LLVM 3.2+.</li>
</ul>
<p>Maarten Lankhorst (4):</p>
<ul>
<li>nouveau: re-allocate bo's on overflow</li>
<li>nouveau: fix MPEG4 hw decoding</li>
<li>nouveau: rework reference frame handling</li>
<li>nouveau: remove unneeded assert</li>
</ul>
<p>Marek Olšák (3):</p>
<ul>
<li>r600g,radeonsi: make sure there's enough CS space before resuming queries</li>
<li>mesa: set UniformBooleanTrue = 1.0f by default</li>
<li>st/mesa: use 1.0f as boolean true on drivers without integer support</li>
</ul>
<p>Richard Sandiford (1):</p>
<ul>
<li>gallivm: Fix uses of 2^24</li>
</ul>
<p>Roland Scheidegger (1):</p>
<ul>
<li>gallivm: set mcpu when initializing llvm execution engine</li>
</ul>
<p>Thomas Hellstrom (1):</p>
<ul>
<li>winsys/svga: Fix incorrect type usage in IOCTL v2</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,101 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.2.9 Release Notes / October 12, 2014</h1>
<p>
Mesa 10.2.9 is a bug fix release which fixes bugs found since the 10.2.8 release.
This is the final planned release for the 10.2 branch.
</p>
<p>
Mesa 10.2.9 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
f8d62857eed8f604a57710c58a8ffcfb8dab2dc4977ec27c956c7c4fd14032f6 MesaLib-10.2.9.tar.gz
f6031f8b7113a92325b60635c504c510490eebb2e707119bbff7bd86aa34657d MesaLib-10.2.9.tar.bz2
11c0ef4f3308fc29d9f15a77fd8f4842a946fce9e830250a1c95b171a446171a MesaLib-10.2.9.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79462">Bug 79462</a> - [NVC0/Codegen] Shader compilation falis in spill logic</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83570">Bug 83570</a> - Glyphy demo throws unhandled Integer division by zero exception</li>
</ul>
<h2>Changes</h2>
<p>Andreas Pokorny (2):</p>
<ul>
<li>egl/drm: expose KHR_image_pixmap extension</li>
<li>i915: Fix black buffers when importing prime fds</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: Add sha256 sums for the 10.2.8 release</li>
<li>Update VERSION to 10.2.9</li>
</ul>
<p>Ilia Mirkin (1):</p>
<ul>
<li>nv50/ir: avoid deleting pseudo instructions too early</li>
</ul>
<p>Marek Olšák (3):</p>
<ul>
<li>radeonsi: release GS rings at context destruction</li>
<li>radeonsi: properly destroy the GS copy shader and scratch_bo for compute</li>
<li>st/dri: remove GALLIUM_MSAA and __GL_FSAA_MODE environment variables</li>
</ul>
<p>Roland Scheidegger (1):</p>
<ul>
<li>gallivm: fix idiv</li>
</ul>
<p>Thomas Hellstrom (1):</p>
<ul>
<li>st/xa: Fix regression in xa_yuv_planar_blit()</li>
</ul>
<p>Tom Stellard (1):</p>
<ul>
<li>configure.ac: Compute LLVM_VERSION_PATCH using llvm-config</li>
</ul>
<p>rconde (1):</p>
<ul>
<li>gallivm,tgsi: fix idiv by zero crash</li>
</ul>
</div>
</body>
</html>

View File

@@ -88,8 +88,6 @@ following options during configure, if you would like support for svga driver
Note: The files are installed in $(libdir)/gallium-pipe/ and the interface
between them and libxatracker.so is <strong>not</strong> stable.
</p>
<li>The environment variable GALLIUM_MSAA that forced a multisample GLX visual was removed.</li>
</ul>
</div>

View File

@@ -1,158 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.3.1 Release Notes / October 12, 2014</h1>
<p>
Mesa 10.3.1 is a bug fix release which fixes bugs found since the 10.3 release.
</p>
<p>
Mesa 10.3.1 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
155afcbad17be8bb80282c761b957d5cc716c14a1fa16c4f5ee04e76df729c6d MesaLib-10.3.1.tar.gz
b081d077d717e5d56f2d59677490856052c41573e50378ff86d6c72456714add MesaLib-10.3.1.tar.bz2
07a14febfed06412d519e091a62d24513fee6745f1a6f8a8f1956bfe04b77d15 MesaLib-10.3.1.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79462">Bug 79462</a> - [NVC0/Codegen] Shader compilation falis in spill logic</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82932">Bug 82932</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.shaders.indexing.vector_subscript.vec3_static_loop_subscript_write_direct_read_vertex fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83506">Bug 83506</a> - [UBO] row_major layout ignored inside structures</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83533">Bug 83533</a> - [UBO] nested structures don't get appropriate padding</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83570">Bug 83570</a> - Glyphy demo throws unhandled Integer division by zero exception</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83741">Bug 83741</a> - [UBO] row_major layout partially ignored for arrays of structures</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84178">Bug 84178</a> - Big glamor regression in Xorg server 1.6.99.1 GIT: x11perf 1.5 Test: PutImage XY 500x500 Square</li>
</ul>
<h2>Changes</h2>
<p>Andreas Pokorny (2):</p>
<ul>
<li>egl/drm: expose KHR_image_pixmap extension</li>
<li>i915: Fix black buffers when importing prime fds</li>
</ul>
<p>Brian Paul (1):</p>
<ul>
<li>mesa: fix prog_optimize.c assertions triggered by SWZ opcode</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: Add 10.3 sha256 sums, news item and link release notes</li>
<li>Update VERSION to 10.3.1</li>
</ul>
<p>Ian Romanick (4):</p>
<ul>
<li>glsl: Make sure fields after small structs have correct padding</li>
<li>glsl: Make sure row-major array-of-structure get correct layout</li>
<li>glsl: Round struct size up to at least 16 bytes</li>
<li>glsl: Strip arrayness from ir_type_dereference_variable too</li>
</ul>
<p>Ilia Mirkin (5):</p>
<ul>
<li>nv50/ir: avoid deleting pseudo instructions too early</li>
<li>gm107/ir: fix manual TXD for array targets</li>
<li>gm107/ir: fix texture argument order</li>
<li>gm107/ir: add support for indirect const buffer selection</li>
<li>gm107/ir: take relative pfetch offset into account</li>
</ul>
<p>Keith Packard (1):</p>
<ul>
<li>glx/dri3: Provide error diagnostics when DRI3 allocation fails</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>mesa: Use proper structure for glGet*(GL_TEXTURE_COORD_ARRAY*).</li>
<li>mesa: Set correct array element in vbo_exec_vtx_init.</li>
</ul>
<p>Marek Olšák (3):</p>
<ul>
<li>radeonsi: release GS rings at context destruction</li>
<li>radeonsi: properly destroy the GS copy shader and scratch_bo for compute</li>
<li>st/dri: remove GALLIUM_MSAA and __GL_FSAA_MODE environment variables</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>st/mesa: Use PIPE_USAGE_STAGING for GL_STATIC/DYNAMIC/STREAM_READ buffers</li>
</ul>
<p>Richard Sandiford (2):</p>
<ul>
<li>mesa: Fix alpha component in unpack_R8G8B8X8_SRGB.</li>
<li>swrast: Fix handling of MESA_FORMAT_L8A8_SRGB for big-endian</li>
</ul>
<p>Roland Scheidegger (1):</p>
<ul>
<li>gallivm: fix idiv</li>
</ul>
<p>Thomas Hellstrom (1):</p>
<ul>
<li>st/xa: Fix regression in xa_yuv_planar_blit()</li>
</ul>
<p>Tom Stellard (2):</p>
<ul>
<li>clover: Add support to mem objects for multiple destructor callbacks v2</li>
<li>configure.ac: Compute LLVM_VERSION_PATCH using llvm-config</li>
</ul>
<p>Tomasz Figa (3):</p>
<ul>
<li>util: Include in Android builds</li>
<li>st/mesa: Generate format_info.c in Android builds</li>
<li>st/mesa: Fix paths used in Android builds</li>
</ul>
<p>rconde (1):</p>
<ul>
<li>gallivm,tgsi: fix idiv by zero crash</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,115 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.3.2 Release Notes / October 24, 2014</h1>
<p>
Mesa 10.3.2 is a bug fix release which fixes bugs found since the 10.3 release.
</p>
<p>
Mesa 10.3.2 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
e65f8e691f06f111c1aeb3a376b13c9cc88cb162bee2709e0e7e6b0e6628ca75 MesaLib-10.3.2.tar.gz
e9849bcb9aa9acd98a753d6d46d2e7d7238d3367036e11357a60efd16de8bea3 MesaLib-10.3.2.tar.bz2
427dc0d670d38e713ebff2675665ec2fe4ff7d04ce227bd54de946999fc1d234 MesaLib-10.3.2.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=54372">Bug 54372</a> - GLX_INTEL_swap_event crashes driver when swapping window buffers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81680">Bug 81680</a> - [r600g] Firefox crashes with hardware acceleration turned on</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84140">Bug 84140</a> - mplayer crashes playing some files using vdpau output</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84662">Bug 84662</a> - Long pauses with Unreal demo Elemental on R9270X since : Always flush the HDP cache before submitting a CS to the GPU</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85267">Bug 85267</a> - vlc crashes with vdpau (Radeon 3850HD) [r600]</li>
</ul>
<h2>Changes</h2>
<p>Brian Paul (3):</p>
<ul>
<li>mesa: fix spurious wglGetProcAddress / GL_INVALID_OPERATION error</li>
<li>st/wgl: add WINAPI qualifiers on wgl function typedefs</li>
<li>glsl: fix several use-after-free bugs</li>
</ul>
<p>Daniel Manjarres (1):</p>
<ul>
<li>glx: Fix glxUseXFont for glxWindow and glxPixmaps</li>
</ul>
<p>Dave Airlie (1):</p>
<ul>
<li>mesa: fix GetTexImage for 1D array depth textures</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: Add sha256 sums for the 10.3.1 release</li>
<li>Update VERSION to 10.3.2</li>
</ul>
<p>Ilia Mirkin (4):</p>
<ul>
<li>gm107/ir: add dnz emission for fmul</li>
<li>gk110/ir: add dnz flag emission for fmul/fmad</li>
<li>nouveau: 3d textures are unsupported, limit 3d levels to 1</li>
<li>st/gbm: fix order of arguments passed to is_format_supported</li>
</ul>
<p>Kenneth Graunke (3):</p>
<ul>
<li>i965: Add a BRW_MOCS_PTE #define.</li>
<li>i965: Use BDW_MOCS_PTE for renderbuffers.</li>
<li>i965: Fix register write checks.</li>
</ul>
<p>Marek Olšák (2):</p>
<ul>
<li>st/mesa: use pipe_sampler_view_release for releasing sampler views</li>
<li>glsl_to_tgsi: fix the value of gl_FrontFacing with native integers</li>
</ul>
<p>Michel Dänzer (4):</p>
<ul>
<li>radeonsi: Clear sampler view flags when binding a buffer</li>
<li>r600g,radeonsi: Always use GTT again for PIPE_USAGE_STREAM buffers</li>
<li>winsys/radeon: Use separate caching buffer manager for each set of flags</li>
<li>r600g: Drop references to destroyed blend state</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,209 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.3.3 Release Notes / November 8, 2014</h1>
<p>
Mesa 10.3.3 is a bug fix release which fixes bugs found since the 10.3.2 release.
</p>
<p>
Mesa 10.3.3 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
23a0c36d88cd5d8968ae6454160de2878192fd1d37b5d606adca1f1b7e788b79 MesaLib-10.3.3.tar.gz
0e4eee4a2ddf86456eed2fc44da367f95471f74249636710491e85cc256c4753 MesaLib-10.3.3.tar.bz2
a83648f17d776b7cf6c813fbb15782d2644b937dc6a7c53d8c0d1b35411f4840 MesaLib-10.3.3.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=70410">Bug 70410</a> - egl-static/Makefile: linking fails with llvm &gt;= 3.4</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82921">Bug 82921</a> - layout(location=0) emits error &gt;= MAX_UNIFORM_LOCATIONS due to integer underflow</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83574">Bug 83574</a> - [llvmpipe] [softpipe] piglit arb_explicit_uniform_location-use-of-unused-loc regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85454">Bug 85454</a> - Unigine Sanctuary with Wine crashes on Mesa Git</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85918">Bug 85918</a> - Mesa: MSVC 2010/2012 Compile error</li>
</ul>
<h2>Changes</h2>
<p>Anuj Phogat (2):</p>
<ul>
<li>glsl: Fix crash due to negative array index</li>
<li>glsl: Use signed array index in update_max_array_access()</li>
</ul>
<p>Brian Paul (1):</p>
<ul>
<li>mesa: fix UNCLAMPED_FLOAT_TO_UBYTE() macro for MSVC</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: Add sha256 sums for the 10.3.2 release</li>
<li>Update version to 10.3.3</li>
</ul>
<p>Ilia Mirkin (27):</p>
<ul>
<li>freedreno/ir3: fix FSLT/etc handling to return 0/-1 instead of 0/1.0</li>
<li>freedreno/ir3: INEG operates on src0, not src1</li>
<li>freedreno/ir3: add UARL support</li>
<li>freedreno/ir3: negate result of USLT/etc</li>
<li>freedreno/ir3: use unsigned comparison for UIF</li>
<li>freedreno/ir3: add TXL support</li>
<li>freedreno/ir3: fix UCMP handling</li>
<li>freedreno/ir3: implement UMUL correctly</li>
<li>freedreno: add default .dir-locals.el for emacs settings</li>
<li>freedreno/ir3: make texture instruction construction more dynamic</li>
<li>freedreno/ir3: fix TXB/TXL to actually pull the bias/lod argument</li>
<li>freedreno/ir3: add TXQ support</li>
<li>freedreno/ir3: add TXB2 support</li>
<li>freedreno: dual-source render targets are not supported</li>
<li>freedreno: instanced drawing/compute not yet supported</li>
<li>freedreno/ir3: avoid fan-in sources referring to same instruction</li>
<li>freedreno/ir3: add IDIV/UDIV support</li>
<li>freedreno/ir3: add UMOD support, based on UDIV</li>
<li>freedreno/ir3: add MOD support</li>
<li>freedreno/ir3: add ISSG support</li>
<li>freedreno/ir3: add UMAD support</li>
<li>freedreno/ir3: make TXQ return integers, not floats</li>
<li>freedreno/ir3: shadow comes before array</li>
<li>freedreno/ir3: add texture offset support</li>
<li>freedreno/ir3: add TXD support and expose ARB_shader_texture_lod</li>
<li>freedreno/ir3: add TXF support</li>
<li>freedreno: positions come out as integers, not half-integers</li>
</ul>
<p>Jan Vesely (1):</p>
<ul>
<li>configure: include llvm systemlibs when using static llvm</li>
</ul>
<p>Marek Olšák (5):</p>
<ul>
<li>r600g: fix polygon mode for points and lines and point/line fill modes</li>
<li>radeonsi: fix polygon mode for points and lines and point/line fill modes</li>
<li>radeonsi: fix incorrect index buffer max size for lowered 8-bit indices</li>
<li>Revert "st/mesa: set MaxUnrollIterations = 255"</li>
<li>r300g: remove enabled/disabled hyperz and AA compression messages</li>
</ul>
<p>Mauro Rossi (1):</p>
<ul>
<li>gallium/nouveau: fully build the driver under android</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>radeon/llvm: Dynamically allocate branch/loop stack arrays</li>
</ul>
<p>Rob Clark (62):</p>
<ul>
<li>freedreno/ir3: detect scheduler fail</li>
<li>freedreno/ir3: add TXB</li>
<li>freedreno/ir3: add DDX/DDY</li>
<li>freedreno/ir3: bit of debug</li>
<li>freedreno/ir3: fix error in bail logic</li>
<li>freedreno/ir3: fix constlen with relative addressing</li>
<li>freedreno/ir3: add no-copy-propagate fallback step</li>
<li>freedreno: don't overflow cmdstream buffer so much</li>
<li>freedreno/ir3: fix potential segfault in RA</li>
<li>freedreno: update generated headers</li>
<li>freedreno/a3xx: enable hw primitive-restart</li>
<li>freedreno/a3xx: handle rendering to layer != 0</li>
<li>freedreno: update generated headers</li>
<li>freedreno/a3xx: format fixes</li>
<li>util/u_format: add _is_alpha()</li>
<li>freedreno/a3xx: alpha render-target shenanigans</li>
<li>freedreno/ir3: catch incorrect usage of tmp-dst</li>
<li>freedreno/ir3: add missing put_dst</li>
<li>freedreno: "fix" problems with excessive flushes</li>
<li>freedreno: update generated headers</li>
<li>freedreno/a3xx: 3d/array textures</li>
<li>freedreno: add DRM_CONF_SHARE_FD</li>
<li>freedreno/a3xx: more texture array fixes</li>
<li>freedreno/a3xx: initial texture border-color</li>
<li>freedreno: fix compiler warning</li>
<li>freedreno: don't advertise mirror-clamp support</li>
<li>freedreno: update generated headers</li>
<li>freedreno: we have more than 0 viewports!</li>
<li>freedreno: turn missing caps into compile warnings</li>
<li>freedreno/a3xx: add LOD_BIAS</li>
<li>freedreno/a3xx: add flat interpolation mode</li>
<li>freedreno/a3xx: add 32bit integer vtx formats</li>
<li>freedreno/a3xx: fix border color order</li>
<li>freedreno: move bind_sampler_states to per-generation</li>
<li>freedreno: add texcoord clamp support to lowering</li>
<li>freedreno/a3xx: add support to emulate GL_CLAMP</li>
<li>freedreno/a3xx: re-emit shaders on variant change</li>
<li>freedreno/lowering: fix token calculation for lowering</li>
<li>freedreno: destroy transfer pool after blitter</li>
<li>freedreno: max-texture-lod-bias should be 15.0f</li>
<li>freedreno: update generated headers</li>
<li>freedreno/a3xx: handle large shader program sizes</li>
<li>freedreno/a3xx: emit all immediates in one shot</li>
<li>freedreno/ir3: fix lockups with lame FRAG shaders</li>
<li>freedreno/a3xx: handle VS only outputting BCOLOR</li>
<li>freedreno: query fixes</li>
<li>freedreno/a3xx: refactor vertex state emit</li>
<li>freedreno/a3xx: refactor/optimize emit</li>
<li>freedreno/ir3: optimize shader key comparision</li>
<li>freedreno: inline fd_draw_emit()</li>
<li>freedreno: fix layer_stride</li>
<li>freedreno: update generated headers</li>
<li>freedreno/ir3: large const support</li>
<li>freedreno/a3xx: more layer/level fixes</li>
<li>freedreno/ir3: comment + better fxn name</li>
<li>freedreno/ir3: fix potential gpu lockup with kill</li>
<li>freedreno/a3xx: disable early-z when we have kill's</li>
<li>freedreno/ir3: add debug flag to disable cp</li>
<li>freedreno: clear vs scissor</li>
<li>freedreno: mark scissor state dirty when enable bit changes</li>
<li>freedreno/a3xx: fix viewport state during clear</li>
<li>freedreno/a3xx: fix depth/stencil restore format</li>
</ul>
<p>Tapani Pälli (2):</p>
<ul>
<li>glsl: fix uniform location count used for glsl types</li>
<li>mesa: check that uniform exists in glUniform* functions</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,106 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.3.4 Release Notes / November 21, 2014</h1>
<p>
Mesa 10.3.4 is a bug fix release which fixes bugs found since the 10.3.3 release.
</p>
<p>
Mesa 10.3.4 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
26482495ef6177f889dbd87c7edcccfedd995598785bbbd7e3e066352574c8e0 MesaLib-10.3.4.tar.gz
e6373913142338d10515daf619d659433bfd2989988198930c13b0945a15e98a MesaLib-10.3.4.tar.bz2
8c3ebbb6535daf3414305860ebca6ac67dbb6e3d35058c7a6ce18b84b5945b7f MesaLib-10.3.4.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76252">Bug 76252</a> - Dynamic loading/unloading of opengl32.dll results in a deadlock</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78770">Bug 78770</a> - [SNB bisected]Webglc conformance/textures/texture-size-limit.html fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83500">Bug 83500</a> - si_dma_copy_tile causes GPU hangs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85647">Bug 85647</a> - Random radeonsi crashes with mesa 10.3.x</li>
</ul>
<h2>Changes</h2>
<p>Brian Paul (1):</p>
<ul>
<li>st/mesa: copy sampler_array_size field when copying instructions</li>
</ul>
<p>Chad Versace (1):</p>
<ul>
<li>i965: Fix segfault in WebGL Conformance on Ivybridge</li>
</ul>
<p>Dave Airlie (5):</p>
<ul>
<li>r600g/cayman: fix integer multiplication output overwrite (v2)</li>
<li>r600g/cayman: fix texture gather tests</li>
<li>r600g/cayman: handle empty vertex shaders</li>
<li>r600g: geom shaders: always load texture src regs from inputs</li>
<li>r600g: limit texture offset application to specific types (v2)</li>
</ul>
<p>Emil Velikov (3):</p>
<ul>
<li>docs: Add sha256 sums for the 10.3.3 release</li>
<li>configure.ac: roll up a program for the sse4.1 check</li>
<li>get-pick-list.sh: Require explicit "10.3" for nominating stable patches</li>
</ul>
<p>Ilia Mirkin (1):</p>
<ul>
<li>st/mesa: add a fallback for clear_with_quad when no vs_layer</li>
</ul>
<p>José Fonseca (1):</p>
<ul>
<li>llvmpipe: Avoid deadlock when unloading opengl32.dll</li>
</ul>
<p>Kenneth Graunke (1):</p>
<ul>
<li>i915g: we also have more than 0 viewports!</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>radeonsi: Disable asynchronous DMA except for PIPE_BUFFER</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,88 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.3.5 Release Notes / December 5, 2014</h1>
<p>
Mesa 10.3.5 is a bug fix release which fixes bugs found since the 10.3.4 release.
</p>
<p>
Mesa 10.3.5 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
7ea71c3cce89114df3dc050376afa1c6f6bf235d77a68f9703273603d6a90621 MesaLib-10.3.5.tar.gz
eb75d2790f1606d59d50a6acaa637b6c75f2155b3e0eca3d5099165c0d9556ae MesaLib-10.3.5.tar.bz2
164bc64ba63fb07ff255ff8de6ed3c95ff545dfe8f864c44c33abe94788da910 MesaLib-10.3.5.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86618">Bug 86618</a> - [NV96] neg modifiers not working in MIN and MAX operations</li>
</ul>
<h2>Changes</h2>
<p>Brian Paul (2):</p>
<ul>
<li>mesa: fix arithmetic error in _mesa_compute_compressed_pixelstore()</li>
<li>mesa: fix height error check for 1D array textures</li>
</ul>
<p>Chris Forbes (2):</p>
<ul>
<li>i965: Handle nested uniform array indexing</li>
<li>mesa: Fix Get(GL_TRANSPOSE_CURRENT_MATRIX_ARB) to transpose</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: Add sha256 sums for the 10.3.5 release</li>
<li>Update version to 10.3.5</li>
</ul>
<p>Ilia Mirkin (6):</p>
<ul>
<li>nv50/ir: set neg modifiers on min/max args</li>
<li>nv50,nvc0: actually check constbufs for invalidation</li>
<li>nv50,nvc0: buffer resources can be bound as other things down the line</li>
<li>freedreno/ir3: don't pass consts to madsh.m16 in MOD logic</li>
<li>freedreno/a3xx: only enable blend clamp for non-float formats</li>
<li>freedreno/ir3: fix UMAD</li>
</ul>
<p>Rob Clark (1):</p>
<ul>
<li>configure.ac: bump libdrm_freedreno requirement</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,124 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.3.6 Release Notes / December 29, 2014</h1>
<p>
Mesa 10.3.6 is a bug fix release which fixes bugs found since the 10.3.5 release.
</p>
<p>
Mesa 10.3.6 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
c4d053d6bc6604cb5c93c99e0ef2e815c539f26dc5a03737eb3809bc1767d12f MesaLib-10.3.6.tar.gz
8d43673c6788fbf85f9c36c3a95c61ccf46f8835fc9c0d85d34474490d80572b MesaLib-10.3.6.tar.bz2
6b5b1e9a13949cfdb76fe51e8dcc3ea71e464a5ca73d11fdc29c20c4ba3f411a MesaLib-10.3.6.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=60879">Bug 60879</a> - [radeonsi] X11 can't start with acceleration enabled</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82585">Bug 82585</a> - geometry shader with optional out variable segfaults</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82991">Bug 82991</a> - Inverted bumpmap in webgl applications</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84777">Bug 84777</a> - [BSW]Piglit spec_glsl-1.50_execution_geometry-basic fails</li>
</ul>
<h2>Changes</h2>
<p>Andres Gomez (1):</p>
<ul>
<li>i965/brw_reg: struct constructor now needs explicit negate and abs values.</li>
</ul>
<p>Ben Widawsky (1):</p>
<ul>
<li>i965/gs: Avoid DW * DW mul</li>
</ul>
<p>Dave Airlie (1):</p>
<ul>
<li>r600g: only init GS_VERT_ITEMSIZE on r600</li>
</ul>
<p>Emil Velikov (3):</p>
<ul>
<li>docs: Add sha256 sums for the 10.3.5 release</li>
<li>Revert "glx/dri3: Request non-vsynced Present for swapinterval zero. (v3)"</li>
<li>Update version to 10.3.6</li>
</ul>
<p>Ian Romanick (2):</p>
<ul>
<li>linker: Wrap access of producer_var with a NULL check</li>
<li>linker: Assign varying locations geometry shader inputs for SSO</li>
</ul>
<p>Ilia Mirkin (3):</p>
<ul>
<li>util/primconvert: pass index bias through</li>
<li>util/primconvert: support instanced rendering</li>
<li>util/primconvert: take ib offset into account</li>
</ul>
<p>José Fonseca (1):</p>
<ul>
<li>util/primconvert: Avoid point arithmetic; apply offset on all cases.</li>
</ul>
<p>Marek Olšák (1):</p>
<ul>
<li>docs/relnotes: document the removal of GALLIUM_MSAA</li>
</ul>
<p>Mario Kleiner (4):</p>
<ul>
<li>glx/dri3: Fix glXWaitForSbcOML() to handle targetSBC==0 correctly. (v2)</li>
<li>glx/dri3: Track separate (ust, msc) for PresentPixmap vs. PresentNotifyMsc (v2)</li>
<li>glx/dri3: Request non-vsynced Present for swapinterval zero. (v3)</li>
<li>glx/dri3: Don't fail on glXSwapBuffersMscOML(dpy, window, 0, 0, 0) (v2)</li>
</ul>
<p>Maxence Le Doré (1):</p>
<ul>
<li>glsl: Add gl_MaxViewports to available builtin constants</li>
</ul>
<p>Tom Stellard (1):</p>
<ul>
<li>radeonsi: Program RASTER_CONFIG for harvested GPUs v5</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,93 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.3.7 Release Notes / January 12, 2015</h1>
<p>
Mesa 10.3.7 is a bug fix release which fixes bugs found since the 10.3.6 release.
</p>
<p>
Mesa 10.3.7 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
bc13f33c19bc9f44a0565fdd51a8f9d1c0153a3365c429ceaf4ef43b7022b052 MesaLib-10.3.7.tar.gz
43c6ced15e237cbb21b3082d7c0b42777c50c1f731d0d4b5efb5231063fb6a5b MesaLib-10.3.7.tar.bz2
d821fd46baf804fecfcf403e901800a4b996c7dd1c83f20a354b46566a49026f MesaLib-10.3.7.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85529">Bug 85529</a> - Surfaces not drawn in Unvanquished</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87619">Bug 87619</a> - Changes to state such as render targets change fragment shader without marking it dirty.</li>
</ul>
<h2>Changes</h2>
<p>Chad Versace (2):</p>
<ul>
<li>i965: Use safer pointer arithmetic in intel_texsubimage_tiled_memcpy()</li>
<li>i965: Use safer pointer arithmetic in gather_oa_results()</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: Add sha256 sums for the 10.3.6 release</li>
<li>Update version to 10.3.7</li>
</ul>
<p>Ilia Mirkin (2):</p>
<ul>
<li>nv50,nvc0: set vertex id base to index_bias</li>
<li>nv50/ir: fix texture offsets in release builds</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>i965: Add missing BRW_NEW_*_PROG_DATA to texture/renderbuffer atoms.</li>
<li>i965: Fix start/base_vertex_location for &gt;1 prims but !BRW_NEW_VERTICES.</li>
</ul>
<p>Marek Olšák (3):</p>
<ul>
<li>glsl_to_tgsi: fix a bug in copy propagation</li>
<li>vbo: ignore primitive restart if FixedIndex is enabled in DrawArrays</li>
<li>st/mesa: fix GL_PRIMITIVE_RESTART_FIXED_INDEX</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>radeonsi: Don't modify PA_SC_RASTER_CONFIG register value if rb_mask == 0</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,335 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.3 Release Notes / September 19, 2014</h1>
<p>
Mesa 10.3 is a new development release.
People who are concerned with stability and reliability should stick
with a previous release or wait for Mesa 10.3.1.
</p>
<p>
Mesa 10.3 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
9a1bf52040fc3dda81e83a35f944f1c3f532847dbe9fdf57161265cf71ea1bae MesaLib-10.3.0.tar.gz
0283bfe710fa449ed82e465cfa09612a269e19abb7e0382082608062ce7960b5 MesaLib-10.3.0.tar.bz2
221420763c2c3a244836a736e735612c4a6a0377b4e5223fca1e612f49906789 MesaLib-10.3.0.zip
</pre>
<h2>New features</h2>
<p>
Note: some of the new features are only available with certain drivers.
</p>
<ul>
<li>GL_ARB_ES3_compatibility on nv50, nvc0, r600, radeonsi, softpipe, llvmpipe</li>
<li>GL_ARB_clear_texture on i965</li>
<li>GL_ARB_compressed_texture_pixel_storage on all drivers</li>
<li>GL_ARB_conditional_render_inverted on i965, nvc0, softpipe, llvmpipe</li>
<li>GL_ARB_derivative_control on i965, nv50, nvc0, r600</li>
<li>GL_ARB_draw_indirect on nvc0, radeonsi</li>
<li>GL_ARB_explicit_uniform_location (all drivers that support GLSL)</li>
<li>GL_ARB_fragment_layer_viewport on nv50, nvc0, llvmpipe, r600</li>
<li>GL_ARB_gpu_shader5 on i965/gen7, nvc0</li>
<li>GL_ARB_multi_draw_indirect on nvc0, radeonsi</li>
<li>GL_ARB_sample_shading on radeonsi</li>
<li>GL_ARB_seamless_cubemap_per_texture on i965, llvmpipe, nvc0, r600, radeonsi, softpipe</li>
<li>GL_ARB_stencil_texturing on nv50, nvc0, r600, and radeonsi</li>
<li>GL_ARB_texture_barrier on nv50, nvc0, r300, r600, radeonsi</li>
<li>GL_ARB_texture_compression_bptc on i965/gen7+, nvc0, r600/evergreen+, radeonsi</li>
<li>GL_ARB_texture_cube_map_array on radeonsi</li>
<li>GL_ARB_texture_gather on r600, radeonsi</li>
<li>GL_ARB_texture_query_levels on nv50, nvc0, llvmpipe, r600, radeonsi, softpipe</li>
<li>GL_ARB_texture_query_lod on r600, radeonsi</li>
<li>GL_ARB_viewport_array on nvc0</li>
<li>GL_AMD_vertex_shader_viewport_index on i965/gen7+, r600</li>
<li>GL_OES_compressed_ETC1_RGB8_texture on nv30, nv50, nvc0, r300, r600, radeonsi, softpipe, llvmpipe</li>
<li>GLX_MESA_query_renderer on nv30, nv50, nvc0, r300, r600, radeonsi, softpipe, llvmpipe</li>
<li>A new software rasterizer driver (kms_swrast_dri.so) that works with
DRM drivers that don't have a full-fledged GEM (such as qxl or simpledrm)</li>
<li>Distribute the Khronos GL/glcorearb.h header file.</li>
</ul>
<h2>Bug fixes</h2>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=50754">Bug 50754</a> - Building 32 bit mesa on 64 bit OS fails since change for automake</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=53617">Bug 53617</a> - [llvmpipe] piglit fbo-depthtex regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=54372">Bug 54372</a> - GLX_INTEL_swap_event crashes driver when swapping window buffers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=56127">Bug 56127</a> - [ILK bisected]unigine-sanctruary performance reduced by 98%</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=66184">Bug 66184</a> - src/mesa/state_tracker/st_glsl_to_tgsi.cpp:3216:simplify_cmp: Assertion `inst-&gt;dst.index &lt; 4096' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=66452">Bug 66452</a> - JUNIPER UVD accelerated playback of WMV3 streams does not work</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=68365">Bug 68365</a> - [SNB Bisected]Piglit spec_ARB_framebuffer_object_fbo-blit-stretch fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=70441">Bug 70441</a> - [Gen4-5 clip] Piglit spec_OpenGL_1.1_polygon-offset hits (execsize &gt;= width) assertion</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=73846">Bug 73846</a> - [llvmpipe] lp_test_format fails with llvm-3.5svn &gt;= r199602</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=74005">Bug 74005</a> - [i965 Bisected]Piglit/glx_glx-make-glxdrawable-current fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=74863">Bug 74863</a> - [r600g] HyperZ broken on RV770 and CYPRESS (Left 4 Dead 2 trees corruption) bisected!</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=75010">Bug 75010</a> - clang: error: unknown argument: '-fstack-protector-strong'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=75478">Bug 75478</a> - [BDW]Some Piglit and Ogles2conform cases cause GPU hang</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=75664">Bug 75664</a> - Unigine Valley &amp; Heaven &quot;error: syntax error, unexpected EXTENSION, expecting $end&quot; IVB HD4000</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=75878">Bug 75878</a> - [BDW] GPU hang running Raytracer WebGL demo</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76188">Bug 76188</a> - EGL_EXT_image_dma_buf_import fd ownership is incorrect</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76223">Bug 76223</a> - [radeonsi] luxmark segfault</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76939">Bug 76939</a> - [BDW] GPU hang when running “Metro:Last Light “ /“Crusader Kings II”</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77245">Bug 77245</a> - Bogus GL_ARB_explicit_attrib_location layout identifier warnings</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77493">Bug 77493</a> - lp_test_arit fails with llvm &gt;= llvm-3.5svn r206094</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77703">Bug 77703</a> - [ILK Bisected]Piglit glean_texCombine4 fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77704">Bug 77704</a> - [IVB/HSW Bisected]Ogles3conform GL3Tests_shadow_shadow_execution_frag.test fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77705">Bug 77705</a> - [SNB/IVB/HSW/BYT/BDW Bisected]Ogles3conform GL3Tests/packed_pixels/packed_pixels_pixelstore.test segfault</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77707">Bug 77707</a> - [ILK Bisected]Ogles2conform GL_sin_sin_float_frag_xvary.test fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77740">Bug 77740</a> - i965: Relax accumulator dependency scheduling on Gen &lt; 6</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77852">Bug 77852</a> - [BDW]Piglit spec_ARB_framebuffer_object_fbo-drawbuffers-none_glBlitFramebuffer fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77856">Bug 77856</a> - [BDW]Piglit spec_OpenGL_3.0_clearbuffer-mixed-format fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77865">Bug 77865</a> - [BDW] Many Ogles3conform framebuffer_blit cases fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78225">Bug 78225</a> - Compile error due to undefined reference to `gbm_dri_backend', fix attached</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78258">Bug 78258</a> - make check link_varyings.gl_ClipDistance failure</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78403">Bug 78403</a> - query_renderer_implementation_unittest.cpp:144:4: error: expected primary-expression before . token</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78468">Bug 78468</a> - Compiling of shader gets stuck in infinite loop</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78537">Bug 78537</a> - no anisotropic filtering in a native Half-Life 2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78546">Bug 78546</a> - [swrast] piglit copyteximage-border regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78581">Bug 78581</a> - OpenCL: clBuildProgram prints error messages directly rather than storing them</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78648">Bug 78648</a> - Texture artifacts in Kerbal Space Program</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78665">Bug 78665</a> - macros in builtin_functions.cpp make invalid assumptions about M_PI definitions</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78679">Bug 78679</a> - Gen4-5 code lost: runtime_check_aads_emit</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78691">Bug 78691</a> - [G45 - Tesseract] Mesa 10.1.2 implementation error: Unsupported opcode 169872468 in FS</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78692">Bug 78692</a> - Football Manager 2014, gameplay rendered black &amp; white</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78716">Bug 78716</a> - Fix Mesa bugs for running Unreal Engine 4.1 Cave effects demo compiled for Linux</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78803">Bug 78803</a> - gallivm/lp_bld_debug.cpp:42:28: fatal error: llvm/IR/Module.h: No such file or directory</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78842">Bug 78842</a> - [swrast] piglit fcc-read-after-clear copy rb regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78843">Bug 78843</a> - [swrast] piglit copyteximage 1D regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78872">Bug 78872</a> - [ILK Bisected]Piglit spec_ARB_depth_buffer_float_fbo-depthstencil-GL_DEPTH32F_STENCIL8-blit Aborted</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78875">Bug 78875</a> - [ILK Bisected]Webglc conformance/uniforms/uniform-default-values.html fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78888">Bug 78888</a> - test_eu_compact.c:54:3: error: implicit declaration of function brw_disasm [-Werror=implicit-function-declaration]</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79029">Bug 79029</a> - INTEL_DEBUG=shader_time is full of lies</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79095">Bug 79095</a> - x86/common_x86.c:348:14: error: use of undeclared identifier 'bit_SSE4_1'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79115">Bug 79115</a> - glFramebufferRenderbuffer(GL_DRAW_FRAMEBUFFER, GL_DEPTH_STENCIL_ATTACHMENT, GL_RENDERBUFFER, 0) doesn't unbind stencil buffer</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79263">Bug 79263</a> - Linking error in egl_gallium.la when compiling 32 bit on multiarch</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79294">Bug 79294</a> - Xlib-based build broken on non x86/x86-64 architectures</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79373">Bug 79373</a> - Non-const initializers for matrix and vector constructors</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79382">Bug 79382</a> - build error: multiple definition of `loader_get_pci_id_for_fd'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79421">Bug 79421</a> - [llvmpipe] SIGSEGV src/gallium/drivers/llvmpipe/lp_rast_priv.h:218</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79440">Bug 79440</a> - prog_hash_table.c:146: undefined reference to `_mesa_error_no_memory'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79469">Bug 79469</a> - Commit e3cc0d90e14e62a0a787b6c07a6df0f5c84039be breaks unigine heaven</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79534">Bug 79534</a> - gen&lt;7 renders garbage</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79616">Bug 79616</a> - L4D2 crash on startup</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79724">Bug 79724</a> - switch statement type check</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79729">Bug 79729</a> - [i965] glClear on a multisample texture doesn't work</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79809">Bug 79809</a> - radeonsi: mouse cursor corruption using weston on AMD Kaveri</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79823">Bug 79823</a> - [NV30/gallium] Mozilla apps freeze on startup with nouveau-dri-10.2.1 libs on dual-screen</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79885">Bug 79885</a> - commit b52a530 (gallium/egl: st_profiles are build time decision, treat them as such) broke egl</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79903">Bug 79903</a> - [HSW Bisected]Some Piglit and Ogles2conform cases fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79907">Bug 79907</a> - Mesa 10.2.1 --enable-vdpau default=auto broken</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79948">Bug 79948</a> - [i965] Incorrect pixels when using discard and uniform loads</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80015">Bug 80015</a> - Transparency glitches in native Civilization 5 (Civ5) port</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80115">Bug 80115</a> - MESA_META_DRAW_BUFFERS induced GL_INVALID_VALUE errors</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80211">Bug 80211</a> - [ILK/SNB Bisected]Piglit shaders_glsl-fs-copy-propagation-texcoords-1 fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80247">Bug 80247</a> - Khronos conformance test ES3-CTS.gtf.GL3Tests.transform_feedback.transform_feedback_vertex_id fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80254">Bug 80254</a> - pipe_loader_sw.c:90: undefined reference to `dri_create_sw_winsys'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80541">Bug 80541</a> - [softpipe] piglit levelclamp regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80561">Bug 80561</a> - Incorrect implementation of some VDPAU APIs.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80614">Bug 80614</a> - [regression] Error in `omxregister-bellagio': munmap_chunk(): invalid pointer: 0x00007f5f76626dab</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80778">Bug 80778</a> - [bisected regression] piglit spec/glsl-1.50/compiler/incorrect-in-layout-qualifier-repeated-prim.geom</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80827">Bug 80827</a> - [radeonsi,R9 270X] Corruptions in window menus in KDE</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80880">Bug 80880</a> - Unreal Engine 4 demos fail GLSL compiler assertion</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80991">Bug 80991</a> - [BDW]Piglit spec_ARB_sample_shading_builtin-gl-sample-mask_2 fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81020">Bug 81020</a> - [radeonsi][regresssion] Wireframe of background rendered through objects in Half-Life 2: Episode 2 with MSAA enabled</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81150">Bug 81150</a> - [SNB]Piglit spec_arb_shading_language_packing_execution_built-in-functions_fs-packSnorm4x8 fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81157">Bug 81157</a> - [BDW]Piglit some spec_glsl-1.50_execution_built-in-functions* cases fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81450">Bug 81450</a> - [BDW]Piglit spec_glsl-1.30_execution_tex-miplevel-selection_textureGrad_1DArray cases intel_do_flush_locked failed</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81828">Bug 81828</a> - [BDW Bisected]Ogles3conform GL3Tests_packed_pixels_packed_pixels_pbo.test fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81834">Bug 81834</a> - TGSI constant buffer overrun causes assertion failure</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81857">Bug 81857</a> - [SNB+]Piglit spec_glsl-1.30_execution_switch_fs-default_last sporadically fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81967">Bug 81967</a> - [regression] Selections in Blender renders wrong</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82139">Bug 82139</a> - [r600g, bisected] multiple ubo piglit regressions</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82159">Bug 82159</a> - No rule to make target `../../../../src/mesa/libmesa.la', needed by `collision'.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82255">Bug 82255</a> - [VP2] Chroma planes are vertically stretched during VDPAU playback</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82268">Bug 82268</a> - Add support for the OpenRISC architecture (or1k)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82428">Bug 82428</a> - [radeonsi,R9 270X] System lockup when using mplayer/mpv with VDPAU</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82472">Bug 82472</a> - piglit 16385-consecutive-chars regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82483">Bug 82483</a> - format_srgb.h:145: undefined reference to `util_format_srgb_to_linear_8unorm_table'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82517">Bug 82517</a> - [RADEONSI,VDPAU] SIGSEGV in map_msg_fb_buf called from ruvd_destroy, when closing a Tab with accelerated video player</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82534">Bug 82534</a> - src\egl\main\eglapi.h : fatal error LNK1107: invalid or corrupt file: cannot read at 0x2E02</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82536">Bug 82536</a> - u_current.h:72: undefined reference to `__imp__glapi_Dispatch'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82538">Bug 82538</a> - Super Maryo Chronicles fails with st/mesa assertion failure</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82539">Bug 82539</a> - vmw_screen_dri.lo In file included from vmw_screen_dri.c:41: vmwgfx_drm.h:32:17: error: drm.h: No such file or directory</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82546">Bug 82546</a> - [regression] libOSMesa build failure</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82574">Bug 82574</a> - GLSL: opt_vectorize goes wrong on texture lookups</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82628">Bug 82628</a> - bisected: GALLIUM_HUD hangs radeon 7970M (PRIME)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82671">Bug 82671</a> - [r600g-evergreen][compute]Empty kernel execution causes crash</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82709">Bug 82709</a> - OpenCL not working on radeon hainan</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82796">Bug 82796</a> - [IVB/BYT-M/HSW/BDW Bisected]Synmark2_v6.0_OglTerrainFlyInst/OglTerrainPanInst cannot run as image validation failed</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82804">Bug 82804</a> - unreal engine 4 rendering errors</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82814">Bug 82814</a> - glDrawBuffers(0, NULL) segfaults in _mesa_drawbuffers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82828">Bug 82828</a> - Regression: Crash in 3Dmark2001</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82846">Bug 82846</a> - [BDW Bisected] Gpu hang when running Lightsmark v2008/Warsow v1.0/Xonotic v0.7/unigine-demos</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82881">Bug 82881</a> - test_vec4_register_coalesce regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82882">Bug 82882</a> - [swrast] piglit glsl-fs-uniform-bool-1 regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82929">Bug 82929</a> - [BDW Bisected]glxgears causes X hang</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82932">Bug 82932</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.shaders.indexing.vector_subscript.vec3_static_loop_subscript_write_direct_read_vertex fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83046">Bug 83046</a> - [BDW bisected]] Warsow v1.0/Xonotic v0.7/Gputest v0.5_triangle_fullscreen/synmark2_v6/GLBenchmark v2.5.0/GLBenchmark v2.7.0/Ungine-demos performance reduced 30%~60%</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83079">Bug 83079</a> - [NVC0] Dota 2 (Linux native and Wine) crash with Nouveau Drivers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83081">Bug 83081</a> - [BDW Bisected]Piglit spec_ARB_sample_shading_builtin-gl-sample-mask_2 is core dumped</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83127">Bug 83127</a> - [ILK Bisected]Piglit glean_texCombine fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83355">Bug 83355</a> - FTBFS: src/mesa/program/program_lexer.l:122:64: error: unknown type name 'YYSTYPE'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83432">Bug 83432</a> - r600_query.c:269:r600_emit_query_end: Assertion `ctx-&gt;num_pipelinestat_queries &gt; 0' failed [Gallium HUD]</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83468">Bug 83468</a> - [UBO] Using bool from UBO as if-statement condition asserts</li>
</ul>
<h2>Changes</h2>
<ul>
<li>Removed support for the GL_ATI_envmap_bumpmap extension</li>
<li>The hacky --enable-32/64-bit is no longer available in configure. To build
32/64 bit mesa refer to the default method recommended by your distribution</li>
</li>The environment variable GALLIUM_MSAA that forced a multisample GLX visual was removed.</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,97 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.4.1 Release Notes / December 29, 2014</h1>
<p>
Mesa 10.4.1 is a bug fix release which fixes bugs found since the 10.4.0 release.
</p>
<p>
Mesa 10.4.1 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
5311285e791a6bfaa468ad002bd1e1164acb3eaa040b5a1bf958bdb7c27e0a9d MesaLib-10.4.1.tar.gz
91e8b71c8aff4cb92022a09a872b1c5d1ae5bfec8c6c84dbc4221333da5bf1ca MesaLib-10.4.1.tar.bz2
e09c8135f5a86ecb21182c6f8959aafd39ae2f98858fdf7c0e25df65b5abcdb8 MesaLib-10.4.1.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82585">Bug 82585</a> - geometry shader with optional out variable segfaults</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82991">Bug 82991</a> - Inverted bumpmap in webgl applications</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83908">Bug 83908</a> - [i965] Incorrect icon colors in Steam Big Picture</li>
</ul>
<h2>Changes</h2>
<p>Andres Gomez (1):</p>
<ul>
<li>i965/brw_reg: struct constructor now needs explicit negate and abs values.</li>
</ul>
<p>Cody Northrop (1):</p>
<ul>
<li>i965: Require pixel alignment for GPU copy blit</li>
</ul>
<p>Emil Velikov (3):</p>
<ul>
<li>docs: Add 10.4 sha256 sums, news item and link release notes</li>
<li>Revert "glx/dri3: Request non-vsynced Present for swapinterval zero. (v3)"</li>
<li>Update version to 10.4.1</li>
</ul>
<p>Ian Romanick (2):</p>
<ul>
<li>linker: Wrap access of producer_var with a NULL check</li>
<li>linker: Assign varying locations geometry shader inputs for SSO</li>
</ul>
<p>Mario Kleiner (4):</p>
<ul>
<li>glx/dri3: Fix glXWaitForSbcOML() to handle targetSBC==0 correctly. (v2)</li>
<li>glx/dri3: Track separate (ust, msc) for PresentPixmap vs. PresentNotifyMsc (v2)</li>
<li>glx/dri3: Request non-vsynced Present for swapinterval zero. (v3)</li>
<li>glx/dri3: Don't fail on glXSwapBuffersMscOML(dpy, window, 0, 0, 0) (v2)</li>
</ul>
<p>Maxence Le Doré (1):</p>
<ul>
<li>glsl: Add gl_MaxViewports to available builtin constants</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,127 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.4.2 Release Notes / January 12, 2015</h1>
<p>
Mesa 10.4.2 is a bug fix release which fixes bugs found since the 10.4.1 release.
</p>
<p>
Mesa 10.4.2 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
e303e77dd774df0d051b2870b165f98c97084a55980f884731df89c1b56a6146 MesaLib-10.4.2.tar.gz
08a119937d9f2aa2f66dd5de97baffc2a6e675f549e40e699a31f5485d15327f MesaLib-10.4.2.tar.bz2
c2c2921a80a3395824f02bee4572a6a17d6a12a928a3e497618eeea04fb06490 MesaLib-10.4.2.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85529">Bug 85529</a> - Surfaces not drawn in Unvanquished</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87619">Bug 87619</a> - Changes to state such as render targets change fragment shader without marking it dirty.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87658">Bug 87658</a> - [llvmpipe] SEGV in sse2_has_daz on ancient Pentium4-M</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87913">Bug 87913</a> - CPU cacheline size of 0 can be returned by CPUID leaf 0x80000006 in some virtual machines</li>
</ul>
<h2>Changes</h2>
<p>Chad Versace (2):</p>
<ul>
<li>i965: Use safer pointer arithmetic in intel_texsubimage_tiled_memcpy()</li>
<li>i965: Use safer pointer arithmetic in gather_oa_results()</li>
</ul>
<p>Dave Airlie (3):</p>
<ul>
<li>Revert "r600g/sb: fix issues cause by GLSL switching to loops for switch"</li>
<li>r600g: fix regression since UCMP change</li>
<li>r600g/sb: implement r600 gpr index workaround. (v3.1)</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: Add sha256 sums for the 10.4.1 release</li>
<li>Update version to 10.4.2</li>
</ul>
<p>Ilia Mirkin (2):</p>
<ul>
<li>nv50,nvc0: set vertex id base to index_bias</li>
<li>nv50/ir: fix texture offsets in release builds</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>i965: Add missing BRW_NEW_*_PROG_DATA to texture/renderbuffer atoms.</li>
<li>i965: Fix start/base_vertex_location for &gt;1 prims but !BRW_NEW_VERTICES.</li>
</ul>
<p>Leonid Shatz (1):</p>
<ul>
<li>gallium/util: make sure cache line size is not zero</li>
</ul>
<p>Marek Olšák (4):</p>
<ul>
<li>glsl_to_tgsi: fix a bug in copy propagation</li>
<li>vbo: ignore primitive restart if FixedIndex is enabled in DrawArrays</li>
<li>st/mesa: fix GL_PRIMITIVE_RESTART_FIXED_INDEX</li>
<li>radeonsi: fix VertexID for OpenGL</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>radeonsi: Don't modify PA_SC_RASTER_CONFIG register value if rb_mask == 0</li>
</ul>
<p>Roland Scheidegger (1):</p>
<ul>
<li>gallium/util: fix crash with daz detection on x86</li>
</ul>
<p>Tiziano Bacocco (1):</p>
<ul>
<li>nv50,nvc0: implement half_pixel_center</li>
</ul>
<p>Vadim Girlin (1):</p>
<ul>
<li>r600g/sb: fix issues with loops created for switch</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,145 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.4.3 Release Notes / January 24, 2015</h1>
<p>
Mesa 10.4.3 is a bug fix release which fixes bugs found since the 10.4.2 release.
</p>
<p>
Mesa 10.4.3 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
c53eaafc83d9c6315f63e0904d9954d929b841b0b2be7a328eeb6e14f1376129 MesaLib-10.4.3.tar.gz
ef6ecc9c2f36c9f78d1662382a69ae961f38f03af3a0c3268e53f351aa1978ad MesaLib-10.4.3.tar.bz2
179325fc8ec66529d3b0d0c43ef61a33a44d91daa126c3bbdd1efdfd25a7db1d MesaLib-10.4.3.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80568">Bug 80568</a> - [gen4] GPU Crash During Google Chrome Operation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85367">Bug 85367</a> - [gen4] GPU hang in glmark-es2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85696">Bug 85696</a> - r600g+nine: Bioshock shader failure after 7b1c0cbc90d456384b0950ad21faa3c61a6b43ff</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88219">Bug 88219</a> - include/c11/threads_posix.h:197: undefined reference to `pthread_mutex_lock'</li>
</ul>
<h2>Changes</h2>
<p>Axel Davy (39):</p>
<ul>
<li>st/nine: Add new texture format strings</li>
<li>st/nine: Correctly advertise D3DPMISCCAPS_CLIPTLVERTS</li>
<li>st/nine: NineBaseTexture9: fix setting of last_layer</li>
<li>st/nine: CubeTexture: fix GetLevelDesc</li>
<li>st/nine: Fix crash when deleting non-implicit swapchain</li>
<li>st/nine: Return D3DERR_INVALIDCALL when trying to create a texture of bad format</li>
<li>st/nine: NineBaseTexture9: update sampler view creation</li>
<li>st/nine: Check if srgb format is supported before trying to use it.</li>
<li>st/nine: Add ATI1 and ATI2 support</li>
<li>st/nine: Rework of boolean constants</li>
<li>st/nine: Convert integer constants to floats before storing them when cards don't support integers</li>
<li>st/nine: Remove some shader unused code</li>
<li>st/nine: Saturate oFog and oPts vs outputs</li>
<li>st/nine: Correctly declare NineTranslateInstruction_Mkxn inputs</li>
<li>st/nine: Fix typo for M4x4</li>
<li>st/nine: Fix POW implementation</li>
<li>st/nine: Handle RSQ special cases</li>
<li>st/nine: Handle NRM with input of null norm</li>
<li>st/nine: Correct LOG on negative values</li>
<li>st/nine: Rewrite LOOP implementation, and a0 aL handling</li>
<li>st/nine: Fix CND implementation</li>
<li>st/nine: Clamp ps 1.X constants</li>
<li>st/nine: Fix some fixed function pipeline operation</li>
<li>st/nine: Implement TEXCOORD special behaviours</li>
<li>st/nine: Fill missing dst and src number for some instructions.</li>
<li>st/nine: Fix TEXM3x3 and implement TEXM3x3VSPEC</li>
<li>st/nine: implement TEXM3x2DEPTH</li>
<li>st/nine: Implement TEXM3x2TEX</li>
<li>st/nine: Implement TEXM3x3SPEC</li>
<li>st/nine: Implement TEXDEPTH</li>
<li>st/nine: Implement TEXDP3</li>
<li>st/nine: Implement TEXDP3TEX</li>
<li>st/nine: Implement TEXREG2AR, TEXREG2GB and TEXREG2RGB</li>
<li>st/nine: Correct rules for relative adressing and constants.</li>
<li>st/nine: Remove unused code for ps</li>
<li>st/nine: Fix sm3 relative addressing for non-debug build</li>
<li>st/nine: Add variables containing the size of the constant buffers</li>
<li>st/nine: Allocate the correct size for the user constant buffer</li>
<li>st/nine: Allocate vs constbuf buffer for indirect addressing once.</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: Add sha256 sums for the 10.4.2 release</li>
<li>Update version to 10.4.3</li>
</ul>
<p>Jason Ekstrand (1):</p>
<ul>
<li>mesa: Fix clamping to -1.0 in snorm_to_float</li>
</ul>
<p>Jonathan Gray (1):</p>
<ul>
<li>glsl: Link glsl_test with pthreads library.</li>
</ul>
<p>Jose Fonseca (1):</p>
<ul>
<li>nine: Drop use of TGSI_OPCODE_CND.</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>i965: Respect the no_8 flag on Gen6, not just Gen7+.</li>
<li>i965: Work around mysterious Gen4 GPU hangs with minimal state changes.</li>
</ul>
<p>Stanislaw Halik (1):</p>
<ul>
<li>st/nine: Hack to generate resource if it doesn't exist when getting view</li>
</ul>
<p>Xavier Bouchoux (3):</p>
<ul>
<li>st/nine: Additional defines to d3dtypes.h</li>
<li>st/nine: Add missing c++ declaration for IDirect3DVolumeTexture9</li>
<li>st/nine: Fix D3DRS_POINTSPRITE support</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,100 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.4.4 Release Notes / February 06, 2015</h1>
<p>
Mesa 10.4.4 is a bug fix release which fixes bugs found since the 10.4.3 release.
</p>
<p>
Mesa 10.4.4 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
5cb427eaf980cb8555953e9928f5797979ed783e277745d5f8cbae8bc5364086 MesaLib-10.4.4.tar.gz
f18a967e9c4d80e054b2fdff8c130ce6e6d1f8eecfc42c9f354f8628d8b4df1c MesaLib-10.4.4.tar.bz2
86baad73b77920c80fe58402a905e7dd17e3ea10ead6ea7d3afdc0a56c860bd7 MesaLib-10.4.4.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88662">Bug 88662</a> - unaligned access to gl_dlist_node</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88930">Bug 88930</a> - [osmesa] osbuffer-&gt;textures should be indexed by attachment type</li>
</ul>
<h2>Changes</h2>
<p>Brian Paul (1):</p>
<ul>
<li>mesa: fix display list 8-byte alignment issue</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: Add sha256 sums for the 10.4.3 release</li>
<li>Update version to 10.4.4</li>
</ul>
<p>José Fonseca (1):</p>
<ul>
<li>egl: Pass the correct X visual depth to xcb_put_image().</li>
</ul>
<p>Mario Kleiner (1):</p>
<ul>
<li>glx/dri3: Request non-vsynced Present for swapinterval zero. (v3)</li>
</ul>
<p>Matt Turner (1):</p>
<ul>
<li>gallium/util: Don't use __builtin_clrsb in util_last_bit().</li>
</ul>
<p>Niels Ole Salscheider (1):</p>
<ul>
<li>configure: Link against all LLVM targets when building clover</li>
</ul>
<p>Park, Jeongmin (1):</p>
<ul>
<li>st/osmesa: Fix osbuffer-&gt;textures indexing</li>
</ul>
<p>Ville Syrjälä (1):</p>
<ul>
<li>i965: Fix max_wm_threads for CHV</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,114 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.4.5 Release Notes / February 21, 2015</h1>
<p>
Mesa 10.4.5 is a bug fix release which fixes bugs found since the 10.4.4 release.
</p>
<p>
Mesa 10.4.5 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
e12bbdaee9a758617e8ebd0bb0e987f72addd11db2e4da25ba695e386cd63843 MesaLib-10.4.5.tar.gz
bf60000700a9d58e3aca2bfeee7e781053b0d839e61a95b1883e05a2dee247a0 MesaLib-10.4.5.tar.bz2
3b926de8eee500bb67cf85332c51292f826cc539b8636382aadbb8e70c76527a MesaLib-10.4.5.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82477">Bug 82477</a> - [softpipe] piglit fp-long-alu regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88658">Bug 88658</a> - (bisected) Slow video playback on Kabini</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89069">Bug 89069</a> - Lack of grass in The Talos Principle on radeonsi (native\wine\nine)</li>
</ul>
<h2>Changes</h2>
<p>Carl Worth (1):</p>
<ul>
<li>Revert use of Mesa IR optimizer for ARB_fragment_programs</li>
</ul>
<p>Emil Velikov (3):</p>
<ul>
<li>docs: Add sha256 sums for the 10.4.4 release</li>
<li>get-pick-list.sh: Require explicit "10.4" for nominating stable patches</li>
<li>Update version to 10.4.5</li>
</ul>
<p>Ilia Mirkin (3):</p>
<ul>
<li>nvc0: bail out of 2d blits with non-A8_UNORM alpha formats</li>
<li>st/mesa: treat resource-less xfb buffers as if they weren't there</li>
<li>nvc0: allow holes in xfb target lists</li>
</ul>
<p>Jeremy Huddleston Sequoia (2):</p>
<ul>
<li>darwin: build fix</li>
<li>darwin: build fix</li>
</ul>
<p>Kenneth Graunke (4):</p>
<ul>
<li>i965: Override swizzles for integer luminance formats.</li>
<li>i965: Use a gl_color_union for sampler border color.</li>
<li>i965: Fix integer border color on Haswell.</li>
<li>glsl: Reduce memory consumption of copy propagation passes.</li>
</ul>
<p>Laura Ekstrand (1):</p>
<ul>
<li>main: Fixed _mesa_GetCompressedTexImage_sw to copy slices correctly.</li>
</ul>
<p>Marek Olšák (5):</p>
<ul>
<li>r600g,radeonsi: don't append to streamout buffers that haven't been used yet</li>
<li>radeonsi: fix instanced arrays with non-zero start instance</li>
<li>radeonsi: small fix in SPI state</li>
<li>mesa: fix AtomicBuffer typo in _mesa_DeleteBuffers</li>
<li>radeonsi: fix a crash if a stencil ref state is set before a DSA state</li>
</ul>
<p>Michel Dänzer (2):</p>
<ul>
<li>st/mesa: Don't use PIPE_USAGE_STREAM for GL_PIXEL_UNPACK_BUFFER_ARB</li>
<li>Revert "radeon/llvm: enable unsafe math for graphics shaders"</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,143 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.4.6 Release Notes / March 06, 2015</h1>
<p>
Mesa 10.4.6 is a bug fix release which fixes bugs found since the 10.4.5 release.
</p>
<p>
Mesa 10.4.6 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
46c9082142e811c01e49a2c332a9ac0a1eb98f2908985fb9df216539d7eaeaf4 MesaLib-10.4.6.tar.gz
d8baedd20e79ccd98a5a7b05e23d59a30892e68de1fcc057ca6873dafca02735 MesaLib-10.4.6.tar.bz2
6aded6eac7f0d4d55117b8b581d8424710bbb4c768fc90f7b881f29311a751aa MesaLib-10.4.6.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=45348">Bug 45348</a> - [swrast] piglit fbo-drawbuffers-arbfp regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84613">Bug 84613</a> - [G965, bisected] piglit regressions : glslparsertest.glsl2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87516">Bug 87516</a> - glProgramBinary violates spec</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88885">Bug 88885</a> - Transform feedback uses incorrect interleaving if a previous draw did not write gl_Position</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89180">Bug 89180</a> - [IVB regression] Rendering issues in Mass Effect through VMware Workstation</li>
</ul>
<h2>Changes</h2>
<p>Abdiel Janulgue (2):</p>
<ul>
<li>glsl: Don't optimize min/max into saturate when EmitNoSat is set</li>
<li>st/mesa: For vertex shaders, don't emit saturate when SM 3.0 is unsupported</li>
</ul>
<p>Andreas Boll (1):</p>
<ul>
<li>glx: Fix returned values of GLX_RENDERER_PREFERRED_PROFILE_MESA</li>
</ul>
<p>Brian Paul (2):</p>
<ul>
<li>swrast: fix multiple color buffer writing</li>
<li>st/mesa: fix sampler view reference counting bug in glDraw/CopyPixels</li>
</ul>
<p>Chris Forbes (1):</p>
<ul>
<li>i965/gs: Check newly-generated GS-out VUE map against correct stage</li>
</ul>
<p>Eduardo Lima Mitev (1):</p>
<ul>
<li>mesa: Fix error validating args for TexSubImage3D</li>
</ul>
<p>Emil Velikov (6):</p>
<ul>
<li>docs: Add sha256 sums for the 10.4.5 release</li>
<li>install-lib-links: remove the .install-lib-links file</li>
<li>Revert "mesa: Correct backwards NULL check."</li>
<li>mesa: cherry-pick the second half of commit 2aa71e9485a</li>
<li>Revert "gallivm: Update for RTDyldMemoryManager becoming an unique_ptr."</li>
<li>Update version to 10.4.6</li>
</ul>
<p>Ian Romanick (3):</p>
<ul>
<li>mesa: Add missing error checks in _mesa_ProgramBinary</li>
<li>mesa: Ensure that length is set to zero in _mesa_GetProgramBinary</li>
<li>mesa: Always generate GL_INVALID_OPERATION in _mesa_GetProgramBinary</li>
</ul>
<p>Jonathan Gray (1):</p>
<ul>
<li>auxilary/os: correct sysctl use in os_get_total_physical_memory()</li>
</ul>
<p>José Fonseca (1):</p>
<ul>
<li>gallivm: Update for RTDyldMemoryManager becoming an unique_ptr.</li>
</ul>
<p>Leo Liu (1):</p>
<ul>
<li>st/omx/dec/h264: fix picture out-of-order with poc type 0 v2</li>
</ul>
<p>Lucas Stach (1):</p>
<ul>
<li>install-lib-links: don't depend on .libs directory</li>
</ul>
<p>Marek Olšák (2):</p>
<ul>
<li>vbo: fix an unitialized-variable warning</li>
<li>radeonsi: fix point sprites</li>
</ul>
<p>Matt Turner (4):</p>
<ul>
<li>glsl: Rewrite and fix min/max to saturate optimization.</li>
<li>mesa: Correct backwards NULL check.</li>
<li>i965/fs: Don't use backend_visitor::instructions after creating the CFG.</li>
<li>mesa: Correct backwards NULL check.</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,134 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.4.7 Release Notes / March 20, 2015</h1>
<p>
Mesa 10.4.7 is a bug fix release which fixes bugs found since the 10.4.6 release.
</p>
<p>
Mesa 10.4.7 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
9e7b59267199658808f8b33e0410b86fbafbdcd52378658b9df65fac9d24947f MesaLib-10.4.7.tar.gz
2c351c98671f9a7ab3fd9c601bb7a255801b1580f5dd0992639f99152801b0d2 MesaLib-10.4.7.tar.bz2
d14ac578b5ce16560757b53fbd1cb4d6b34652f8e110e4b10a019adc82e67ffd MesaLib-10.4.7.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79202">Bug 79202</a> - valgrind errors in glsl-fs-uniform-array-loop-unroll.shader_test; random code generation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89156">Bug 89156</a> - r300g: GL_COMPRESSED_RED_RGTC1 / ATI1N support broken</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89224">Bug 89224</a> - Incorrect rendering of Unigine Valley running in VM on VMware Workstation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89530">Bug 89530</a> - FTBFS in loader: missing fstat</li>
</ul>
<h2>Changes</h2>
<p>Andrey Sudnik (1):</p>
<ul>
<li>i965/vec4: Don't lose the saturate modifier in copy propagation.</li>
</ul>
<p>Daniel Stone (1):</p>
<ul>
<li>egl: Take alpha bits into account when selecting GBM formats</li>
</ul>
<p>Emil Velikov (6):</p>
<ul>
<li>docs: Add sha256 sums for the 10.4.6 release</li>
<li>cherry-ignore: add not applicable/rejected commits</li>
<li>mesa: rename format_info.c to format_info.h</li>
<li>loader: include &lt;sys/stat.h&gt; for non-sysfs builds</li>
<li>auxiliary/os: fix the android build - s/drm_munmap/os_munmap/</li>
<li>Update version to 10.4.7</li>
</ul>
<p>Iago Toral Quiroga (1):</p>
<ul>
<li>i965: Fix out-of-bounds accesses into pull_constant_loc array</li>
</ul>
<p>Ilia Mirkin (4):</p>
<ul>
<li>freedreno: move fb state copy after checking for size change</li>
<li>freedreno/ir3: fix array count returned by TXQ</li>
<li>freedreno/ir3: get the # of miplevels from getinfo</li>
<li>freedreno: fix slice pitch calculations</li>
</ul>
<p>Marc-Andre Lureau (1):</p>
<ul>
<li>gallium/auxiliary/indices: fix start param</li>
</ul>
<p>Marek Olšák (4):</p>
<ul>
<li>r300g: fix RGTC1 and LATC1 SNORM formats</li>
<li>r300g: fix a crash when resolving into an sRGB texture</li>
<li>r300g: fix sRGB-&gt;sRGB blits</li>
<li>radeonsi: increase coords array size for radeon_llvm_emit_prepare_cube_coords</li>
</ul>
<p>Mario Kleiner (1):</p>
<ul>
<li>glx: Handle out-of-sequence swap completion events correctly. (v2)</li>
</ul>
<p>Matt Turner (2):</p>
<ul>
<li>r300g: Use PATH_MAX instead of limiting ourselves to 100 chars.</li>
<li>r300g: Check return value of snprintf().</li>
</ul>
<p>Rob Clark (2):</p>
<ul>
<li>freedreno/ir3: fix silly typo for binning pass shaders</li>
<li>freedreno: update generated headers</li>
</ul>
<p>Samuel Iglesias Gonsalvez (1):</p>
<ul>
<li>glsl: optimize (0 cmp x + y) into (-x cmp y).</li>
</ul>
<p>Stefan Dösinger (1):</p>
<ul>
<li>r300g: Fix the ATI1N swizzle (RGTC1 and LATC1)</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,259 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.4 Release Notes / December 14, 2014</h1>
<p>
Mesa 10.4 is a new development release.
People who are concerned with stability and reliability should stick
with a previous release or wait for Mesa 10.4.1.
</p>
<p>
Mesa 10.4 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
abfbfd2d91ce81491c5bb6923ae649212ad5f82d0bee277de8704cc948dc221e MesaLib-10.4.0.tar.gz
98a7dff3a1a6708c79789de8b9a05d8042e867067f70e8f30387c15026233219 MesaLib-10.4.0.tar.bz2
443a6d46d0691b5ac811d8d30091b1716c365689b16d49c57cf273c2b76086fe MesaLib-10.4.0.zip
</pre>
<h2>New features</h2>
<p>
Note: some of the new features are only available with certain drivers.
</p>
<ul>
<li>GL_ARB_conditional_render_inverted on nv50</li>
<li>GL_ARB_sample_shading on r600</li>
<li>GL_ARB_texture_view on nv50, nvc0</li>
<li>GL_ARB_clip_control on nv50, nvc0, r300, r600, radeonsi, llvmpipe, softpipe</li>
<li>GL_KHR_context_flush_control on all drivers</li>
</ul>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79963">Bug 79963</a> - [ILK Bisected]some piglit and ogles2conform cases fail </li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=29661">Bug 29661</a> - MSVC built u_format_test fails on Windows</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=38873">Bug 38873</a> - [855gm] gnome-shell misrendered</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=54372">Bug 54372</a> - GLX_INTEL_swap_event crashes driver when swapping window buffers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=60879">Bug 60879</a> - [radeonsi] X11 can't start with acceleration enabled</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=61415">Bug 61415</a> - Clover ignores --with-opencl-libdir path</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=64471">Bug 64471</a> - Radeon HD6570 lockup in Brütal Legend with HyperZ</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=66184">Bug 66184</a> - src/mesa/state_tracker/st_glsl_to_tgsi.cpp:3216:simplify_cmp: Assertion `inst-&gt;dst.index &lt; 4096' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=67672">Bug 67672</a> - [llvmpipe] lp_test_arit fails on old CPUs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=69200">Bug 69200</a> - [Bisected]Piglit glx/glx-multithread-shader-compile aborted</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=70410">Bug 70410</a> - egl-static/Makefile: linking fails with llvm &gt;= 3.4</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=72685">Bug 72685</a> - [radeonsi hyperz] Artifacts in Unigine Sanctuary</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=72819">Bug 72819</a> - [855GM] Incorrect drop shadow color on windows and strange white rectangle when showing/hiding GLX-dock...</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=74563">Bug 74563</a> - Surfaceless contexts are not properly released by DRI drivers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=74863">Bug 74863</a> - [r600g] HyperZ broken on RV770 and CYPRESS (Left 4 Dead 2 trees corruption) bisected!</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=75011">Bug 75011</a> - [hyperz] Performance drop since git-01e6371 (disable hyperz by default) with radeonsi</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=75112">Bug 75112</a> - Meta Bug for HyperZ issues on r600g and radeonsi</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76252">Bug 76252</a> - Dynamic loading/unloading of opengl32.dll results in a deadlock</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76861">Bug 76861</a> - mid3 generates slow code for constant arguments</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77957">Bug 77957</a> - Variably-indexed constant arrays result in terrible shader code</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78468">Bug 78468</a> - Compiling of shader gets stuck in infinite loop</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78770">Bug 78770</a> - [SNB bisected]Webglc conformance/textures/texture-size-limit.html fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79155">Bug 79155</a> - [Tesseract Game] Global Illumination: Medium Causes Color Distortion</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79462">Bug 79462</a> - [NVC0/Codegen] Shader compilation falis in spill logic</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80011">Bug 80011</a> - [softpipe] tgsi/tgsi_exec.c:2023:exec_txf: Assertion `0' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80012">Bug 80012</a> - [softpipe] draw/draw_gs.c:113:tgsi_fetch_gs_outputs: Assertion `!util_is_inf_or_nan(output[slot][0])' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80050">Bug 80050</a> - [855GM] Incorrect drop shadow color under windows in Cinnamon persists with MESA 10.1.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80247">Bug 80247</a> - Khronos conformance test ES3-CTS.gtf.GL3Tests.transform_feedback.transform_feedback_vertex_id fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80561">Bug 80561</a> - Incorrect implementation of some VDPAU APIs.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80615">Bug 80615</a> - Files in bellagio directory [omx tracker] don't respect installation folder</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80848">Bug 80848</a> - [dri3] Building mesa fails with dri3 enabled</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81680">Bug 81680</a> - [r600g] Firefox crashes with hardware acceleration turned on</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82255">Bug 82255</a> - [VP2] Chroma planes are vertically stretched during VDPAU playback</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82472">Bug 82472</a> - piglit 16385-consecutive-chars regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82537">Bug 82537</a> - Stunt Rally GLSL compiler assertion failure</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82538">Bug 82538</a> - Super Maryo Chronicles fails with st/mesa assertion failure</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82539">Bug 82539</a> - vmw_screen_dri.lo In file included from vmw_screen_dri.c:41: vmwgfx_drm.h:32:17: error: drm.h: No such file or directory</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82796">Bug 82796</a> - [IVB/BYT-M/HSW/BDW Bisected]Synmark2_v6.0_OglTerrainFlyInst/OglTerrainPanInst cannot run as image validation failed</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82804">Bug 82804</a> - unreal engine 4 rendering errors</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82828">Bug 82828</a> - Regression: Crash in 3Dmark2001</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82846">Bug 82846</a> - [BDW Bisected] Gpu hang when running Lightsmark v2008/Warsow v1.0/Xonotic v0.7/unigine-demos</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82881">Bug 82881</a> - test_vec4_register_coalesce regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82882">Bug 82882</a> - [swrast] piglit glsl-fs-uniform-bool-1 regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82921">Bug 82921</a> - layout(location=0) emits error &gt;= MAX_UNIFORM_LOCATIONS due to integer underflow</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82929">Bug 82929</a> - [BDW Bisected]glxgears causes X hang</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82932">Bug 82932</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.shaders.indexing.vector_subscript.vec3_static_loop_subscript_write_direct_read_vertex fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83079">Bug 83079</a> - [NVC0] Dota 2 (Linux native and Wine) crash with Nouveau Drivers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83080">Bug 83080</a> - [SNB+ Bisected]ES3-CTS.shaders.loops.do_while_constant_iterations.mixed_break_continue_fragment fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83081">Bug 83081</a> - [BDW Bisected]Piglit spec_ARB_sample_shading_builtin-gl-sample-mask_2 is core dumped</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83127">Bug 83127</a> - [ILK Bisected]Piglit glean_texCombine fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83148">Bug 83148</a> - Unity invisible under Ubuntu 14.04 and 14.10</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83355">Bug 83355</a> - FTBFS: src/mesa/program/program_lexer.l:122:64: error: unknown type name 'YYSTYPE'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83380">Bug 83380</a> - Linking fails when not writing gl_Position.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83418">Bug 83418</a> - EU IV is incorrectly rendered after git1409011930.d571f2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83432">Bug 83432</a> - r600_query.c:269:r600_emit_query_end: Assertion `ctx-&gt;num_pipelinestat_queries &gt; 0' failed [Gallium HUD]</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83463">Bug 83463</a> - [swrast] piglit glsl-vs-clamp-1 regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83468">Bug 83468</a> - [UBO] Using bool from UBO as if-statement condition asserts</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83500">Bug 83500</a> - si_dma_copy_tile causes GPU hangs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83506">Bug 83506</a> - [UBO] row_major layout ignored inside structures</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83533">Bug 83533</a> - [UBO] nested structures don't get appropriate padding</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83573">Bug 83573</a> - [swrast] piglit fs-op-not-bool-using-if regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83574">Bug 83574</a> - [llvmpipe] [softpipe] piglit arb_explicit_uniform_location-use-of-unused-loc regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83741">Bug 83741</a> - [UBO] row_major layout partially ignored for arrays of structures</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83777">Bug 83777</a> - [regression] ilo fails to build</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83934">Bug 83934</a> - Structures must have same name to be considered same type.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84140">Bug 84140</a> - mplayer crashes playing some files using vdpau output</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84145">Bug 84145</a> - UE4: Realistic Rendering Demo render blue</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84178">Bug 84178</a> - Big glamor regression in Xorg server 1.6.99.1 GIT: x11perf 1.5 Test: PutImage XY 500x500 Square</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84355">Bug 84355</a> - texture2DProjLod and textureCubeLod are not supported when using GLES.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84529">Bug 84529</a> - [IVB bisected] glean fragProg1 CMP test failed</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84538">Bug 84538</a> - lp_test_format.c:226:4: error: too few arguments to function gallivm_create</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84539">Bug 84539</a> - brw_fs_register_coalesce.cpp:183: bool fs_visitor::register_coalesce(): Assertion `src_size &lt;= 11' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84557">Bug 84557</a> - [HSW] &quot;Emit ELSE/ENDIF JIP with type D on Gen 7&quot; causes Atomic Afterlife and GPU hangs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84651">Bug 84651</a> - Distorted graphics or black window when running Battle.net app on Intel hardware via wine</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84662">Bug 84662</a> - Long pauses with Unreal demo Elemental on R9270X since : Always flush the HDP cache before submitting a CS to the GPU</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84777">Bug 84777</a> - [BSW]Piglit spec_glsl-1.50_execution_geometry-basic fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84807">Bug 84807</a> - Build issue starting between bf4aecfb2acc8d0dc815105d2f36eccbc97c284b and a3e9582f09249ad27716ba82c7dfcee685b65d51</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85189">Bug 85189</a> - llvm/invocation.cpp: In function 'void {anonymous}::optimize(llvm::Module*, unsigned int, const std::vector&lt;llvm::Function*&gt;&amp;)': llvm/invocation.cpp:324:18: error: expected type-specifier</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85267">Bug 85267</a> - vlc crashes with vdpau (Radeon 3850HD) [r600]</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85377">Bug 85377</a> - lp_test_format failure with llvm-3.6</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85425">Bug 85425</a> - [bisected] Compiler error in clip control operations in meta</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85429">Bug 85429</a> - indirect.c:296: multiple definition of `__indirect_glNewList'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85454">Bug 85454</a> - Unigine Sanctuary with Wine crashes on Mesa Git</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85647">Bug 85647</a> - Random radeonsi crashes with mesa 10.3.x</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85683">Bug 85683</a> - [i965 Bisected]Piglit shaders_glsl-vs-raytrace-bug26691 segfault</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85691">Bug 85691</a> - 'glsl: Drop constant 0.0 components from dot products.' broke piglit shaders/glsl-gnome-shell-dim-window and a few others with Gallium</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86025">Bug 86025</a> - src\glsl\list.h(535) : error C2143: syntax error : missing ';' before 'type'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86089">Bug 86089</a> - [r600g][mesa 10.4.0-dev] shader failure - r600_sb::bc_finalizer::cf_peephole() when starting Second Life</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86145">Bug 86145</a> - Pipeline statistic counter values for VF always 0</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86618">Bug 86618</a> - [NV96] neg modifiers not working in MIN and MAX operations</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86760">Bug 86760</a> - mesa doesn't build: recipe for target 'r600_llvm.lo' failed</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86764">Bug 86764</a> - [SNB+ Bisected]Piglit glean/pointSprite fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86788">Bug 86788</a> - (bisected) 32bit UrbanTerror 4.1 timedemo sse4.1 segfault...</li>
</ul>
<h2>Changes</h2>
<ul>
<li>The environment variable GALLIUM_MSAA that forced a multisample GLX visual was removed.</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,212 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.0 Release Notes / March 06, 2015</h1>
<p>
Mesa 10.5.0 is a new development release.
People who are concerned with stability and reliability should stick
with a previous release or wait for Mesa 10.5.1.
</p>
<p>
Mesa 10.5.0 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
2bb6e2e982ee4d8264d52d638c2a4e3f8a164190336d72d4e34ae1304d87ed91 mesa-10.5.0.tar.gz
d7ca9f9044bbdd674377e3eebceef1fae339c8817b9aa435c2053e4fea44e5d3 mesa-10.5.0.tar.xz
</pre>
<h2>New features</h2>
<p>
Note: some of the new features are only available with certain drivers.
</p>
<ul>
<li>GL_ARB_framebuffer_sRGB on freedreno</li>
<li>GL_ARB_texture_rg on freedreno</li>
<li>GL_EXT_packed_float on freedreno</li>
<li>GL_EXT_polygon_offset_clamp on i965, nv50, nvc0, r600, radeonsi, llvmpipe</li>
<li>GL_EXT_texture_shared_exponent on freedreno</li>
<li>GL_EXT_texture_snorm on freedreno</li>
</ul>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=10370">Bug 10370</a> - Incorrect pixels read back if draw bitmap texture through Display list</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=45348">Bug 45348</a> - [swrast] piglit fbo-drawbuffers-arbfp regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=60879">Bug 60879</a> - [radeonsi] X11 can't start with acceleration enabled</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=67672">Bug 67672</a> - [llvmpipe] lp_test_arit fails on old CPUs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77544">Bug 77544</a> - i965: Try to use LINE instructions to perform MAD with immediate arguments</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78770">Bug 78770</a> - [SNB bisected]Webglc conformance/textures/texture-size-limit.html fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80568">Bug 80568</a> - [gen4] GPU Crash During Google Chrome Operation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82477">Bug 82477</a> - [softpipe] piglit fp-long-alu regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82585">Bug 82585</a> - geometry shader with optional out variable segfaults</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82991">Bug 82991</a> - Inverted bumpmap in webgl applications</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83463">Bug 83463</a> - [swrast] piglit glsl-vs-clamp-1 regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83500">Bug 83500</a> - si_dma_copy_tile causes GPU hangs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83510">Bug 83510</a> - Graphical glitches in Unreal Engine 4</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83908">Bug 83908</a> - [i965] Incorrect icon colors in Steam Big Picture</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84212">Bug 84212</a> - [BSW]ES3-CTS.shaders.loops.do_while_dynamic_iterations.vector_counter_vertex fails and causes GPU hang</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84651">Bug 84651</a> - Distorted graphics or black window when running Battle.net app on Intel hardware via wine</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84777">Bug 84777</a> - [BSW]Piglit spec_glsl-1.50_execution_geometry-basic fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85367">Bug 85367</a> - [gen4] GPU hang in glmark-es2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85467">Bug 85467</a> - [llvmpipe] piglit gl-1.0-dlist-beginend failure with llvm-3.6.0svn</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85529">Bug 85529</a> - Surfaces not drawn in Unvanquished</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85647">Bug 85647</a> - Random radeonsi crashes with mesa 10.3.x</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85696">Bug 85696</a> - r600g+nine: Bioshock shader failure after 7b1c0cbc90d456384b0950ad21faa3c61a6b43ff</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86089">Bug 86089</a> - [r600g][mesa 10.4.0-dev] shader failure - r600_sb::bc_finalizer::cf_peephole() when starting Second Life</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86618">Bug 86618</a> - [NV96] neg modifiers not working in MIN and MAX operations</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86760">Bug 86760</a> - mesa doesn't build: recipe for target 'r600_llvm.lo' failed</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86764">Bug 86764</a> - [SNB+ Bisected]Piglit glean/pointSprite fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86788">Bug 86788</a> - (bisected) 32bit UrbanTerror 4.1 timedemo sse4.1 segfault...</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86811">Bug 86811</a> - [BDW/BSW Bisected]Piglit spec_arb_shading_language_packing_execution_built-in-functions_vs-unpackSnorm4x8 fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86837">Bug 86837</a> - kodi segfault since auxiliary/vl: rework the build of the VL code</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86939">Bug 86939</a> - test_vf_float_conversions.cpp:63:12: error: expected primary-expression before union</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86944">Bug 86944</a> - glsl_parser_extras.cpp&quot;, line 1455: Error: Badly formed expression. (Oracle Studio)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86958">Bug 86958</a> - lp_bld_misc.cpp:503:40: error: no matching function for call to llvm::EngineBuilder::setMCJITMemoryManager(ShaderMemoryManager*&amp;)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86969">Bug 86969</a> - _drm_intel_gem_bo_references() function takes half the CPU with Witcher2 game</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87076">Bug 87076</a> - Dead Island needs allow_glsl_extension_directive_midshader</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87516">Bug 87516</a> - glProgramBinary violates spec</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87619">Bug 87619</a> - Changes to state such as render targets change fragment shader without marking it dirty.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87658">Bug 87658</a> - [llvmpipe] SEGV in sse2_has_daz on ancient Pentium4-M</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87694">Bug 87694</a> - [SNB] Crash in brw_begin_transform_feedback</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87886">Bug 87886</a> - constant fps drops with Intel and Radeon</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87887">Bug 87887</a> - [i965 Bisected]ES2-CTS.gtf.GL.cos.cos_float_vert_xvary fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87913">Bug 87913</a> - CPU cacheline size of 0 can be returned by CPUID leaf 0x80000006 in some virtual machines</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88079">Bug 88079</a> - dEQP-GLES3.functional.fbo.completeness.renderable.renderbuffer.color0 tests fail due to enabling of GL_RGB and GL_RGBA</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88170">Bug 88170</a> - 32 bits opengl apps crash with latest llvm 3.6 git / mesa git / radeonsi</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88219">Bug 88219</a> - include/c11/threads_posix.h:197: undefined reference to `pthread_mutex_lock'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88227">Bug 88227</a> - Radeonsi: High GTT usage in Prison Architect large map</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88248">Bug 88248</a> - Calling glClear while there is an occlusion query in progress messes up the results</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88335">Bug 88335</a> - format_pack.c:9567:22: error: expected ')'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88385">Bug 88385</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.gtf.GL3Tests.packed_pixels.packed_pixels core dumped</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88467">Bug 88467</a> - nir.c:140: error: nir_src has no member named ssa</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88478">Bug 88478</a> - #error &quot;&lt;malloc.h&gt; has been replaced by &lt;stdlib.h&gt;&quot;</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88519">Bug 88519</a> - sha1.c:210:22: error: 'grcy_md_hd_t' undeclared (first use in this function)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88523">Bug 88523</a> - sha1.c:37: error: 'SHA1_CTX' undeclared (first use in this function)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88561">Bug 88561</a> - [radeonsi][regression,bisected] Depth test/buffer issues in Portal</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88658">Bug 88658</a> - (bisected) Slow video playback on Kabini</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88662">Bug 88662</a> - unaligned access to gl_dlist_node</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88783">Bug 88783</a> - FTBFS: Clover: src/gallium/state_trackers/clover/llvm/invocation.cpp:335:49: error: no matching function for call to 'llvm::TargetLibraryInfo::TargetLibraryInfo(llvm::Triple)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88792">Bug 88792</a> - [BDW/BSW Bisected]Piglit spec_ARB_pixel_buffer_object_pbo-read-argb8888 fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88806">Bug 88806</a> - nir/nir_constant_expressions.c:2754:15: error: controlling expression type 'unsigned int' not compatible with any generic association type</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88841">Bug 88841</a> - [SNB/IVB/HSW/BDW Bisected]Piglit spec_EGL_NOK_texture_from_pixmap_basic fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88852">Bug 88852</a> - macros.h(181) : error C2143: syntax error : missing '{' before 'enum [tag]'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88905">Bug 88905</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.gtf.GL3Tests.packed_pixels.packed_pixels fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88930">Bug 88930</a> - [osmesa] osbuffer-&gt;textures should be indexed by attachment type</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88962">Bug 88962</a> - [osmesa] Crash on postprocessing if z buffer is NULL</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89032">Bug 89032</a> - [BDW/BSW/SKL Bisected]Piglit spec_OpenGL_1.1_infinite-spot-light fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89037">Bug 89037</a> - [SKL]Piglit spec_EXT_texture_array_copyteximage_1D_ARRAY_samples=2 sporadically causes GPU hang</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89068">Bug 89068</a> - glTexImage2D regression by texstore_rgba switch to _mesa_format_convert</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89069">Bug 89069</a> - Lack of grass in The Talos Principle on radeonsi (native\wine\nine)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89180">Bug 89180</a> - [IVB regression] Rendering issues in Mass Effect through VMware Workstation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86330">Bug 86330</a> - lp_bld_debug.cpp:112: multiple definition of `raw_debug_ostream::write_impl(char const*, unsigned long)'</li>
</ul>
<h2>Changes</h2>
<ul>
<li>Removed support for GCC versions earlier than 4.2.0.</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,217 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.1 Release Notes / March 13, 2015</h1>
<p>
Mesa 10.5.1 is a bug fix release which fixes bugs found since the 10.5.0 release.
</p>
<p>
Mesa 10.5.1 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
b5b6256a6d46023e16a675257fd11a0f94d7b3e60a76cf112952da3d0fef8e9b mesa-10.5.1.tar.gz
ffc51943d15c6812ee7611d053d8980a683fbd6a4986cff567b12cc66637d679 mesa-10.5.1.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79202">Bug 79202</a> - valgrind errors in glsl-fs-uniform-array-loop-unroll.shader_test; random code generation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84613">Bug 84613</a> - [G965, bisected] piglit regressions : glslparsertest.glsl2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86747">Bug 86747</a> - Noise in Football Manager 2014 textures</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86974">Bug 86974</a> - INTEL_DEBUG=shader_time always asserts in fs_generator::generate_code() when Mesa is built with --enable-debug (= with asserts)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88246">Bug 88246</a> - Commit 2881b12 causes 43 DrawElements test regressions</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88793">Bug 88793</a> - [BDW/BSW Bisected]Piglit/shaders_glsl-max-varyings fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88883">Bug 88883</a> - ir-a2xx.c: variable changed in assert statement</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88885">Bug 88885</a> - Transform feedback uses incorrect interleaving if a previous draw did not write gl_Position</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89095">Bug 89095</a> - [SNB/IVB/BYT Bisected]Webglc conformance/glsl/functions/glsl-function-mix-float.html fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89156">Bug 89156</a> - r300g: GL_COMPRESSED_RED_RGTC1 / ATI1N support broken</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89224">Bug 89224</a> - Incorrect rendering of Unigine Valley running in VM on VMware Workstation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89292">Bug 89292</a> - [regression,bisected] incomplete screenshots in some cases</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89311">Bug 89311</a> - [regression, bisected] dEQP: Added entry points for glCompressedTextureSubImage*D.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89312">Bug 89312</a> - [regression, bisected] main: Added entry points for CopyTextureSubImage*D. (d6b7c40cecfe01)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89315">Bug 89315</a> - [HSW, regression, bisected] i965/fs: Emit MAD instructions when possible.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89317">Bug 89317</a> - [HSW, regression, bisected] i965: Add LINTERP/CINTERP to can_do_cmod() (d91390634)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89416">Bug 89416</a> - UE4Editor crash after load project</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89430">Bug 89430</a> - [g965][bisected] arb_copy_image-targets gl_texture* tests fail</li>
</ul>
<h2>Changes</h2>
<p>Andrey Sudnik (1):</p>
<ul>
<li>i965/vec4: Don't lose the saturate modifier in copy propagation.</li>
</ul>
<p>Chris Forbes (1):</p>
<ul>
<li>i965/gs: Check newly-generated GS-out VUE map against correct stage</li>
</ul>
<p>Daniel Stone (1):</p>
<ul>
<li>egl: Take alpha bits into account when selecting GBM formats</li>
</ul>
<p>Emil Velikov (5):</p>
<ul>
<li>docs: Add sha256 sums for the 10.5.0 release</li>
<li>egl/main: no longer export internal function</li>
<li>cherry-ignore: ignore a few more commits picked without -x</li>
<li>mapi: fix commit 90411b56f6bc817e229d8801ac0adad6d4e3fb7a</li>
<li>Update version to 10.5.1</li>
</ul>
<p>Frank Henigman (1):</p>
<ul>
<li>intel: fix EGLImage renderbuffer _BaseFormat</li>
</ul>
<p>Iago Toral Quiroga (1):</p>
<ul>
<li>i965: Fix out-of-bounds accesses into pull_constant_loc array</li>
</ul>
<p>Ian Romanick (1):</p>
<ul>
<li>i965/fs/nir: Use emit_math for nir_op_fpow</li>
</ul>
<p>Ilia Mirkin (3):</p>
<ul>
<li>freedreno: move fb state copy after checking for size change</li>
<li>freedreno/ir3: fix array count returned by TXQ</li>
<li>freedreno/ir3: get the # of miplevels from getinfo</li>
</ul>
<p>Jason Ekstrand (2):</p>
<ul>
<li>meta/TexSubImage: Stash everything other than PIXEL_TRANSFER/store in meta_begin</li>
<li>main/base_tex_format: Properly handle STENCIL_INDEX1/4/16</li>
</ul>
<p>Kenneth Graunke (8):</p>
<ul>
<li>i965: Split Gen4-5 BlitFramebuffer code; prefer BLT over Meta.</li>
<li>glsl: Mark array access when copying to a temporary for the ?: operator.</li>
<li>i965/fs: Set force_writemask_all on shader_time instructions.</li>
<li>i965/fs: Set smear on shader_time diff register.</li>
<li>i965/fs: Make emit_shader_time_write return rather than emit.</li>
<li>i965/fs: Make get_timestamp() pass back the MOV rather than emitting it.</li>
<li>i965/fs: Make emit_shader_time_end() insert before EOT.</li>
<li>i965/fs: Don't issue FB writes for bound but unwritten color targets.</li>
</ul>
<p>Laura Ekstrand (2):</p>
<ul>
<li>main: Fix target checking for CompressedTexSubImage*D.</li>
<li>main: Fix target checking for CopyTexSubImage*D.</li>
</ul>
<p>Marc-Andre Lureau (1):</p>
<ul>
<li>gallium/auxiliary/indices: fix start param</li>
</ul>
<p>Marek Olšák (3):</p>
<ul>
<li>r300g: fix RGTC1 and LATC1 SNORM formats</li>
<li>r300g: fix a crash when resolving into an sRGB texture</li>
<li>r300g: fix sRGB-&gt;sRGB blits</li>
</ul>
<p>Matt Turner (12):</p>
<ul>
<li>i965/vec4: Fix implementation of i2b.</li>
<li>mesa: Indent break statements and add a missing one.</li>
<li>mesa: Free memory allocated for luminance in readpixels.</li>
<li>mesa: Correct backwards NULL check.</li>
<li>i965: Consider scratch writes to have side effects.</li>
<li>i965/fs: Don't use backend_visitor::instructions after creating the CFG.</li>
<li>r300g: Use PATH_MAX instead of limiting ourselves to 100 chars.</li>
<li>r300g: Check return value of snprintf().</li>
<li>i965/fs: Don't propagate cmod to inst with different type.</li>
<li>i965: Tell intel_get_memcpy() which direction the memcpy() is going.</li>
<li>Revert SHA1 additions.</li>
<li>i965: Avoid applying negate to wrong MAD source.</li>
</ul>
<p>Neil Roberts (4):</p>
<ul>
<li>meta: In pbo_{Get,}TexSubImage don't repeatedly rebind the source tex</li>
<li>Revert "common: Fix PBOs for 1D_ARRAY."</li>
<li>meta: Allow GL_UN/PACK_IMAGE_HEIGHT in _mesa_meta_pbo_Get/TexSubImage</li>
<li>meta: Fix the y offset for 1D_ARRAY in _mesa_meta_pbo_TexSubImage</li>
</ul>
<p>Rob Clark (11):</p>
<ul>
<li>freedreno/ir3: fix silly typo for binning pass shaders</li>
<li>freedreno/a2xx: fix increment in assert</li>
<li>freedreno/a4xx: bit of cleanup</li>
<li>freedreno: update generated headers</li>
<li>freedreno/a4xx: set PC_PRIM_VTX_CNTL.VAROUT properly</li>
<li>freedreno: update generated headers</li>
<li>freedreno/a4xx: aniso filtering</li>
<li>freedreno/ir3: fix up cat6 instruction encodings</li>
<li>freedreno/ir3: add support for memory (cat6) instructions</li>
<li>freedreno/ir3: handle flat bypass for a4xx</li>
<li>freedreno/ir3: fix failed assert in grouping</li>
</ul>
<p>Stefan Dösinger (1):</p>
<ul>
<li>r300g: Fix the ATI1N swizzle (RGTC1 and LATC1)</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,130 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.2 Release Notes / March 28, 2015</h1>
<p>
Mesa 10.5.2 is a bug fix release which fixes bugs found since the 10.5.1 release.
</p>
<p>
Mesa 10.5.2 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
755220e160a9f22fda0dffd47746f997b6e196d03f8edc390df7793aecaaa541 mesa-10.5.2.tar.gz
2f4b6fb77c3e7d6f861558d0884a3073f575e1e673dad8d1b0624e78e9c4dd44 mesa-10.5.2.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88534">Bug 88534</a> - include/c11/threads_posix.h PTHREAD_MUTEX_RECURSIVE_NP not defined</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89328">Bug 89328</a> - python required to build Mesa release tarballs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89530">Bug 89530</a> - FTBFS in loader: missing fstat</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89590">Bug 89590</a> - Crash in glLinkProgram with shaders with multiple constant arrays</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89680">Bug 89680</a> - Hard link exist in Mesa 10.5.1 sources</li>
</ul>
<h2>Changes</h2>
<p>Anuj Phogat (1):</p>
<ul>
<li>glsl: Generate link error for non-matching gl_FragCoord redeclarations</li>
</ul>
<p>Emil Velikov (7):</p>
<ul>
<li>docs: Add sha256 sums for the 10.5.1 release</li>
<li>automake: add missing egl files to the tarball</li>
<li>st/egl: don't ship the dri2.c link at the tarball</li>
<li>loader: include &lt;sys/stat.h&gt; for non-sysfs builds</li>
<li>auxiliary/os: fix the android build - s/drm_munmap/os_munmap/</li>
<li>cherry-ignore: add commit non applicable for 10.5</li>
<li>Update version to 10.5.2</li>
</ul>
<p>Felix Janda (1):</p>
<ul>
<li>c11/threads: Use PTHREAD_MUTEX_RECURSIVE by default</li>
</ul>
<p>Francisco Jerez (1):</p>
<ul>
<li>i965: Set nr_params to the number of uniform components in the VS/GS path.</li>
</ul>
<p>Ilia Mirkin (2):</p>
<ul>
<li>freedreno/a3xx: use the same layer size for all slices</li>
<li>freedreno: fix slice pitch calculations</li>
</ul>
<p>Marek Olšák (1):</p>
<ul>
<li>radeonsi: increase coords array size for radeon_llvm_emit_prepare_cube_coords</li>
</ul>
<p>Mario Kleiner (2):</p>
<ul>
<li>glx: Handle out-of-sequence swap completion events correctly. (v2)</li>
<li>mapi: Make private copies of name strings provided by client.</li>
</ul>
<p>Rob Clark (1):</p>
<ul>
<li>freedreno: update generated headers</li>
</ul>
<p>Samuel Iglesias Gonsalvez (2):</p>
<ul>
<li>glsl: optimize (0 cmp x + y) into (-x cmp y).</li>
<li>configure: Introduce new output variable to ax_check_python_mako_module.m4</li>
</ul>
<p>Tapani Pälli (1):</p>
<ul>
<li>glsl: fix names in lower_constant_arrays_to_uniforms</li>
</ul>
<p>Tom Stellard (1):</p>
<ul>
<li>clover: Return 0 as storage size for local kernel args that are not set v2</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,125 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.3 Release Notes / April 12, 2015</h1>
<p>
Mesa 10.5.3 is a bug fix release which fixes bugs found since the 10.5.2 release.
</p>
<p>
Mesa 10.5.3 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
2371b8e210ccd19f61dd94b6664d612e5a479ba7d431a074512d87633bd6aeb4 mesa-10.5.3.tar.gz
8701ee1be4f5c03238f5e63c1a9bd4cc03a2f6c0155ed42a1ae7d58f18912ba2 mesa-10.5.3.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83962">Bug 83962</a> - [HSW/BYT]Piglit spec_ARB_gpu_shader5_arb_gpu_shader5-emitstreamvertex_nodraw fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89679">Bug 89679</a> - [NV50] Portal/Half-Life 2 will not start (native Steam)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89746">Bug 89746</a> - Mesa and LLVM 3.6+ break opengl for genymotion</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89754">Bug 89754</a> - vertexAttrib fails WebGL Conformance test with mesa drivers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89758">Bug 89758</a> - pow WebGL Conformance test with mesa drivers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89759">Bug 89759</a> - WebGL OGL ES GLSL conformance test with mesa drivers fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89905">Bug 89905</a> - scons build broken on 10.5.2 due to activated vega st</li>
</ul>
<h2>Changes</h2>
<p>Dave Airlie (1):</p>
<ul>
<li>st_glsl_to_tgsi: only do mov copy propagation on temps (v2)</li>
</ul>
<p>Emil Velikov (5):</p>
<ul>
<li>docs: Add sha256 sums for the 10.5.2 release</li>
<li>xmlpool: don't forget to ship the MOS</li>
<li>configure.ac: error out if python/mako is not found when required</li>
<li>dist: add the VG depedencies into the tarball</li>
<li>Update version to 10.5.3</li>
</ul>
<p>Iago Toral Quiroga (1):</p>
<ul>
<li>i965: Do not render primitives in non-zero streams then TF is disabled</li>
</ul>
<p>Ilia Mirkin (7):</p>
<ul>
<li>st/mesa: update arrays when the current attrib has been updated</li>
<li>nv50/ir: take postFactor into account when doing peephole optimizations</li>
<li>nv50/ir/gk110: fix offset flag position for TXD opcode</li>
<li>freedreno/a3xx: fix 3d texture layout</li>
<li>freedreno/a3xx: point size should not be divided by 2</li>
<li>nv50: allocate more offset space for occlusion queries</li>
<li>nv50,nvc0: limit the y-tiling of 3d textures to the first level's tiling</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>i965: Fix instanced geometry shaders on Gen8+.</li>
<li>i965: Add forgotten multi-stream code to Gen8 SOL state.</li>
</ul>
<p>Marcin Ślusarz (1):</p>
<ul>
<li>nouveau: synchronize "scratch runout" destruction with the command stream</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>radeonsi: Cache LLVMTargetMachineRef in context instead of in screen</li>
</ul>
<p>Tom Stellard (1):</p>
<ul>
<li>clover: Return CL_BUILD_ERROR for CL_PROGRAM_BUILD_STATUS when compilation fails v2</li>
</ul>
<p>Ville Syrjälä (1):</p>
<ul>
<li>i965: Fix URB size for CHV</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,125 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.4 Release Notes / April 24, 2015</h1>
<p>
Mesa 10.5.4 is a bug fix release which fixes bugs found since the 10.5.3 release.
</p>
<p>
Mesa 10.5.4 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
e1089567fc7bf8d9b2d8badcc9f2fc3b758701c8c0ccfe7af1805549fea53f11 mesa-10.5.4.tar.gz
b51e723f3a20d842c88a92d809435b229fc4744ca0dbec0317d9d4a3ac4c6803 mesa-10.5.4.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=69226">Bug 69226</a> - Cannot enable basic shaders with Second Life aborts attempt</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=71591">Bug 71591</a> - Second Life shaders fail to compile (extension declared in middle of shader)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81025">Bug 81025</a> - [IVB/BYT Bisected]Piglit spec_ARB_draw_indirect_arb_draw_indirect-draw-elements-prim-restart-ugly fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89457">Bug 89457</a> - [BSW Bisected]ogles3conform ES3-CTS.gtf.GL3Tests.shadow.shadow_execution_vert fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89957">Bug 89957</a> - vm protection faults in piglit lest: texsubimage cube_map_array pbo</li>
</ul>
<h2>Changes</h2>
<p>Brian Paul (1):</p>
<ul>
<li>glsl: rewrite glsl_type::record_key_hash() to avoid buffer overflow</li>
</ul>
<p>Dave Airlie (2):</p>
<ul>
<li>st/mesa: convert sub image for cube map arrays to 2d arrays for upload</li>
<li>st/mesa: align cube map arrays layers</li>
</ul>
<p>Emil Velikov (11):</p>
<ul>
<li>docs: Add 256 sums for the 10.5.3 release</li>
<li>radeonsi: remove unused si_dump_key()</li>
<li>android: use LOCAL_SHARED_LIBRARIES over TARGET_OUT_HEADERS</li>
<li>android: add $(mesa_top)/src include to the whole of mesa</li>
<li>android: egl: add libsync_cflags to the build</li>
<li>android: dri/common: conditionally include drm_cflags/set __NOT_HAVE_DRM_H</li>
<li>android: add HAVE__BUILTIN_* and HAVE_FUNC_ATTRIBUTE_* defines</li>
<li>android: add $(mesa_top)/src/mesa/main to the includes list</li>
<li>android: dri: link against libmesa_util</li>
<li>android: mesa: fix the path of the SSE4_1 optimisations</li>
<li>Update version to 10.5.4</li>
</ul>
<p>Ian Romanick (1):</p>
<ul>
<li>nir: Fix typo in "ushr by 0" algebraic replacement</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>i965: Fix software primitive restart with indirect draws.</li>
<li>drirc: Add "Second Life" quirk (allow_glsl_extension_directive_midshader).</li>
</ul>
<p>Kristian Høgsberg (1):</p>
<ul>
<li>i965: Rewrite ir_tex to ir_txl with lod 0 for vertex shaders</li>
</ul>
<p>Marek Olšák (2):</p>
<ul>
<li>glsl_to_tgsi: fix out-of-bounds constant access and crash for uniforms</li>
<li>glsl_to_tgsi: don't use a potentially-undefined immediate for ir_query_levels</li>
</ul>
<p>Mathias Froehlich (1):</p>
<ul>
<li>i965: Flush batchbuffer containing the query on glQueryCounter.</li>
</ul>
<p>Mauro Rossi (2):</p>
<ul>
<li>android: mesa: generate the format_{un,}pack.[ch] sources</li>
<li>android: add inital NIR build</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,95 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.5 Release Notes / May 11, 2015</h1>
<p>
Mesa 10.5.5 is a bug fix release which fixes bugs found since the 10.5.4 release.
</p>
<p>
Mesa 10.5.5 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
c10f00fd792b8290dd51ebcc48a9016c4cafab19ec205423c6fcadfd7f3a59f2 mesa-10.5.5.tar.gz
4ac4e4ea3414f1cadb1467f2f173f9e56170d31e8674f7953a46f0549d319f28 mesa-10.5.5.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88521">Bug 88521</a> - GLBenchmark 2.7 TRex renders with artifacts on Gen8 with !UXA</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89455">Bug 89455</a> - [NVC0/Gallium] Unigine Heaven black and white boxes</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89689">Bug 89689</a> - [Regression] Weston on DRM backend won't start with new version of mesa</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90130">Bug 90130</a> - gl_PrimitiveId seems to reset at 340</li>
</ul>
<h2>Changes</h2>
<p>Boyan Ding (1):</p>
<ul>
<li>i965: Add XRGB8888 format to intel_screen_make_configs</li>
</ul>
<p>Emil Velikov (3):</p>
<ul>
<li>docs: Add sha256 sums for the 10.5.4 release</li>
<li>r300: do not link against libdrm_intel</li>
<li>Update version to 10.5.5</li>
</ul>
<p>Ilia Mirkin (4):</p>
<ul>
<li>nvc0/ir: flush denorms to zero in non-compute shaders</li>
<li>gk110/ir: fix set with a register dest to not auto-set the abs flag</li>
<li>nvc0/ir: fix predicated PFETCH emission</li>
<li>nv50/ir: fix asFlow() const helper for OP_JOIN</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>i965: Make intel_emit_linear_blit handle Gen8+ alignment restrictions.</li>
<li>i965: Disallow linear blits that are not cacheline aligned.</li>
</ul>
<p>Roland Scheidegger (1):</p>
<ul>
<li>draw: fix prim ids when there's no gs</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,331 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.0 Release Notes / June 14, 2015</h1>
<p>
Mesa 10.6.0 is a new development release.
People who are concerned with stability and reliability should stick
with a previous release or wait for Mesa 10.6.1.
</p>
<p>
Mesa 10.6.0 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
9bc659abdba26202509304f259723aaa4343dba6aac4bd87d5baea11d23c8c63 mesa-10.6.0.tar.gz
f37e2633978deed02ff0522abc36c709586e2b555fd439a82ab71dce2c866c76 mesa-10.6.0.tar.xz
</pre>
<h2>New features</h2>
<p>
Note: some of the new features are only available with certain drivers.
</p>
<ul>
<li>GL_AMD_pinned_memory on r600, radeonsi</li>
<li>GL_ARB_clip_control on i965</li>
<li>GL_ARB_depth_buffer_float on freedreno</li>
<li>GL_ARB_depth_clamp on freedreno</li>
<li>GL_ARB_direct_state_access on all drivers that support GL 2.0+</li>
<li>GL_ARB_draw_indirect, GL_ARB_multi_draw_indirect on r600</li>
<li>GL_ARB_draw_instanced on freedreno</li>
<li>GL_ARB_gpu_shader_fp64 on nvc0, softpipe</li>
<li>GL_ARB_gpu_shader5 on i965/gen8+</li>
<li>GL_ARB_instanced_arrays on freedreno</li>
<li>GL_ARB_pipeline_statistics_query on i965, nv50, nvc0, r600, radeonsi, softpipe</li>
<li>GL_ARB_program_interface_query (all drivers)</li>
<li>GL_ARB_texture_stencil8 on nv50, nvc0, r600, radeonsi, softpipe</li>
<li>GL_ARB_texture_view on llvmpipe, softpipe</li>
<li>GL_ARB_uniform_buffer_object on freedreno</li>
<li>GL_ARB_vertex_attrib_64bit on nvc0, softpipe</li>
<li>GL_ARB_viewport_array, GL_AMD_vertex_shader_viewport_index on i965/gen6</li>
<li>GL_EXT_draw_buffers2 on freedreno</li>
<li>GL_OES_EGL_sync on all drivers</li>
<li>EGL_KHR_fence_sync on i965, freedreno, nv50, nvc0, r600, radeonsi</li>
<li>EGL_KHR_wait_sync on i965, freedreno, nv50, nvc0, r600, radeonsi</li>
<li>EGL_KHR_cl_event2 on freedreno, nv50, nvc0, r600, radeonsi</li>
<li>GL_AMD_performance_monitor on nvc0</li>
</ul>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=15006">Bug 15006</a> - translate &amp; rotate the line cause Aliasing</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=27007">Bug 27007</a> - Lines disappear with GL_LINE_SMOOTH</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28832">Bug 28832</a> - piglit/general/line-aa-width fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=45348">Bug 45348</a> - [swrast] piglit fbo-drawbuffers-arbfp regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=60797">Bug 60797</a> - 1px lines in octave plot aliased to 0</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=67564">Bug 67564</a> - HiZ buffers are much larger than necessary</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=69226">Bug 69226</a> - Cannot enable basic shaders with Second Life aborts attempt</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=71591">Bug 71591</a> - Second Life shaders fail to compile (extension declared in middle of shader)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79202">Bug 79202</a> - valgrind errors in glsl-fs-uniform-array-loop-unroll.shader_test; random code generation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81025">Bug 81025</a> - [IVB/BYT Bisected]Piglit spec_ARB_draw_indirect_arb_draw_indirect-draw-elements-prim-restart-ugly fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82477">Bug 82477</a> - [softpipe] piglit fp-long-alu regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82668">Bug 82668</a> - Can't set int attributes to certain values on 32-bit</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82831">Bug 82831</a> - i965: Support GL_ARB_blend_func_extended in SIMD16</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83962">Bug 83962</a> - [HSW/BYT]Piglit spec_ARB_gpu_shader5_arb_gpu_shader5-emitstreamvertex_nodraw fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84613">Bug 84613</a> - [G965, bisected] piglit regressions : glslparsertest.glsl2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86747">Bug 86747</a> - Noise in Football Manager 2014 textures</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86792">Bug 86792</a> - [NVC0] Portal 2 Crashes in Wine</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86811">Bug 86811</a> - [BDW/BSW Bisected]Piglit spec_arb_shading_language_packing_execution_built-in-functions_vs-unpackSnorm4x8 fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86837">Bug 86837</a> - kodi segfault since auxiliary/vl: rework the build of the VL code</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86944">Bug 86944</a> - glsl_parser_extras.cpp&quot;, line 1455: Error: Badly formed expression. (Oracle Studio)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86974">Bug 86974</a> - INTEL_DEBUG=shader_time always asserts in fs_generator::generate_code() when Mesa is built with --enable-debug (= with asserts)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86980">Bug 86980</a> - [swrast] piglit fp-rfl regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87258">Bug 87258</a> - [BDW/BSW Bisected]Piglit spec_ARB_shader_atomic_counters_array-indexing fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88246">Bug 88246</a> - Commit 2881b12 causes 43 DrawElements test regressions</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88248">Bug 88248</a> - Calling glClear while there is an occlusion query in progress messes up the results</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88521">Bug 88521</a> - GLBenchmark 2.7 TRex renders with artifacts on Gen8 with !UXA</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88534">Bug 88534</a> - include/c11/threads_posix.h PTHREAD_MUTEX_RECURSIVE_NP not defined</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88561">Bug 88561</a> - [radeonsi][regression,bisected] Depth test/buffer issues in Portal</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88793">Bug 88793</a> - [BDW/BSW Bisected]Piglit/shaders_glsl-max-varyings fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88815">Bug 88815</a> - Incorrect handling of GLSL #line directive</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88883">Bug 88883</a> - ir-a2xx.c: variable changed in assert statement</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88885">Bug 88885</a> - Transform feedback uses incorrect interleaving if a previous draw did not write gl_Position</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88905">Bug 88905</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.gtf.GL3Tests.packed_pixels.packed_pixels fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88999">Bug 88999</a> - [SKL] Compiz crashes after opening unity dash</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89014">Bug 89014</a> - PIPE_QUERY_GPU_FINISHED is not acting as expected on SI</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89026">Bug 89026</a> - Renderbuffer layered state used for framebuffer completeness test</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89032">Bug 89032</a> - [BDW/BSW/SKL Bisected]Piglit spec_OpenGL_1.1_infinite-spot-light fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89037">Bug 89037</a> - [SKL]Piglit spec_EXT_texture_array_copyteximage_1D_ARRAY_samples=2 sporadically causes GPU hang</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89039">Bug 89039</a> - [SKL]etqw system hang</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89058">Bug 89058</a> - [SKL]Render error in some games (etqw-demo, nexuiz, portal)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89068">Bug 89068</a> - glTexImage2D regression by texstore_rgba switch to _mesa_format_convert</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89069">Bug 89069</a> - Lack of grass in The Talos Principle on radeonsi (native\wine\nine)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89094">Bug 89094</a> - [SNB/IVB/HSW/BYT Bisected]Ogles3conform ES3-CTS.gtf.GL3Tests.shadow.shadow_execution_vert fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89095">Bug 89095</a> - [SNB/IVB/BYT Bisected]Webglc conformance/glsl/functions/glsl-function-mix-float.html fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89112">Bug 89112</a> - u_atomic_test: u_atomic_test.c:124: test_atomic_8bits_bool: Assertion `r == 65 &amp;&amp; &quot;p_atomic_add&quot;' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89118">Bug 89118</a> - [SKL Bisected]many Ogles3conform cases core dumped</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89131">Bug 89131</a> - [Bisected] Graphical corruption in Weston, shows old framebuffer pieces</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89156">Bug 89156</a> - r300g: GL_COMPRESSED_RED_RGTC1 / ATI1N support broken</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89180">Bug 89180</a> - [IVB regression] Rendering issues in Mass Effect through VMware Workstation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89210">Bug 89210</a> - GS statistics fail on SNB</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89218">Bug 89218</a> - lower_instructions.cpp:648:48: error: invalid suffix 'd' on floating constant</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89224">Bug 89224</a> - Incorrect rendering of Unigine Valley running in VM on VMware Workstation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89260">Bug 89260</a> - macros.h:34:25: fatal error: util/u_math.h: No such file or directory</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89292">Bug 89292</a> - [regression,bisected] incomplete screenshots in some cases</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89311">Bug 89311</a> - [regression, bisected] dEQP: Added entry points for glCompressedTextureSubImage*D.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89312">Bug 89312</a> - [regression, bisected] main: Added entry points for CopyTextureSubImage*D. (d6b7c40cecfe01)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89315">Bug 89315</a> - [HSW, regression, bisected] i965/fs: Emit MAD instructions when possible.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89317">Bug 89317</a> - [HSW, regression, bisected] i965: Add LINTERP/CINTERP to can_do_cmod() (d91390634)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89328">Bug 89328</a> - python required to build Mesa release tarballs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89342">Bug 89342</a> - main/light.c:159:62: error: 'M_PI' undeclared (first use in this function)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89343">Bug 89343</a> - compiler/tests/radeon_compiler_optimize_tests.c:43:3: error: implicit declaration of function fprintf [-Werror=implicit-function-declaration]</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89345">Bug 89345</a> - imports.h:452:58: error: expected declaration specifiers or '...' before 'va_list'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89364">Bug 89364</a> - c99_alloca.h:40:22: fatal error: alloca.h: No such file or directory</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89372">Bug 89372</a> - [softpipe] piglit glsl-1.50 generate-zero-primitives regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89387">Bug 89387</a> - Double delete in lp_bld_misc.cpp</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89416">Bug 89416</a> - UE4Editor crash after load project</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89430">Bug 89430</a> - [g965][bisected] arb_copy_image-targets gl_texture* tests fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89433">Bug 89433</a> - GCC 4.2 does not support -Wvla</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89455">Bug 89455</a> - [NVC0/Gallium] Unigine Heaven black and white boxes</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89457">Bug 89457</a> - [BSW Bisected]ogles3conform ES3-CTS.gtf.GL3Tests.shadow.shadow_execution_vert fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89477">Bug 89477</a> - include/no_extern_c.h:47:1: error: template with C linkage</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89508">Bug 89508</a> - Bad int(floatBitsToInt(vec4))</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89530">Bug 89530</a> - FTBFS in loader: missing fstat</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89569">Bug 89569</a> - Papo &amp; Yo crash on startup [HSW]</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89590">Bug 89590</a> - Crash in glLinkProgram with shaders with multiple constant arrays</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89662">Bug 89662</a> - context.c:943: undefined reference to `_glapi_new_nop_table'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89670">Bug 89670</a> - cmod_propagation_test.andnz_one regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89679">Bug 89679</a> - [NV50] Portal/Half-Life 2 will not start (native Steam)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89689">Bug 89689</a> - [Regression] Weston on DRM backend won't start with new version of mesa</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89722">Bug 89722</a> - [ILK Bisected]Ogles2conform/ES2-CTS.gtf.GL.equal.equal_vec2_frag fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89726">Bug 89726</a> - [Bisected] dEQP-GLES3: uniform linking logic in the presence of structs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89746">Bug 89746</a> - Mesa and LLVM 3.6+ break opengl for genymotion</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89754">Bug 89754</a> - vertexAttrib fails WebGL Conformance test with mesa drivers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89758">Bug 89758</a> - pow WebGL Conformance test with mesa drivers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89759">Bug 89759</a> - WebGL OGL ES GLSL conformance test with mesa drivers fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89831">Bug 89831</a> - [r600] r600_asm.c:310:assign_alu_units: Assertion `0' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89899">Bug 89899</a> - nir/nir_lower_tex_projector.c:112: error: unknown field ssa specified in initializer</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89957">Bug 89957</a> - vm protection faults in piglit lest: texsubimage cube_map_array pbo</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89960">Bug 89960</a> - [softpipe] piglit copy-pixels regreession</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89961">Bug 89961</a> - [BDW/BSW Bisected]Synmark2_v6 OglDrvRes/OglDrvShComp/OglDrvState/OglPSPom Image Validation fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89963">Bug 89963</a> - lp_bld_debug.cpp:100:31: error: no matching function for call to llvm::raw_ostream::raw_ostream()</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90000">Bug 90000</a> - [i965 Bisected NIR] Piglit/gglean_fragprog1-z-write_test fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90109">Bug 90109</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.shaders.uniform_block.random.basic_arrays.3 fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90114">Bug 90114</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.shaders.struct.uniform.sampler_array_fragment fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90130">Bug 90130</a> - gl_PrimitiveId seems to reset at 340</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90147">Bug 90147</a> - swrast: build error undeclared _SC_PHYS_PAGES on osx</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90149">Bug 90149</a> - [SNB+ Bisected]ES3-CTS.gtf.GL3Tests.uniform_buffer_object.uniform_buffer_object_getactiveuniformsiv_for_nonexistent_uniform_indices fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90153">Bug 90153</a> - [SKL Bisected]ES3-CTS.gtf.GL3Tests.uniform_buffer_object.uniform_buffer_object_all_valid_basic_types fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90167">Bug 90167</a> - [softpipe] piglit depthstencil-default_fb-drawpixels-32f_24_8_rev regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90207">Bug 90207</a> - [r600g, bisected] regression: NI/Turks crash on WebGL Water (most WebGL stuff)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90213">Bug 90213</a> - glDrawPixels with GL_COLOR_INDEX never returns.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90243">Bug 90243</a> - [bisected] regression: spec.!opengl 3_2.get-active-attrib-returns-all-inputs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90258">Bug 90258</a> - [IVB] spec.glsl-1_10.execution.fs-dfdy-accuracy fails intermittently</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90310">Bug 90310</a> - Fails to build gallium_dri.so at linking stage with clang because of multiple redefinitions</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90350">Bug 90350</a> - [G96] Portal's portal are incorrectly rendered</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90363">Bug 90363</a> - [nv50] HW state is not reset correctly when using a new GL context</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90397">Bug 90397</a> - ARB_program_interface_query: glGetProgramResourceiv() returns wrong value for GL_REFERENCED_BY_*_SHADER prop for GL_UNIFORM for members of an interface block with an instance name</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90466">Bug 90466</a> - arm: linker error ndefined reference to `nir_metadata_preserve'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90520">Bug 90520</a> - Register spilling clobbers registers used elsewhere in the shader</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90547">Bug 90547</a> - [BDW/BSW/SKL Bisected]Piglit/glean&#64;vertprog1-rsq_test_2_(reciprocal_square_root_of_negative_value) fais</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90580">Bug 90580</a> - [HSW bisected] integer multiplication bug</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90629">Bug 90629</a> - [i965] SIMD16 dual_source_blend assertion `src[i].file != GRF || src[i].width == dst.width' failed</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90749">Bug 90749</a> - [BDW Bisected]dEQP-GLES3.functional.rasterization.fbo.rbo_multisample_max.primitives.lines_wide fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90830">Bug 90830</a> - [bsw bisected regression] GPU hang for spec.arb_gpu_shader5.execution.sampler_array_indexing.vs-nonzero-base</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90839">Bug 90839</a> - [10.5.5/10.6 regression, bisected] PBO glDrawPixels no longer using blit fastpath</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90905">Bug 90905</a> - mesa: Finish subdir-objects transition</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=9951">Bug 9951</a> - GL_LINE_SMOOTH and GL_POLYGON_SMOOTH with i965 driver</li>
</ul>
<h2>Changes</h2>
<ul>
<li>Removed classic Windows software rasterizer.</li>
<li>Removed egl_gallium EGL driver.</li>
<li>Removed gbm_gallium GBM driver.</li>
<li>Removed OpenVG support.</li>
<li>Removed the galahad gallium driver.</li>
<li>Removed the identity gallium driver.</li>
<li>Removed the EGL loader from the Windows SCons build.</li>
<li>Removed the classic osmesa from the Windows SCons build.</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,104 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.1 Release Notes / June 29, 2015</h1>
<p>
Mesa 10.6.1 is a bug fix release which fixes bugs found since the 10.6.0 release.
</p>
<p>
Mesa 10.6.1 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
b4cccd4d0eabcc2bca00c3175d3ad88fdda57ffdb883a7998525b873a21fe607 mesa-10.6.1.tar.gz
6c80a2b647e57c85dc36e609d9aed17f878f0d8e0cf9ace86d14cf604101e1eb mesa-10.6.1.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90347">Bug 90347</a> - [NVE0+] Failure to insert texbar under some circumstances (causing bad colors in Terasology)</li>
</ul>
<h2>Changes</h2>
<p>Anuj Phogat (4):</p>
<ul>
<li>mesa: Handle integer formats in need_rgb_to_luminance_conversion()</li>
<li>mesa: Use helper function need_rgb_to_luminance_conversion()</li>
<li>mesa: Turn need_rgb_to_luminance_conversion() in to a global function</li>
<li>meta: Abort meta path if ReadPixels need rgb to luminance conversion</li>
</ul>
<p>Ben Widawsky (1):</p>
<ul>
<li>i965/gen9: Implement Push Constant Buffer workaround</li>
</ul>
<p>Boyan Ding (2):</p>
<ul>
<li>egl/x11: Set version of swrastLoader to 2</li>
<li>egl/x11: Remove duplicate call to dri2_x11_add_configs_for_visuals</li>
</ul>
<p>Emil Velikov (6):</p>
<ul>
<li>docs: Add sha256sums for the 10.6.0 release</li>
<li>configure: warn about shared_glapi &amp; xlib-glx only when both are set</li>
<li>configure: error out when building backend-less libEGL</li>
<li>configure: error out when building libEGL without shared-glapi</li>
<li>gbm: do not (over)link against libglapi.so</li>
<li>Update version to 10.6.1</li>
</ul>
<p>Frank Henigman (1):</p>
<ul>
<li>gbm: dlopen libglapi so gbm_create_device works</li>
</ul>
<p>Ilia Mirkin (9):</p>
<ul>
<li>nvc0/ir: fix collection of first uses for texture barrier insertion</li>
<li>nv50,nvc0: clamp uniform size to 64k</li>
<li>nvc0/ir: can't have a join on a load with an indirect source</li>
<li>glsl: handle conversions to double when comparing param matches</li>
<li>glsl: add version checks to conditionals for builtin variable enablement</li>
<li>mesa: add GL_PROGRAM_PIPELINE support in KHR_debug calls</li>
<li>glsl: binding point is a texture unit, which is a combined space</li>
<li>nvc0: always put all tfb bufs into bufctx</li>
<li>nv50,nvc0: make sure to pushbuf_refn before putting bo into pushbuf_data</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,165 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.2 Release Notes / July 11, 2015</h1>
<p>
Mesa 10.6.2 is a bug fix release which fixes bugs found since the 10.6.1 release.
</p>
<p>
Mesa 10.6.2 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
9c7ab9300dda6c912faaaff97995ec1820ba21d114d9cf555f145cbad90995f4 mesa-10.6.2.tar.gz
05753d3db4212900927b9894221a1669a10f56786e86a7e818b6e18a0817dca9 mesa-10.6.2.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=73528">Bug 73528</a> - Deferred lighting in Second Life causes system hiccups and screen flickering</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80500">Bug 80500</a> - Flickering shadows in unreleased title trace</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82186">Bug 82186</a> - [r600g] BARTS GPU lockup with minecraft shaders</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84225">Bug 84225</a> - Allow constant-index-expression sampler array indexing with GLSL-ES &lt; 300</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90537">Bug 90537</a> - radeonsi bo/va conflict on RADEON_GEM_VA (rscreen-&gt;ws-&gt;buffer_from_handle returns NULL)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90873">Bug 90873</a> - Kernel hang, TearFree On, Mate desktop environment</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91022">Bug 91022</a> - [g45 g965 bisected] assertions generated from textureGrad cube samplers fix</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91047">Bug 91047</a> - [SNB Bisected] Messed up Fog in Super Smash Bros. Melee in Dolphin</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91056">Bug 91056</a> - The Bard's Tale (2005, native) has rendering issues</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91117">Bug 91117</a> - Nimbus (running in wine) has rendering issues, objects are semi-transparent</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91124">Bug 91124</a> - Civilization V (in Wine) has rendering issues: text missing, menu bar corrupted</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91173">Bug 91173</a> - Oddworld: Stranger's Wrath HD: disfigured models in wrong colors</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91226">Bug 91226</a> - Crash in glLinkProgram (NEW)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91231">Bug 91231</a> - [NV92] Psychonauts (native) segfaults on start when DRI3 enabled</li>
</ul>
<h2>Changes</h2>
<p>Chris Wilson (1):</p>
<ul>
<li>loader: Look for any version of currently linked libudev.so</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: Add sha256 checksums for the 10.6.1 release</li>
<li>Update version to 10.6.2</li>
</ul>
<p>Ilia Mirkin (8):</p>
<ul>
<li>nv50/ir: propagate modifier to right arg when const-folding mad</li>
<li>nv50/ir: fix emission of address reg in 3rd source</li>
<li>nv50/ir: copy joinAt when splitting both before and after</li>
<li>mesa: reset the source packing when creating temp transfer image</li>
<li>nv50/ir: don't emit src2 in immediate form</li>
<li>mesa/prog: relative offsets into constbufs are not constant</li>
<li>nv50/ir: UCMP arguments are float, so make sure modifiers are applied</li>
<li>nvc0: turn sample counts off during blit</li>
</ul>
<p>Kenneth Graunke (5):</p>
<ul>
<li>i965/fs: Fix ir_txs in emit_texture_gen4_simd16().</li>
<li>i965: Reserve more batch space to accomodate Gen6 perfmonitors.</li>
<li>i965/vs: Fix matNxM vertex attributes where M != 4.</li>
<li>Revert "glsl: clone inputs and outputs during linking"</li>
<li>Revert "i965: Delete linked GLSL IR when using NIR."</li>
</ul>
<p>Marek Olšák (3):</p>
<ul>
<li>r600g: disable single-sample fast color clear due to hangs</li>
<li>radeonsi: fix a hang with DrawTransformFeedback on 4 SE chips</li>
<li>st/dri: don't set PIPE_BIND_SCANOUT for MSAA surfaces</li>
</ul>
<p>Mario Kleiner (2):</p>
<ul>
<li>nouveau: Use dup fd as key in drm-winsys hash table to fix ZaphodHeads.</li>
<li>winsys/radeon: Use dup fd as key in drm-winsys hash table to fix ZaphodHeads.</li>
</ul>
<p>Matt Turner (2):</p>
<ul>
<li>i965/fs: Don't mess up stride for uniform integer multiplication.</li>
<li>Revert SHA1 additions.</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>winsys/radeon: Unmap GPU VM address range when destroying BO</li>
</ul>
<p>Mike Stroyan (2):</p>
<ul>
<li>meta: Only change and restore viewport 0 in mesa meta mode</li>
<li>i965: allocate at least 1 BLEND_STATE element</li>
</ul>
<p>Neil Roberts (4):</p>
<ul>
<li>i965/skl: Set the pulls bary bit in 3DSTATE_PS_EXTRA</li>
<li>glsl: Add missing check for whether an expression is an add operation</li>
<li>glsl: Make sure not to dereference NULL</li>
<li>i965: Don't try to print the GLSL IR if it has been freed</li>
</ul>
<p>Tapani Pälli (8):</p>
<ul>
<li>glsl: clone inputs and outputs during linking</li>
<li>i965: Delete linked GLSL IR when using NIR.</li>
<li>glsl: Allow dynamic sampler array indexing with GLSL ES &lt; 3.00</li>
<li>mesa/glsl: new compiler option EmitNoIndirectSampler</li>
<li>i965: use EmitNoIndirectSampler for gen &lt; 7</li>
<li>i915: use EmitNoIndirectSampler</li>
<li>mesa/st: use EmitNoIndirectSampler if !ARB_gpu_shader5</li>
<li>glsl: validate sampler array indexing for 'constant-index-expression'</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,106 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.3 Release Notes / July 26, 2015</h1>
<p>
Mesa 10.6.3 is a bug fix release which fixes bugs found since the 10.6.2 release.
</p>
<p>
Mesa 10.6.3 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
c27e1e33798e69a6d2d2425aee8ac7b4c0b243066a65dd76cbb182ea31b1c7f2 mesa-10.6.3.tar.gz
58592e07c350cd2e8969b73fa83048c657a39fe2f13f3b88f5e5818fe2e4676d mesa-10.6.3.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90728">Bug 90728</a> - dvd playback with vlc and vdpau causes segmentation fault</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91337">Bug 91337</a> - OSMesaGetProcAdress(&quot;OSMesaPixelStore&quot;) returns nil</li>
</ul>
<h2>Changes</h2>
<p>Brian Paul (1):</p>
<ul>
<li>osmesa: fix OSMesaPixelsStore typo</li>
</ul>
<p>Chad Versace (1):</p>
<ul>
<li>mesa: Fix generation of git_sha1.h.tmp for gitlinks</li>
</ul>
<p>Christian König (2):</p>
<ul>
<li>vl: cleanup video buffer private when the decoder is destroyed</li>
<li>st/vdpau: fix mixer size checks</li>
</ul>
<p>Emil Velikov (3):</p>
<ul>
<li>docs: Add sha256 checksums for the 10.6.2 release</li>
<li>auxiliary/vl: use the correct screen index</li>
<li>Update version to 10.6.3</li>
</ul>
<p>Francisco Jerez (1):</p>
<ul>
<li>i965/gen9: Use custom MOCS entries set up by the kernel.</li>
</ul>
<p>Ilia Mirkin (5):</p>
<ul>
<li>nv50, nvc0: enable at least one color RT if alphatest is enabled</li>
<li>nvc0/ir: fix txq on indirect samplers</li>
<li>nvc0/ir: don't worry about sampler in txq handling</li>
<li>gm107/ir: fix indirect txq emission</li>
<li>nv50: fix max level clamping on G80</li>
</ul>
<p>Kenneth Graunke (1):</p>
<ul>
<li>program: Allow redundant OPTION ARB_fog_* directives.</li>
</ul>
<p>Rob Clark (1):</p>
<ul>
<li>xa: don't leak fences</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,137 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.4 Release Notes / August 11, 2015</h1>
<p>
Mesa 10.6.4 is a bug fix release which fixes bugs found since the 10.6.3 release.
</p>
<p>
Mesa 10.6.4 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
4960bf17d8b5d6a6503c6954ec6cf480b5cd930797bac901c60bea192675f85e mesa-10.6.4.tar.gz
8f5ac103f0f503de2f7a985b0df349bd4ecdfe7f51c714be146fa5a9a3c07b77 mesa-10.6.4.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=73512">Bug 73512</a> - [clover] mesa.icd. should contain full path</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91290">Bug 91290</a> - SIGSEGV glcpp/glcpp-parse.y:1077</li>
</ul>
<h2>Changes</h2>
<p>Anuj Phogat (6):</p>
<ul>
<li>mesa: Turn get_readpixels_transfer_ops() in to a global function</li>
<li>meta: Fix transfer operations check in meta pbo path for readpixels</li>
<li>meta: Abort meta pbo path if readpixels need signed-unsigned conversion</li>
<li>meta: Don't do fragment color clamping in _mesa_meta_pbo_GetTexSubImage</li>
<li>mesa: Add a helper function _mesa_need_luminance_to_rgb_conversion()</li>
<li>meta: Fix reading luminance texture as rgba in _mesa_meta_pbo_GetTexSubImage()</li>
</ul>
<p>Ben Widawsky (1):</p>
<ul>
<li>i965/skl: Add production thread counts and URB size</li>
</ul>
<p>Eduardo Lima Mitev (3):</p>
<ul>
<li>mesa: Fix errors values returned by glShaderBinary()</li>
<li>mesa: Validate target before resolving tex obj in glTex(ture)SubImageXD</li>
<li>mesa: Fix error returned by glCopyTexImage2D() upon an invalid internal format</li>
</ul>
<p>Emil Velikov (6):</p>
<ul>
<li>docs: Add checksums for mesa 10.6.3 tarballs</li>
<li>configure.ac: do not set HAVE_DRI(23) when libdrm is missing</li>
<li>egl/wayland: libdrm is a hard requirement, treat it as such</li>
<li>winsys/radeon: don't leak the fd when it is 0</li>
<li>bugzilla_mesa.sh: sort the bugs list by number</li>
<li>Update version to 10.6.4</li>
</ul>
<p>Francisco Jerez (1):</p>
<ul>
<li>i965/fs: Fix fs_inst::regs_read() for sources in the ATTR file.</li>
</ul>
<p>Frank Binns (2):</p>
<ul>
<li>egl/dri: Add error info needed for EGL_EXT_image_dma_buf_import extension</li>
<li>egl: Add eglQuerySurface surface type check for EGL_LARGEST_PBUFFER attrib</li>
</ul>
<p>Igor Gnatenko (1):</p>
<ul>
<li>opencl: use versioned .so in mesa.icd</li>
</ul>
<p>Ilia Mirkin (1):</p>
<ul>
<li>nvc0: fix geometry program revalidation of clipping params</li>
</ul>
<p>Kenneth Graunke (1):</p>
<ul>
<li>glsl: Fix a bug where LHS swizzles of swizzles were too small.</li>
</ul>
<p>Marek Olšák (6):</p>
<ul>
<li>st/mesa: don't call st_validate_state in BlitFramebuffer</li>
<li>radeonsi: upload shader rodata after updating scratch relocations</li>
<li>st/mesa: don't ignore texture buffer state changes</li>
<li>radeonsi: rework how shader pointers to descriptors are set</li>
<li>radeonsi: completely rework updating descriptors without CP DMA</li>
<li>r600g: fix the CB_SHADER_MASK setup</li>
</ul>
<p>Samuel Iglesias Gonsalvez (1):</p>
<ul>
<li>glsl/glcpp: fix SIGSEGV when checking error condition for macro redefinition</li>
</ul>
<p>Samuel Pitoiset (1):</p>
<ul>
<li>nv50: avoid segfault with enabled but unbound vertex attrib</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,123 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.5 Release Notes / August 22, 2015</h1>
<p>
Mesa 10.6.5 is a bug fix release which fixes bugs found since the 10.6.4 release.
</p>
<p>
Mesa 10.6.5 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
TBD
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85252">Bug 85252</a> - Segfault in compiler while processing ternary operator with void arguments</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91570">Bug 91570</a> - Upgrading mesa to 10.6 causes segfault in OpenGL applications with GeForce4 MX 440 / AGP 8X</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91610">Bug 91610</a> - [BSW] GPU hang for spec.shaders.point-vertex-id gl_instanceid divisor</li>
</ul>
<h2>Changes</h2>
<p>Adam Jackson (1):</p>
<ul>
<li>glx: Fix __glXWireToEvent for BufferSwapComplete</li>
</ul>
<p>Alex Deucher (2):</p>
<ul>
<li>radeonsi: add new OLAND pci id</li>
<li>radeonsi: properly set the raster_config for KV</li>
</ul>
<p>Emil Velikov (4):</p>
<ul>
<li>docs: add sha256 checksums for 10.6.4</li>
<li>vc4: add missing nir include, to fix the build</li>
<li>Revert "radeonsi: properly set the raster_config for KV"</li>
<li>Update version to 10.6.5</li>
</ul>
<p>Frank Binns (1):</p>
<ul>
<li>egl/x11: don't abort when creating a DRI2 drawable fails</li>
</ul>
<p>Ilia Mirkin (3):</p>
<ul>
<li>nouveau: no need to do tnl wakeup, state updates are always hooked up</li>
<li>gm107/ir: indirect handle goes first on maxwell also</li>
<li>nv50,nvc0: take level into account when doing eng2d multi-layer blits</li>
</ul>
<p>Jason Ekstrand (4):</p>
<ul>
<li>meta/copy_image: Stash off the scissor</li>
<li>mesa/formats: Only do byteswapping for packed formats</li>
<li>mesa/formats: Fix swizzle flipping for big-endian targets</li>
<li>mesa/formats: Don't flip channels of null array formats</li>
</ul>
<p>Marek Olšák (3):</p>
<ul>
<li>radeonsi: fix polygon offset scale</li>
<li>r600g: fix polygon offset scale</li>
<li>r600g: allow setting geometry shader sampler states</li>
</ul>
<p>Neil Roberts (1):</p>
<ul>
<li>i965/bdw: Fix setting the instancing state for the SGVS element</li>
</ul>
<p>Oded Gabbay (2):</p>
<ul>
<li>mesa: clear existing swizzle info before bitwise-OR</li>
<li>mesa/formats: don't byteswap when building array formats</li>
</ul>
<p>Renaud Gaubert (1):</p>
<ul>
<li>glsl: avoid compiler's segfault when processing operators with void arguments</li>
</ul>
</div>
</body>
</html>

View File

@@ -1693,7 +1693,7 @@ bc644be551ed585fc4f66c16b64a91c9 MesaGLUT-7.10.tar.gz
<li>llvmpipe: Special case complementary and identify blend factors in SoA.</li>
<li>llvmpipe: Make rgb/alpha bland func/factors match, when there is no alpha.</li>
<li>draw: Prevent clipped vertices overflow.</li>
<li>draw: Fulfil the new min_lod/max_lod/lod_bias/border_color dynamic state</li>
<li>draw: Fullfil the new min_lod/max_lod/lod_bias/border_color dynamic state</li>
<li>gallivm: Fetch the lod from the dynamic state when min_lod == max_lod.</li>
<li>gallivm: Remove dead experimental code.</li>
<li>llvmpipe: Decouple sampler view and sampler state updates.</li>

View File

@@ -48,7 +48,7 @@ c49c19c2bbef4f3b7f1389974dff25f4 MesaGLUT-7.6.zip
<h2>New features</h2>
<ul>
<li>OpenVG front-end (state tracker for Gallium).
<li><a href="../openvg.html">OpenVG</a> front-end (state tracker for Gallium).
This was written by Zack Rusin at Tungsten Graphics.
<li>GL_ARB_vertex_array_object and GL_APPLE_vertex_array_object extensions
(supported in Gallium drivers, Intel DRI drivers, and software drivers)</li>

View File

@@ -133,8 +133,10 @@ each directory.
<ul>
<li><b>clover</b> - OpenCL state tracker
<li><b>dri</b> - Meta state tracker for DRI drivers
<li><b>egl</b> - Meta state tracker for EGL drivers
<li><b>glx</b> - Meta state tracker for GLX
<li><b>vdpau</b> - VDPAU state tracker
<li><b>vega</b> - OpenVG 1.x state tracker
<li><b>wgl</b> -
<li><b>xorg</b> - Meta state tracker for Xorg video drivers
<li><b>xvmc</b> - XvMC state tracker

View File

@@ -1,147 +0,0 @@
Name
MESA_image_dma_buf_export
Name Strings
EGL_MESA_image_dma_buf_export
Contributors
Dave Airlie
Contact
Dave Airlie (airlied 'at' redhat 'dot' com)
Status
Complete, shipping.
Version
Version 3, May 5, 2015
Number
EGL Extension #87
Dependencies
Requires EGL 1.4 or later. This extension is written against the
wording of the EGL 1.4 specification.
EGL_KHR_base_image is required.
The EGL implementation must be running on a Linux kernel supporting the
dma_buf buffer sharing mechanism.
Overview
This extension provides entry points for integrating EGLImage with the
dma-buf infrastructure. The extension allows creating a Linux dma_buf
file descriptor or multiple file descriptors, in the case of multi-plane
YUV image, from an EGLImage.
It is designed to provide the complementary functionality to
EGL_EXT_image_dma_buf_import.
IP Status
Open-source; freely implementable.
New Types
This extension uses the 64-bit unsigned integer type EGLuint64KHR
first introduced by the EGL_KHR_stream extension, but does not
depend on that extension. The typedef may be reproduced separately
for this extension, if not already present in eglext.h.
typedef khronos_uint64_t EGLuint64KHR;
New Procedures and Functions
EGLBoolean eglExportDMABUFImageQueryMESA(EGLDisplay dpy,
EGLImageKHR image,
int *fourcc,
int *num_planes,
EGLuint64KHR *modifiers);
EGLBoolean eglExportDMABUFImageMESA(EGLDisplay dpy,
EGLImageKHR image,
int *fds,
EGLint *strides,
EGLint *offsets);
New Tokens
None
Additions to the EGL 1.4 Specification:
To mirror the import extension, this extension attempts to return
enough information to enable an exported dma-buf to be imported
via eglCreateImageKHR and EGL_LINUX_DMA_BUF_EXT token.
Retrieving the information is a two step process, so two APIs
are required.
The first entrypoint
EGLBoolean eglExportDMABUFImageQueryMESA(EGLDisplay dpy,
EGLImageKHR image,
int *fourcc,
int *num_planes,
EGLuint64KHR *modifiers);
is used to retrieve the pixel format of the buffer, as specified by
drm_fourcc.h, the number of planes in the image and the Linux
drm modifiers. <fourcc>, <num_planes> and <modifiers> may be NULL,
in which case no value is retrieved.
The second entrypoint retrieves the dma_buf file descriptors,
strides and offsets for the image. The caller should pass
arrays sized according to the num_planes values retrieved previously.
Passing arrays of the wrong size will have undefined results.
If the number of fds is less than the number of planes, then
subsequent fd slots should contain -1.
EGLBoolean eglExportDMABUFImageMESA(EGLDisplay dpy,
EGLImageKHR image,
int *fds,
EGLint *strides,
EGLint *offsets);
<fds>, <strides>, <offsets> can be NULL if the infomatation isn't
required by the caller.
Issues
1. Should the API look more like an attribute getting API?
ANSWER: No, from a user interface pov, having to iterate across calling
the API up to 12 times using attribs seems like the wrong solution.
2. Should the API take a plane and just get the fd/stride/offset for that
plane?
ANSWER: UNKNOWN,this might be just as valid an API.
3. Does ownership of the file descriptor remain with the app?
ANSWER: Yes, the app is responsible for closing any fds retrieved.
4. If number of planes and number of fds differ what should we do?
ANSWER: Return -1 for the secondary slots, as this avoids having
to dup the fd extra times to make the interface sane.
Revision History
Version 3, May, 2015
Just use the KHR 64-bit type.
Version 2, March, 2015
Add a query interface (Dave Airlie)
Version 1, June 3, 2014
Initial draft (Dave Airlie)

View File

@@ -150,7 +150,7 @@ New features:
Changes:
<ul>
<li>renamed aux.h as glaux.h (MS-DOS names can't start with aux)
<li>most filenames are in 8.3 format to accommodate MS-DOS
<li>most filenames are in 8.3 format to accomodate MS-DOS
<li>use GLubytes to store arrays of colors instead of GLints
</ul>
@@ -1224,7 +1224,7 @@ Bug fixes:
</ul>
Changes:
<ul>
<li>max texture units reduced to six to accommodate texture rectangles
<li>max texture units reduced to six to accomodate texture rectangles
<li>removed unfinished GL_MESA_sprite_point extension code
</ul>

View File

@@ -19,7 +19,6 @@
<p>
This page lists known issues with
<a href="http://www.spec.org/gwpg/gpc.static/vp11info.html" target="_main">SPEC Viewperf 11</a>
and <a href="https://www.spec.org/gwpg/gpc.static/vp12info.html" target="_main">SPEC Viewperf 12</a>
when running on Mesa-based drivers.
</p>
@@ -41,15 +40,13 @@ These issues have been reported to the SPEC organization in the hope that
they'll be fixed in the future.
</p>
<h2><u>Viewperf 11</u></h2>
<p>
Some of the Viewperf 11 tests use a lot of memory.
Some of the Viewperf tests use a lot of memory.
At least 2GB of RAM is recommended.
</p>
<h3>Catia-03 test 2</h3>
<h2>Catia-03 test 2</h2>
<p>
This test creates over 38000 vertex buffer objects. On some systems
@@ -62,7 +59,7 @@ either in Viewperf or the Mesa driver.
<h3>Catia-03 tests 3, 4, 8</h3>
<h2>Catia-03 tests 3, 4, 8</h2>
<p>
These tests use features of the
@@ -82,7 +79,7 @@ Subsequent drawing calls become no-ops and the rendering is incorrect.
<h3>sw-02 tests 1, 2, 4, 6</h3>
<h2>sw-02 tests 1, 2, 4, 6</h2>
<p>
These tests depend on the
@@ -102,7 +99,7 @@ color. This is probably due to some uninitialized state somewhere.
<h3>sw-02 test 6</h3>
<h2>sw-02 test 6</h2>
<p>
The lines drawn in this test appear in a random color.
@@ -114,7 +111,7 @@ situation, we get a random color.
<h3>Lightwave-01 test 3</h3>
<h2>Lightwave-01 test 3</h2>
<p>
This test uses a number of mipmapped textures, but the textures are
@@ -175,7 +172,7 @@ However, we have no plans to implement this work-around in Mesa.
</p>
<h3>Maya-03 test 2</h3>
<h2>Maya-03 test 2</h2>
<p>
This test makes some unusual calls to glRotate. For example:
@@ -207,7 +204,7 @@ and with a semi-random color (between white and black) since GL_FOG is enabled.
</p>
<h3>Proe-05 test 1</h3>
<h2>Proe-05 test 1</h2>
<p>
This uses depth testing but there's two problems:
@@ -235,7 +232,7 @@ glClear is called so clearing the depth buffer would be a no-op anyway.
</p>
<h3>Proe-05 test 6</h3>
<h2>Proe-05 test 6</h2>
<p>
This test draws an engine model with a two-pass algorithm.
@@ -264,86 +261,6 @@ blending with appropriate patterns/modes to ensure the same fragments
are produced in both passes.
</p>
<h2><u>Viewperf 12</u></h2>
<p>
Note that Viewperf 12 only runs on 64-bit Windows 7 or later.
</p>
<h3>catia-04</h3>
<p>
One of the catia tests calls wglGetProcAddress() to get some
GL_EXT_direct_state_access functions (such as glBindMultiTextureEXT) and some
GL_NV_half_float functions (such as glMultiTexCoord3hNV).
If the extension/function is not supported, wglGetProcAddress() can return NULL.
Unfortunately, Viewperf doesn't check for null pointers and crashes when it
later tries to use the pointer.
</p>
<p>
Another catia test uses OpenGL 3.1's primitive restart feature.
But when Viewperf creates an OpenGL context, it doesn't request version 3.1
If the driver returns version 3.0 or earlier all the calls related to primitive
restart generate an OpenGL error.
Some of the rendering is then incorrect.
</p>
<h3>energy-01</h3>
<p>
This test creates a 3D luminance texture of size 1K x 1K x 1K.
If the OpenGL driver/device doesn't support a texture of this size
the glTexImage3D() call will fail with GL_INVALID_VALUE or GL_OUT_OF_MEMORY
and all that's rendered is plain white polygons.
Ideally, the test would use a proxy texture to determine the max 3D
texture size. But it does not do that.
</p>
<h3>maya-04</h3>
<p>
This test generates many GL_INVALID_OPERATION errors in its calls to
glUniform().
Causes include:
<ul>
<li> Trying to set float uniforms with glUniformi()
<li> Trying to set float uniforms with glUniform3f()
<li> Trying to set matrix uniforms with glUniform() instead of glUniformMatrix().
</ul>
<p>
Apparently, the indexes returned by glGetUniformLocation() were hard-coded
into the application trace when it was created.
Since different implementations of glGetUniformLocation() may return different
values for any given uniform name, subsequent calls to glUniform() will be
invalid since they refer to the wrong uniform variables.
This causes many OpenGL errors and leads to incorrect rendering.
</p>
<h3>medical-01</h3>
<p>
This test uses a single GLSL fragment shader which contains a GLSL 1.20
array initializer statement, but it neglects to specify
<code>#version 120</code> at the top of the shader code.
So, the shader does not compile and all that's rendered is plain white polygons.
</p>
<p>
Also, the test tries to create a very large 3D texture that may exceed
the device driver's limit.
When this happens, the glTexImage3D call fails and all that's rendered is
a white box.
</p>
<h3>showcase-01</h3>
<p>
This is actually a DX11 test based on Autodesk's Showcase product.
As such, it won't run with Mesa.
</p>
</div>
</body>

File diff suppressed because it is too large Load Diff

View File

@@ -1,387 +0,0 @@
/*
* Copyright 2011 Joakim Sindholt <opensource@zhasha.com>
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and associated documentation files (the "Software"),
* to deal in the Software without restriction, including without limitation
* on the rights to use, copy, modify, merge, publish, distribute, sub
* license, and/or sell copies of the Software, and to permit persons to whom
* the Software is furnished to do so, subject to the following conditions:
*
* The above copyright notice and this permission notice (including the next
* paragraph) shall be included in all copies or substantial portions of the
* Software.
*
* THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
* IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
* FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. IN NO EVENT SHALL
* THE AUTHOR(S) AND/OR THEIR SUPPLIERS BE LIABLE FOR ANY CLAIM,
* DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
* OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE
* USE OR OTHER DEALINGS IN THE SOFTWARE. */
#ifndef _D3D9CAPS_H_
#define _D3D9CAPS_H_
#include "d3d9types.h"
/* Caps flags */
#define D3DCAPS2_FULLSCREENGAMMA 0x00020000
#define D3DCAPS2_CANCALIBRATEGAMMA 0x00100000
#define D3DCAPS2_RESERVED 0x02000000
#define D3DCAPS2_CANMANAGERESOURCE 0x10000000
#define D3DCAPS2_DYNAMICTEXTURES 0x20000000
#define D3DCAPS2_CANAUTOGENMIPMAP 0x40000000
#define D3DCAPS2_CANSHARERESOURCE 0x80000000
#define D3DCAPS3_ALPHA_FULLSCREEN_FLIP_OR_DISCARD 0x00000020
#define D3DCAPS3_LINEAR_TO_SRGB_PRESENTATION 0x00000080
#define D3DCAPS3_COPY_TO_VIDMEM 0x00000100
#define D3DCAPS3_COPY_TO_SYSTEMMEM 0x00000200
#define D3DCAPS3_DXVAHD 0x00000400
#define D3DCAPS3_RESERVED 0x8000001F
#define D3DPRESENT_INTERVAL_DEFAULT 0x00000000
#define D3DPRESENT_INTERVAL_ONE 0x00000001
#define D3DPRESENT_INTERVAL_TWO 0x00000002
#define D3DPRESENT_INTERVAL_THREE 0x00000004
#define D3DPRESENT_INTERVAL_FOUR 0x00000008
#define D3DPRESENT_INTERVAL_IMMEDIATE 0x80000000
#define D3DCURSORCAPS_COLOR 0x00000001
#define D3DCURSORCAPS_LOWRES 0x00000002
#define D3DDEVCAPS_EXECUTESYSTEMMEMORY 0x00000010
#define D3DDEVCAPS_EXECUTEVIDEOMEMORY 0x00000020
#define D3DDEVCAPS_TLVERTEXSYSTEMMEMORY 0x00000040
#define D3DDEVCAPS_TLVERTEXVIDEOMEMORY 0x00000080
#define D3DDEVCAPS_TEXTURESYSTEMMEMORY 0x00000100
#define D3DDEVCAPS_TEXTUREVIDEOMEMORY 0x00000200
#define D3DDEVCAPS_DRAWPRIMTLVERTEX 0x00000400
#define D3DDEVCAPS_CANRENDERAFTERFLIP 0x00000800
#define D3DDEVCAPS_TEXTURENONLOCALVIDMEM 0x00001000
#define D3DDEVCAPS_DRAWPRIMITIVES2 0x00002000
#define D3DDEVCAPS_SEPARATETEXTUREMEMORIES 0x00004000
#define D3DDEVCAPS_DRAWPRIMITIVES2EX 0x00008000
#define D3DDEVCAPS_HWTRANSFORMANDLIGHT 0x00010000
#define D3DDEVCAPS_CANBLTSYSTONONLOCAL 0x00020000
#define D3DDEVCAPS_HWRASTERIZATION 0x00080000
#define D3DDEVCAPS_PUREDEVICE 0x00100000
#define D3DDEVCAPS_QUINTICRTPATCHES 0x00200000
#define D3DDEVCAPS_RTPATCHES 0x00400000
#define D3DDEVCAPS_RTPATCHHANDLEZERO 0x00800000
#define D3DDEVCAPS_NPATCHES 0x01000000
#define D3DPMISCCAPS_MASKZ 0x00000002
#define D3DPMISCCAPS_CULLNONE 0x00000010
#define D3DPMISCCAPS_CULLCW 0x00000020
#define D3DPMISCCAPS_CULLCCW 0x00000040
#define D3DPMISCCAPS_COLORWRITEENABLE 0x00000080
#define D3DPMISCCAPS_CLIPPLANESCALEDPOINTS 0x00000100
#define D3DPMISCCAPS_CLIPTLVERTS 0x00000200
#define D3DPMISCCAPS_TSSARGTEMP 0x00000400
#define D3DPMISCCAPS_BLENDOP 0x00000800
#define D3DPMISCCAPS_NULLREFERENCE 0x00001000
#define D3DPMISCCAPS_INDEPENDENTWRITEMASKS 0x00004000
#define D3DPMISCCAPS_PERSTAGECONSTANT 0x00008000
#define D3DPMISCCAPS_FOGANDSPECULARALPHA 0x00010000
#define D3DPMISCCAPS_SEPARATEALPHABLEND 0x00020000
#define D3DPMISCCAPS_MRTINDEPENDENTBITDEPTHS 0x00040000
#define D3DPMISCCAPS_MRTPOSTPIXELSHADERBLENDING 0x00080000
#define D3DPMISCCAPS_FOGVERTEXCLAMPED 0x00100000
#define D3DPMISCCAPS_POSTBLENDSRGBCONVERT 0x00200000
#define D3DPRASTERCAPS_DITHER 0x00000001
#define D3DPRASTERCAPS_ZTEST 0x00000010
#define D3DPRASTERCAPS_FOGVERTEX 0x00000080
#define D3DPRASTERCAPS_FOGTABLE 0x00000100
#define D3DPRASTERCAPS_MIPMAPLODBIAS 0x00002000
#define D3DPRASTERCAPS_ZBUFFERLESSHSR 0x00008000
#define D3DPRASTERCAPS_FOGRANGE 0x00010000
#define D3DPRASTERCAPS_ANISOTROPY 0x00020000
#define D3DPRASTERCAPS_WBUFFER 0x00040000
#define D3DPRASTERCAPS_WFOG 0x00100000
#define D3DPRASTERCAPS_ZFOG 0x00200000
#define D3DPRASTERCAPS_COLORPERSPECTIVE 0x00400000
#define D3DPRASTERCAPS_SCISSORTEST 0x01000000
#define D3DPRASTERCAPS_SLOPESCALEDEPTHBIAS 0x02000000
#define D3DPRASTERCAPS_DEPTHBIAS 0x04000000
#define D3DPRASTERCAPS_MULTISAMPLE_TOGGLE 0x08000000
#define D3DPCMPCAPS_NEVER 0x00000001
#define D3DPCMPCAPS_LESS 0x00000002
#define D3DPCMPCAPS_EQUAL 0x00000004
#define D3DPCMPCAPS_LESSEQUAL 0x00000008
#define D3DPCMPCAPS_GREATER 0x00000010
#define D3DPCMPCAPS_NOTEQUAL 0x00000020
#define D3DPCMPCAPS_GREATEREQUAL 0x00000040
#define D3DPCMPCAPS_ALWAYS 0x00000080
#define D3DPBLENDCAPS_ZERO 0x00000001
#define D3DPBLENDCAPS_ONE 0x00000002
#define D3DPBLENDCAPS_SRCCOLOR 0x00000004
#define D3DPBLENDCAPS_INVSRCCOLOR 0x00000008
#define D3DPBLENDCAPS_SRCALPHA 0x00000010
#define D3DPBLENDCAPS_INVSRCALPHA 0x00000020
#define D3DPBLENDCAPS_DESTALPHA 0x00000040
#define D3DPBLENDCAPS_INVDESTALPHA 0x00000080
#define D3DPBLENDCAPS_DESTCOLOR 0x00000100
#define D3DPBLENDCAPS_INVDESTCOLOR 0x00000200
#define D3DPBLENDCAPS_SRCALPHASAT 0x00000400
#define D3DPBLENDCAPS_BOTHSRCALPHA 0x00000800
#define D3DPBLENDCAPS_BOTHINVSRCALPHA 0x00001000
#define D3DPBLENDCAPS_BLENDFACTOR 0x00002000
#ifndef D3D_DISABLE_9EX
# define D3DPBLENDCAPS_SRCCOLOR2 0x00004000
# define D3DPBLENDCAPS_INVSRCCOLOR2 0x00008000
#endif
#define D3DPSHADECAPS_COLORGOURAUDRGB 0x00000008
#define D3DPSHADECAPS_SPECULARGOURAUDRGB 0x00000200
#define D3DPSHADECAPS_ALPHAGOURAUDBLEND 0x00004000
#define D3DPSHADECAPS_FOGGOURAUD 0x00080000
#define D3DPTEXTURECAPS_PERSPECTIVE 0x00000001
#define D3DPTEXTURECAPS_POW2 0x00000002
#define D3DPTEXTURECAPS_ALPHA 0x00000004
#define D3DPTEXTURECAPS_SQUAREONLY 0x00000020
#define D3DPTEXTURECAPS_TEXREPEATNOTSCALEDBYSIZE 0x00000040
#define D3DPTEXTURECAPS_ALPHAPALETTE 0x00000080
#define D3DPTEXTURECAPS_NONPOW2CONDITIONAL 0x00000100
#define D3DPTEXTURECAPS_PROJECTED 0x00000400
#define D3DPTEXTURECAPS_CUBEMAP 0x00000800
#define D3DPTEXTURECAPS_VOLUMEMAP 0x00002000
#define D3DPTEXTURECAPS_MIPMAP 0x00004000
#define D3DPTEXTURECAPS_MIPVOLUMEMAP 0x00008000
#define D3DPTEXTURECAPS_MIPCUBEMAP 0x00010000
#define D3DPTEXTURECAPS_CUBEMAP_POW2 0x00020000
#define D3DPTEXTURECAPS_VOLUMEMAP_POW2 0x00040000
#define D3DPTEXTURECAPS_NOPROJECTEDBUMPENV 0x00200000
#define D3DPTFILTERCAPS_MINFPOINT 0x00000100
#define D3DPTFILTERCAPS_MINFLINEAR 0x00000200
#define D3DPTFILTERCAPS_MINFANISOTROPIC 0x00000400
#define D3DPTFILTERCAPS_MINFPYRAMIDALQUAD 0x00000800
#define D3DPTFILTERCAPS_MINFGAUSSIANQUAD 0x00001000
#define D3DPTFILTERCAPS_MIPFPOINT 0x00010000
#define D3DPTFILTERCAPS_MIPFLINEAR 0x00020000
#define D3DPTFILTERCAPS_MAGFPOINT 0x01000000
#define D3DPTFILTERCAPS_MAGFLINEAR 0x02000000
#define D3DPTFILTERCAPS_MAGFANISOTROPIC 0x04000000
#define D3DPTFILTERCAPS_MAGFPYRAMIDALQUAD 0x08000000
#define D3DPTFILTERCAPS_MAGFGAUSSIANQUAD 0x10000000
#define D3DPTADDRESSCAPS_WRAP 0x00000001
#define D3DPTADDRESSCAPS_MIRROR 0x00000002
#define D3DPTADDRESSCAPS_CLAMP 0x00000004
#define D3DPTADDRESSCAPS_BORDER 0x00000008
#define D3DPTADDRESSCAPS_INDEPENDENTUV 0x00000010
#define D3DPTADDRESSCAPS_MIRRORONCE 0x00000020
#define D3DLINECAPS_TEXTURE 0x00000001
#define D3DLINECAPS_ZTEST 0x00000002
#define D3DLINECAPS_BLEND 0x00000004
#define D3DLINECAPS_ALPHACMP 0x00000008
#define D3DLINECAPS_FOG 0x00000010
#define D3DLINECAPS_ANTIALIAS 0x00000020
#define D3DSTENCILCAPS_KEEP 0x00000001
#define D3DSTENCILCAPS_ZERO 0x00000002
#define D3DSTENCILCAPS_REPLACE 0x00000004
#define D3DSTENCILCAPS_INCRSAT 0x00000008
#define D3DSTENCILCAPS_DECRSAT 0x00000010
#define D3DSTENCILCAPS_INVERT 0x00000020
#define D3DSTENCILCAPS_INCR 0x00000040
#define D3DSTENCILCAPS_DECR 0x00000080
#define D3DSTENCILCAPS_TWOSIDED 0x00000100
#define D3DFVFCAPS_TEXCOORDCOUNTMASK 0x0000FFFF
#define D3DFVFCAPS_DONOTSTRIPELEMENTS 0x00080000
#define D3DFVFCAPS_PSIZE 0x00100000
#define D3DTEXOPCAPS_DISABLE 0x00000001
#define D3DTEXOPCAPS_SELECTARG1 0x00000002
#define D3DTEXOPCAPS_SELECTARG2 0x00000004
#define D3DTEXOPCAPS_MODULATE 0x00000008
#define D3DTEXOPCAPS_MODULATE2X 0x00000010
#define D3DTEXOPCAPS_MODULATE4X 0x00000020
#define D3DTEXOPCAPS_ADD 0x00000040
#define D3DTEXOPCAPS_ADDSIGNED 0x00000080
#define D3DTEXOPCAPS_ADDSIGNED2X 0x00000100
#define D3DTEXOPCAPS_SUBTRACT 0x00000200
#define D3DTEXOPCAPS_ADDSMOOTH 0x00000400
#define D3DTEXOPCAPS_BLENDDIFFUSEALPHA 0x00000800
#define D3DTEXOPCAPS_BLENDTEXTUREALPHA 0x00001000
#define D3DTEXOPCAPS_BLENDFACTORALPHA 0x00002000
#define D3DTEXOPCAPS_BLENDTEXTUREALPHAPM 0x00004000
#define D3DTEXOPCAPS_BLENDCURRENTALPHA 0x00008000
#define D3DTEXOPCAPS_PREMODULATE 0x00010000
#define D3DTEXOPCAPS_MODULATEALPHA_ADDCOLOR 0x00020000
#define D3DTEXOPCAPS_MODULATECOLOR_ADDALPHA 0x00040000
#define D3DTEXOPCAPS_MODULATEINVALPHA_ADDCOLOR 0x00080000
#define D3DTEXOPCAPS_MODULATEINVCOLOR_ADDALPHA 0x00100000
#define D3DTEXOPCAPS_BUMPENVMAP 0x00200000
#define D3DTEXOPCAPS_BUMPENVMAPLUMINANCE 0x00400000
#define D3DTEXOPCAPS_DOTPRODUCT3 0x00800000
#define D3DTEXOPCAPS_MULTIPLYADD 0x01000000
#define D3DTEXOPCAPS_LERP 0x02000000
#define D3DVTXPCAPS_TEXGEN 0x00000001
#define D3DVTXPCAPS_MATERIALSOURCE7 0x00000002
#define D3DVTXPCAPS_DIRECTIONALLIGHTS 0x00000008
#define D3DVTXPCAPS_POSITIONALLIGHTS 0x00000010
#define D3DVTXPCAPS_LOCALVIEWER 0x00000020
#define D3DVTXPCAPS_TWEENING 0x00000040
#define D3DVTXPCAPS_TEXGEN_SPHEREMAP 0x00000100
#define D3DVTXPCAPS_NO_TEXGEN_NONLOCALVIEWER 0x00000200
#define D3DDEVCAPS2_STREAMOFFSET 0x00000001
#define D3DDEVCAPS2_DMAPNPATCH 0x00000002
#define D3DDEVCAPS2_ADAPTIVETESSRTPATCH 0x00000004
#define D3DDEVCAPS2_ADAPTIVETESSNPATCH 0x00000008
#define D3DDEVCAPS2_CAN_STRETCHRECT_FROM_TEXTURES 0x00000010
#define D3DDEVCAPS2_PRESAMPLEDDMAPNPATCH 0x00000020
#define D3DDEVCAPS2_VERTEXELEMENTSCANSHARESTREAMOFFSET 0x00000040
#define D3DDTCAPS_UBYTE4 0x00000001
#define D3DDTCAPS_UBYTE4N 0x00000002
#define D3DDTCAPS_SHORT2N 0x00000004
#define D3DDTCAPS_SHORT4N 0x00000008
#define D3DDTCAPS_USHORT2N 0x00000010
#define D3DDTCAPS_USHORT4N 0x00000020
#define D3DDTCAPS_UDEC3 0x00000040
#define D3DDTCAPS_DEC3N 0x00000080
#define D3DDTCAPS_FLOAT16_2 0x00000100
#define D3DDTCAPS_FLOAT16_4 0x00000200
#define D3DVS20_MAX_DYNAMICFLOWCONTROLDEPTH 24
#define D3DVS20_MIN_DYNAMICFLOWCONTROLDEPTH 0
#define D3DVS20_MAX_NUMTEMPS 32
#define D3DVS20_MIN_NUMTEMPS 12
#define D3DVS20_MAX_STATICFLOWCONTROLDEPTH 4
#define D3DVS20_MIN_STATICFLOWCONTROLDEPTH 1
#define D3DVS20CAPS_PREDICATION (1 << 0)
#define D3DPS20CAPS_ARBITRARYSWIZZLE (1 << 0)
#define D3DPS20CAPS_GRADIENTINSTRUCTIONS (1 << 1)
#define D3DPS20CAPS_PREDICATION (1 << 2)
#define D3DPS20CAPS_NODEPENDENTREADLIMIT (1 << 3)
#define D3DPS20CAPS_NOTEXINSTRUCTIONLIMIT (1 << 4)
#define D3DPS20_MAX_DYNAMICFLOWCONTROLDEPTH 24
#define D3DPS20_MIN_DYNAMICFLOWCONTROLDEPTH 0
#define D3DPS20_MAX_NUMTEMPS 32
#define D3DPS20_MIN_NUMTEMPS 12
#define D3DPS20_MAX_STATICFLOWCONTROLDEPTH 4
#define D3DPS20_MIN_STATICFLOWCONTROLDEPTH 0
#define D3DPS20_MAX_NUMINSTRUCTIONSLOTS 512
#define D3DPS20_MIN_NUMINSTRUCTIONSLOTS 96
#define D3DMIN30SHADERINSTRUCTIONS 512
#define D3DMAX30SHADERINSTRUCTIONS 32768
/* Structs */
typedef struct _D3DVSHADERCAPS2_0 {
DWORD Caps;
INT DynamicFlowControlDepth;
INT NumTemps;
INT StaticFlowControlDepth;
} D3DVSHADERCAPS2_0, *PD3DVSHADERCAPS2_0, *LPD3DVSHADERCAPS2_0;
typedef struct _D3DPSHADERCAPS2_0 {
DWORD Caps;
INT DynamicFlowControlDepth;
INT NumTemps;
INT StaticFlowControlDepth;
INT NumInstructionSlots;
} D3DPSHADERCAPS2_0, *PD3DPSHADERCAPS2_0, *LPD3DPSHADERCAPS2_0;
typedef struct _D3DCAPS9 {
D3DDEVTYPE DeviceType;
UINT AdapterOrdinal;
DWORD Caps;
DWORD Caps2;
DWORD Caps3;
DWORD PresentationIntervals;
DWORD CursorCaps;
DWORD DevCaps;
DWORD PrimitiveMiscCaps;
DWORD RasterCaps;
DWORD ZCmpCaps;
DWORD SrcBlendCaps;
DWORD DestBlendCaps;
DWORD AlphaCmpCaps;
DWORD ShadeCaps;
DWORD TextureCaps;
DWORD TextureFilterCaps;
DWORD CubeTextureFilterCaps;
DWORD VolumeTextureFilterCaps;
DWORD TextureAddressCaps;
DWORD VolumeTextureAddressCaps;
DWORD LineCaps;
DWORD MaxTextureWidth;
DWORD MaxTextureHeight;
DWORD MaxVolumeExtent;
DWORD MaxTextureRepeat;
DWORD MaxTextureAspectRatio;
DWORD MaxAnisotropy;
float MaxVertexW;
float GuardBandLeft;
float GuardBandTop;
float GuardBandRight;
float GuardBandBottom;
float ExtentsAdjust;
DWORD StencilCaps;
DWORD FVFCaps;
DWORD TextureOpCaps;
DWORD MaxTextureBlendStages;
DWORD MaxSimultaneousTextures;
DWORD VertexProcessingCaps;
DWORD MaxActiveLights;
DWORD MaxUserClipPlanes;
DWORD MaxVertexBlendMatrices;
DWORD MaxVertexBlendMatrixIndex;
float MaxPointSize;
DWORD MaxPrimitiveCount;
DWORD MaxVertexIndex;
DWORD MaxStreams;
DWORD MaxStreamStride;
DWORD VertexShaderVersion;
DWORD MaxVertexShaderConst;
DWORD PixelShaderVersion;
float PixelShader1xMaxValue;
DWORD DevCaps2;
float MaxNpatchTessellationLevel;
DWORD Reserved5;
UINT MasterAdapterOrdinal;
UINT AdapterOrdinalInGroup;
UINT NumberOfAdaptersInGroup;
DWORD DeclTypes;
DWORD NumSimultaneousRTs;
DWORD StretchRectFilterCaps;
D3DVSHADERCAPS2_0 VS20Caps;
D3DPSHADERCAPS2_0 PS20Caps;
DWORD VertexTextureFilterCaps;
DWORD MaxVShaderInstructionsExecuted;
DWORD MaxPShaderInstructionsExecuted;
DWORD MaxVertexShader30InstructionSlots;
DWORD MaxPixelShader30InstructionSlots;
} D3DCAPS9, *PD3DCAPS9, *LPD3DCAPS9;
typedef struct _D3DCONTENTPROTECTIONCAPS {
DWORD Caps;
GUID KeyExchangeType;
UINT BufferAlignmentStart;
UINT BlockAlignmentSize;
ULONGLONG ProtectedMemorySize;
} D3DCONTENTPROTECTIONCAPS, *PD3DCONTENTPROTECTIONCAPS, *LPD3DCONTENTPROTECTIONCAPS;
typedef struct _D3DOVERLAYCAPS {
UINT Caps;
UINT MaxOverlayDisplayWidth;
UINT MaxOverlayDisplayHeight;
} D3DOVERLAYCAPS, *PD3DOVERLAYCAPS, *LPD3DOVERLAYCAPS;
#endif /* _D3D9CAPS_H_ */

File diff suppressed because it is too large Load Diff

View File

@@ -646,7 +646,6 @@ EGLAPI EGLuint64NV EGLAPIENTRY eglGetSystemTimeNV (void);
#endif /* EGL_NV_system_time */
#include <EGL/eglmesaext.h>
#include <EGL/eglextchromium.h>
#ifdef __cplusplus
}

View File

@@ -1,60 +0,0 @@
// Copyright (c) 2013 The Chromium Authors. All rights reserved.
//
// Redistribution and use in source and binary forms, with or without
// modification, are permitted provided that the following conditions are
// met:
//
// * Redistributions of source code must retain the above copyright
// notice, this list of conditions and the following disclaimer.
// * Redistributions in binary form must reproduce the above
// copyright notice, this list of conditions and the following disclaimer
// in the documentation and/or other materials provided with the
// distribution.
// * Neither the name of Google Inc. nor the names of its
// contributors may be used to endorse or promote products derived from
// this software without specific prior written permission.
//
// THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS
// "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT
// LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR
// A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT
// OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
// SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT
// LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
// DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY
// THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
// (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE
// OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
// This file contains Chromium-specific EGL extensions declarations.
#ifndef GPU_EGL_EGLEXTCHROMIUM_H_
#define GPU_EGL_EGLEXTCHROMIUM_H_
#ifdef __cplusplus
extern "C" {
#endif
#include <EGL/eglplatform.h>
/* EGLSyncControlCHROMIUM requires 64-bit uint support */
#if KHRONOS_SUPPORT_INT64
#ifndef EGL_CHROMIUM_sync_control
#define EGL_CHROMIUM_sync_control 1
typedef khronos_uint64_t EGLuint64CHROMIUM;
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglGetSyncValuesCHROMIUM(
EGLDisplay dpy, EGLSurface surface, EGLuint64CHROMIUM *ust,
EGLuint64CHROMIUM *msc, EGLuint64CHROMIUM *sbc);
#endif /* EGL_EGLEXT_PROTOTYPES */
typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETSYNCVALUESCHROMIUMPROC)
(EGLDisplay dpy, EGLSurface surface, EGLuint64CHROMIUM *ust,
EGLuint64CHROMIUM *msc, EGLuint64CHROMIUM *sbc);
#endif
#endif
#ifdef __cplusplus
}
#endif
#endif // GPU_EGL_EGLEXTCHROMIUM_H_

View File

@@ -34,6 +34,63 @@ extern "C" {
#include <EGL/eglplatform.h>
/* EGL_MESA_screen extension >>> PRELIMINARY <<< */
#ifndef EGL_MESA_screen_surface
#define EGL_MESA_screen_surface 1
#define EGL_BAD_SCREEN_MESA 0x4000
#define EGL_BAD_MODE_MESA 0x4001
#define EGL_SCREEN_COUNT_MESA 0x4002
#define EGL_SCREEN_POSITION_MESA 0x4003
#define EGL_SCREEN_POSITION_GRANULARITY_MESA 0x4004
#define EGL_MODE_ID_MESA 0x4005
#define EGL_REFRESH_RATE_MESA 0x4006
#define EGL_OPTIMAL_MESA 0x4007
#define EGL_INTERLACED_MESA 0x4008
#define EGL_SCREEN_BIT_MESA 0x08
typedef khronos_uint32_t EGLScreenMESA;
typedef khronos_uint32_t EGLModeMESA;
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglChooseModeMESA(EGLDisplay dpy, EGLScreenMESA screen, const EGLint *attrib_list, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
EGLAPI EGLBoolean EGLAPIENTRY eglGetModesMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
EGLAPI EGLBoolean EGLAPIENTRY eglGetModeAttribMESA(EGLDisplay dpy, EGLModeMESA mode, EGLint attribute, EGLint *value);
EGLAPI EGLBoolean EGLAPIENTRY eglGetScreensMESA(EGLDisplay dpy, EGLScreenMESA *screens, EGLint max_screens, EGLint *num_screens);
EGLAPI EGLSurface EGLAPIENTRY eglCreateScreenSurfaceMESA(EGLDisplay dpy, EGLConfig config, const EGLint *attrib_list);
EGLAPI EGLBoolean EGLAPIENTRY eglShowScreenSurfaceMESA(EGLDisplay dpy, EGLint screen, EGLSurface surface, EGLModeMESA mode);
EGLAPI EGLBoolean EGLAPIENTRY eglScreenPositionMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLint x, EGLint y);
EGLAPI EGLBoolean EGLAPIENTRY eglQueryScreenMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLint attribute, EGLint *value);
EGLAPI EGLBoolean EGLAPIENTRY eglQueryScreenSurfaceMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLSurface *surface);
EGLAPI EGLBoolean EGLAPIENTRY eglQueryScreenModeMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *mode);
EGLAPI const char * EGLAPIENTRY eglQueryModeStringMESA(EGLDisplay dpy, EGLModeMESA mode);
#endif /* EGL_EGLEXT_PROTOTYPES */
typedef EGLBoolean (EGLAPIENTRYP PFNEGLCHOOSEMODEMESA) (EGLDisplay dpy, EGLScreenMESA screen, const EGLint *attrib_list, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETMODESMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLGetModeATTRIBMESA) (EGLDisplay dpy, EGLModeMESA mode, EGLint attribute, EGLint *value);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETSCRREENSMESA) (EGLDisplay dpy, EGLScreenMESA *screens, EGLint max_screens, EGLint *num_screens);
typedef EGLSurface (EGLAPIENTRYP PFNEGLCREATESCREENSURFACEMESA) (EGLDisplay dpy, EGLConfig config, const EGLint *attrib_list);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLSHOWSCREENSURFACEMESA) (EGLDisplay dpy, EGLint screen, EGLSurface surface, EGLModeMESA mode);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLSCREENPOSIITONMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLint x, EGLint y);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYSCREENMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLint attribute, EGLint *value);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYSCREENSURFACEMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLSurface *surface);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYSCREENMODEMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *mode);
typedef const char * (EGLAPIENTRYP PFNEGLQUERYMODESTRINGMESA) (EGLDisplay dpy, EGLModeMESA mode);
#endif /* EGL_MESA_screen_surface */
#ifndef EGL_MESA_copy_context
#define EGL_MESA_copy_context 1
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglCopyContextMESA(EGLDisplay dpy, EGLContext source, EGLContext dest, EGLint mask);
#endif /* EGL_EGLEXT_PROTOTYPES */
typedef EGLBoolean (EGLAPIENTRYP PFNEGLCOPYCONTEXTMESA) (EGLDisplay dpy, EGLContext source, EGLContext dest, EGLint mask);
#endif /* EGL_MESA_copy_context */
#ifndef EGL_MESA_drm_display
#define EGL_MESA_drm_display 1
@@ -113,19 +170,6 @@ typedef EGLBoolean (EGLAPIENTRYP PFNEGLSWAPBUFFERSREGIONNOK) (EGLDisplay dpy, EG
#define EGL_NO_CONFIG_MESA ((EGLConfig)0)
#endif
#if KHRONOS_SUPPORT_INT64
#ifndef EGL_MESA_image_dma_buf_export
#define EGL_MESA_image_dma_buf_export 1
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglExportDMABUFImageQueryMESA (EGLDisplay dpy, EGLImageKHR image, EGLint *fourcc, EGLint *nplanes, EGLuint64KHR *modifiers);
EGLAPI EGLBoolean EGLAPIENTRY eglExportDMABUFImageMESA (EGLDisplay dpy, EGLImageKHR image, int *fds, EGLint *strides, EGLint *offsets);
#endif
#endif
typedef EGLBoolean (EGLAPIENTRYP PFNEGLEXPORTDMABUFIMAGEQUERYMESA) (EGLDisplay dpy, EGLImageKHR image, EGLint *fourcc, EGLint *nplanes, EGLuint64KHR *modifiers);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLEXPORTDMABUFIMAGEMESA) (EGLDisplay dpy, EGLImageKHR image, int *fds, EGLint *strides, EGLint *offsets);
#endif
#ifdef __cplusplus
}
#endif

View File

@@ -106,7 +106,7 @@ typedef void *EGLNativeDisplayType;
#elif defined(__unix__)
#if defined(MESA_EGL_NO_X11_HEADERS)
#ifdef MESA_EGL_NO_X11_HEADERS
typedef void *EGLNativeDisplayType;
typedef khronos_uintptr_t EGLNativePixmapType;
@@ -124,16 +124,8 @@ typedef Window EGLNativeWindowType;
#endif /* MESA_EGL_NO_X11_HEADERS */
#elif __HAIKU__
#include <kernel/image.h>
typedef void *EGLNativeDisplayType;
typedef khronos_uintptr_t EGLNativePixmapType;
typedef khronos_uintptr_t EGLNativeWindowType;
#else
#error "Platform not recognized"
#endif
/* EGL 1.2 types, renamed for consistency in EGL 1.3 */

View File

@@ -106,7 +106,6 @@
#define glBindTextureEXT MANGLE(BindTextureEXT)
#define glBindTexture MANGLE(BindTexture)
#define glBindTextures MANGLE(BindTextures)
#define glBindTextureUnit MANGLE(BindTextureUnit)
#define glBindTextureUnitParameterEXT MANGLE(BindTextureUnitParameterEXT)
#define glBindTransformFeedback MANGLE(BindTransformFeedback)
#define glBindTransformFeedbackNV MANGLE(BindTransformFeedbackNV)
@@ -130,7 +129,6 @@
#define glBinormalPointerEXT MANGLE(BinormalPointerEXT)
#define glBitmap MANGLE(Bitmap)
#define glBitmapxOES MANGLE(BitmapxOES)
#define glBlendBarrierKHR MANGLE(BlendBarrierKHR)
#define glBlendBarrierNV MANGLE(BlendBarrierNV)
#define glBlendColorEXT MANGLE(BlendColorEXT)
#define glBlendColor MANGLE(BlendColor)
@@ -159,11 +157,9 @@
#define glBlendParameteriNV MANGLE(BlendParameteriNV)
#define glBlitFramebufferEXT MANGLE(BlitFramebufferEXT)
#define glBlitFramebuffer MANGLE(BlitFramebuffer)
#define glBlitNamedFramebuffer MANGLE(BlitNamedFramebuffer)
#define glBufferAddressRangeNV MANGLE(BufferAddressRangeNV)
#define glBufferDataARB MANGLE(BufferDataARB)
#define glBufferData MANGLE(BufferData)
#define glBufferPageCommitmentARB MANGLE(BufferPageCommitmentARB)
#define glBufferParameteriAPPLE MANGLE(BufferParameteriAPPLE)
#define glBufferStorage MANGLE(BufferStorage)
#define glBufferSubDataARB MANGLE(BufferSubDataARB)
@@ -173,7 +169,6 @@
#define glCheckFramebufferStatusEXT MANGLE(CheckFramebufferStatusEXT)
#define glCheckFramebufferStatus MANGLE(CheckFramebufferStatus)
#define glCheckNamedFramebufferStatusEXT MANGLE(CheckNamedFramebufferStatusEXT)
#define glCheckNamedFramebufferStatus MANGLE(CheckNamedFramebufferStatus)
#define glClampColorARB MANGLE(ClampColorARB)
#define glClampColor MANGLE(ClampColor)
#define glClearAccum MANGLE(ClearAccum)
@@ -196,13 +191,7 @@
#define glClearIndex MANGLE(ClearIndex)
#define glClear MANGLE(Clear)
#define glClearNamedBufferDataEXT MANGLE(ClearNamedBufferDataEXT)
#define glClearNamedBufferData MANGLE(ClearNamedBufferData)
#define glClearNamedBufferSubDataEXT MANGLE(ClearNamedBufferSubDataEXT)
#define glClearNamedBufferSubData MANGLE(ClearNamedBufferSubData)
#define glClearNamedFramebufferfi MANGLE(ClearNamedFramebufferfi)
#define glClearNamedFramebufferfv MANGLE(ClearNamedFramebufferfv)
#define glClearNamedFramebufferiv MANGLE(ClearNamedFramebufferiv)
#define glClearNamedFramebufferuiv MANGLE(ClearNamedFramebufferuiv)
#define glClearStencil MANGLE(ClearStencil)
#define glClearTexImage MANGLE(ClearTexImage)
#define glClearTexSubImage MANGLE(ClearTexSubImage)
@@ -211,7 +200,6 @@
#define glClientActiveVertexStreamATI MANGLE(ClientActiveVertexStreamATI)
#define glClientAttribDefaultEXT MANGLE(ClientAttribDefaultEXT)
#define glClientWaitSync MANGLE(ClientWaitSync)
#define glClipControl MANGLE(ClipControl)
#define glClipPlanefOES MANGLE(ClipPlanefOES)
#define glClipPlane MANGLE(ClipPlane)
#define glClipPlanexOES MANGLE(ClipPlanexOES)
@@ -320,11 +308,8 @@
#define glCompressedTextureImage2DEXT MANGLE(CompressedTextureImage2DEXT)
#define glCompressedTextureImage3DEXT MANGLE(CompressedTextureImage3DEXT)
#define glCompressedTextureSubImage1DEXT MANGLE(CompressedTextureSubImage1DEXT)
#define glCompressedTextureSubImage1D MANGLE(CompressedTextureSubImage1D)
#define glCompressedTextureSubImage2DEXT MANGLE(CompressedTextureSubImage2DEXT)
#define glCompressedTextureSubImage2D MANGLE(CompressedTextureSubImage2D)
#define glCompressedTextureSubImage3DEXT MANGLE(CompressedTextureSubImage3DEXT)
#define glCompressedTextureSubImage3D MANGLE(CompressedTextureSubImage3D)
#define glConvolutionFilter1DEXT MANGLE(ConvolutionFilter1DEXT)
#define glConvolutionFilter1D MANGLE(ConvolutionFilter1D)
#define glConvolutionFilter2DEXT MANGLE(ConvolutionFilter2DEXT)
@@ -355,7 +340,6 @@
#define glCopyMultiTexSubImage1DEXT MANGLE(CopyMultiTexSubImage1DEXT)
#define glCopyMultiTexSubImage2DEXT MANGLE(CopyMultiTexSubImage2DEXT)
#define glCopyMultiTexSubImage3DEXT MANGLE(CopyMultiTexSubImage3DEXT)
#define glCopyNamedBufferSubData MANGLE(CopyNamedBufferSubData)
#define glCopyPathNV MANGLE(CopyPathNV)
#define glCopyPixels MANGLE(CopyPixels)
#define glCopyTexImage1DEXT MANGLE(CopyTexImage1DEXT)
@@ -371,32 +355,20 @@
#define glCopyTextureImage1DEXT MANGLE(CopyTextureImage1DEXT)
#define glCopyTextureImage2DEXT MANGLE(CopyTextureImage2DEXT)
#define glCopyTextureSubImage1DEXT MANGLE(CopyTextureSubImage1DEXT)
#define glCopyTextureSubImage1D MANGLE(CopyTextureSubImage1D)
#define glCopyTextureSubImage2DEXT MANGLE(CopyTextureSubImage2DEXT)
#define glCopyTextureSubImage2D MANGLE(CopyTextureSubImage2D)
#define glCopyTextureSubImage3DEXT MANGLE(CopyTextureSubImage3DEXT)
#define glCopyTextureSubImage3D MANGLE(CopyTextureSubImage3D)
#define glCoverFillPathInstancedNV MANGLE(CoverFillPathInstancedNV)
#define glCoverFillPathNV MANGLE(CoverFillPathNV)
#define glCoverStrokePathInstancedNV MANGLE(CoverStrokePathInstancedNV)
#define glCoverStrokePathNV MANGLE(CoverStrokePathNV)
#define glCreateBuffers MANGLE(CreateBuffers)
#define glCreateFramebuffers MANGLE(CreateFramebuffers)
#define glCreatePerfQueryINTEL MANGLE(CreatePerfQueryINTEL)
#define glCreateProgram MANGLE(CreateProgram)
#define glCreateProgramObjectARB MANGLE(CreateProgramObjectARB)
#define glCreateProgramPipelines MANGLE(CreateProgramPipelines)
#define glCreateQueries MANGLE(CreateQueries)
#define glCreateRenderbuffers MANGLE(CreateRenderbuffers)
#define glCreateSamplers MANGLE(CreateSamplers)
#define glCreateShader MANGLE(CreateShader)
#define glCreateShaderObjectARB MANGLE(CreateShaderObjectARB)
#define glCreateShaderProgramEXT MANGLE(CreateShaderProgramEXT)
#define glCreateShaderProgramv MANGLE(CreateShaderProgramv)
#define glCreateSyncFromCLeventARB MANGLE(CreateSyncFromCLeventARB)
#define glCreateTextures MANGLE(CreateTextures)
#define glCreateTransformFeedbacks MANGLE(CreateTransformFeedbacks)
#define glCreateVertexArrays MANGLE(CreateVertexArrays)
#define glCullFace MANGLE(CullFace)
#define glCullParameterdvEXT MANGLE(CullParameterdvEXT)
#define glCullParameterfvEXT MANGLE(CullParameterfvEXT)
@@ -469,7 +441,6 @@
#define glDisable MANGLE(Disable)
#define glDisableVariantClientStateEXT MANGLE(DisableVariantClientStateEXT)
#define glDisableVertexArrayAttribEXT MANGLE(DisableVertexArrayAttribEXT)
#define glDisableVertexArrayAttrib MANGLE(DisableVertexArrayAttrib)
#define glDisableVertexArrayEXT MANGLE(DisableVertexArrayEXT)
#define glDisableVertexAttribAPPLE MANGLE(DisableVertexAttribAPPLE)
#define glDisableVertexAttribArrayARB MANGLE(DisableVertexAttribArrayARB)
@@ -530,7 +501,6 @@
#define glEnable MANGLE(Enable)
#define glEnableVariantClientStateEXT MANGLE(EnableVariantClientStateEXT)
#define glEnableVertexArrayAttribEXT MANGLE(EnableVertexArrayAttribEXT)
#define glEnableVertexArrayAttrib MANGLE(EnableVertexArrayAttrib)
#define glEnableVertexArrayEXT MANGLE(EnableVertexArrayEXT)
#define glEnableVertexAttribAPPLE MANGLE(EnableVertexAttribAPPLE)
#define glEnableVertexAttribArrayARB MANGLE(EnableVertexAttribArrayARB)
@@ -585,7 +555,6 @@
#define glFlushMappedBufferRangeAPPLE MANGLE(FlushMappedBufferRangeAPPLE)
#define glFlushMappedBufferRange MANGLE(FlushMappedBufferRange)
#define glFlushMappedNamedBufferRangeEXT MANGLE(FlushMappedNamedBufferRangeEXT)
#define glFlushMappedNamedBufferRange MANGLE(FlushMappedNamedBufferRange)
#define glFlushPixelDataRangeNV MANGLE(FlushPixelDataRangeNV)
#define glFlushRasterSGIX MANGLE(FlushRasterSGIX)
#define glFlushStaticDataIBM MANGLE(FlushStaticDataIBM)
@@ -659,7 +628,6 @@
#define glGenerateMipmap MANGLE(GenerateMipmap)
#define glGenerateMultiTexMipmapEXT MANGLE(GenerateMultiTexMipmapEXT)
#define glGenerateTextureMipmapEXT MANGLE(GenerateTextureMipmapEXT)
#define glGenerateTextureMipmap MANGLE(GenerateTextureMipmap)
#define glGenFencesAPPLE MANGLE(GenFencesAPPLE)
#define glGenFencesNV MANGLE(GenFencesNV)
#define glGenFragmentShadersATI MANGLE(GenFragmentShadersATI)
@@ -737,8 +705,6 @@
#define glGetCompressedTexImageARB MANGLE(GetCompressedTexImageARB)
#define glGetCompressedTexImage MANGLE(GetCompressedTexImage)
#define glGetCompressedTextureImageEXT MANGLE(GetCompressedTextureImageEXT)
#define glGetCompressedTextureImage MANGLE(GetCompressedTextureImage)
#define glGetCompressedTextureSubImage MANGLE(GetCompressedTextureSubImage)
#define glGetConvolutionFilterEXT MANGLE(GetConvolutionFilterEXT)
#define glGetConvolutionFilter MANGLE(GetConvolutionFilter)
#define glGetConvolutionParameterfvEXT MANGLE(GetConvolutionParameterfvEXT)
@@ -777,7 +743,6 @@
#define glGetFramebufferParameterivEXT MANGLE(GetFramebufferParameterivEXT)
#define glGetFramebufferParameteriv MANGLE(GetFramebufferParameteriv)
#define glGetGraphicsResetStatusARB MANGLE(GetGraphicsResetStatusARB)
#define glGetGraphicsResetStatus MANGLE(GetGraphicsResetStatus)
#define glGetHandleARB MANGLE(GetHandleARB)
#define glGetHistogramEXT MANGLE(GetHistogramEXT)
#define glGetHistogram MANGLE(GetHistogram)
@@ -844,18 +809,12 @@
#define glGetMultiTexParameterIivEXT MANGLE(GetMultiTexParameterIivEXT)
#define glGetMultiTexParameterIuivEXT MANGLE(GetMultiTexParameterIuivEXT)
#define glGetMultiTexParameterivEXT MANGLE(GetMultiTexParameterivEXT)
#define glGetNamedBufferParameteri64v MANGLE(GetNamedBufferParameteri64v)
#define glGetNamedBufferParameterivEXT MANGLE(GetNamedBufferParameterivEXT)
#define glGetNamedBufferParameteriv MANGLE(GetNamedBufferParameteriv)
#define glGetNamedBufferParameterui64vNV MANGLE(GetNamedBufferParameterui64vNV)
#define glGetNamedBufferPointervEXT MANGLE(GetNamedBufferPointervEXT)
#define glGetNamedBufferPointerv MANGLE(GetNamedBufferPointerv)
#define glGetNamedBufferSubDataEXT MANGLE(GetNamedBufferSubDataEXT)
#define glGetNamedBufferSubData MANGLE(GetNamedBufferSubData)
#define glGetNamedFramebufferAttachmentParameterivEXT MANGLE(GetNamedFramebufferAttachmentParameterivEXT)
#define glGetNamedFramebufferAttachmentParameteriv MANGLE(GetNamedFramebufferAttachmentParameteriv)
#define glGetNamedFramebufferParameterivEXT MANGLE(GetNamedFramebufferParameterivEXT)
#define glGetNamedFramebufferParameteriv MANGLE(GetNamedFramebufferParameteriv)
#define glGetNamedProgramivEXT MANGLE(GetNamedProgramivEXT)
#define glGetNamedProgramLocalParameterdvEXT MANGLE(GetNamedProgramLocalParameterdvEXT)
#define glGetNamedProgramLocalParameterfvEXT MANGLE(GetNamedProgramLocalParameterfvEXT)
@@ -863,46 +822,27 @@
#define glGetNamedProgramLocalParameterIuivEXT MANGLE(GetNamedProgramLocalParameterIuivEXT)
#define glGetNamedProgramStringEXT MANGLE(GetNamedProgramStringEXT)
#define glGetNamedRenderbufferParameterivEXT MANGLE(GetNamedRenderbufferParameterivEXT)
#define glGetNamedRenderbufferParameteriv MANGLE(GetNamedRenderbufferParameteriv)
#define glGetNamedStringARB MANGLE(GetNamedStringARB)
#define glGetNamedStringivARB MANGLE(GetNamedStringivARB)
#define glGetnColorTableARB MANGLE(GetnColorTableARB)
#define glGetnColorTable MANGLE(GetnColorTable)
#define glGetnCompressedTexImageARB MANGLE(GetnCompressedTexImageARB)
#define glGetnCompressedTexImage MANGLE(GetnCompressedTexImage)
#define glGetnConvolutionFilterARB MANGLE(GetnConvolutionFilterARB)
#define glGetnConvolutionFilter MANGLE(GetnConvolutionFilter)
#define glGetNextPerfQueryIdINTEL MANGLE(GetNextPerfQueryIdINTEL)
#define glGetnHistogramARB MANGLE(GetnHistogramARB)
#define glGetnHistogram MANGLE(GetnHistogram)
#define glGetnMapdvARB MANGLE(GetnMapdvARB)
#define glGetnMapdv MANGLE(GetnMapdv)
#define glGetnMapfvARB MANGLE(GetnMapfvARB)
#define glGetnMapfv MANGLE(GetnMapfv)
#define glGetnMapivARB MANGLE(GetnMapivARB)
#define glGetnMapiv MANGLE(GetnMapiv)
#define glGetnMinmaxARB MANGLE(GetnMinmaxARB)
#define glGetnMinmax MANGLE(GetnMinmax)
#define glGetnPixelMapfvARB MANGLE(GetnPixelMapfvARB)
#define glGetnPixelMapfv MANGLE(GetnPixelMapfv)
#define glGetnPixelMapuivARB MANGLE(GetnPixelMapuivARB)
#define glGetnPixelMapuiv MANGLE(GetnPixelMapuiv)
#define glGetnPixelMapusvARB MANGLE(GetnPixelMapusvARB)
#define glGetnPixelMapusv MANGLE(GetnPixelMapusv)
#define glGetnPolygonStippleARB MANGLE(GetnPolygonStippleARB)
#define glGetnPolygonStipple MANGLE(GetnPolygonStipple)
#define glGetnSeparableFilterARB MANGLE(GetnSeparableFilterARB)
#define glGetnSeparableFilter MANGLE(GetnSeparableFilter)
#define glGetnTexImageARB MANGLE(GetnTexImageARB)
#define glGetnTexImage MANGLE(GetnTexImage)
#define glGetnUniformdvARB MANGLE(GetnUniformdvARB)
#define glGetnUniformdv MANGLE(GetnUniformdv)
#define glGetnUniformfvARB MANGLE(GetnUniformfvARB)
#define glGetnUniformfv MANGLE(GetnUniformfv)
#define glGetnUniformivARB MANGLE(GetnUniformivARB)
#define glGetnUniformiv MANGLE(GetnUniformiv)
#define glGetnUniformuivARB MANGLE(GetnUniformuivARB)
#define glGetnUniformuiv MANGLE(GetnUniformuiv)
#define glGetObjectBufferfvATI MANGLE(GetObjectBufferfvATI)
#define glGetObjectBufferivATI MANGLE(GetObjectBufferivATI)
#define glGetObjectLabelEXT MANGLE(GetObjectLabelEXT)
@@ -969,7 +909,6 @@
#define glGetProgramParameterfvNV MANGLE(GetProgramParameterfvNV)
#define glGetProgramPipelineInfoLog MANGLE(GetProgramPipelineInfoLog)
#define glGetProgramPipelineiv MANGLE(GetProgramPipelineiv)
#define glGetProgramResourcefvNV MANGLE(GetProgramResourcefvNV)
#define glGetProgramResourceIndex MANGLE(GetProgramResourceIndex)
#define glGetProgramResourceiv MANGLE(GetProgramResourceiv)
#define glGetProgramResourceLocationIndex MANGLE(GetProgramResourceLocationIndex)
@@ -1034,26 +973,15 @@
#define glGetTextureHandleARB MANGLE(GetTextureHandleARB)
#define glGetTextureHandleNV MANGLE(GetTextureHandleNV)
#define glGetTextureImageEXT MANGLE(GetTextureImageEXT)
#define glGetTextureImage MANGLE(GetTextureImage)
#define glGetTextureLevelParameterfvEXT MANGLE(GetTextureLevelParameterfvEXT)
#define glGetTextureLevelParameterfv MANGLE(GetTextureLevelParameterfv)
#define glGetTextureLevelParameterivEXT MANGLE(GetTextureLevelParameterivEXT)
#define glGetTextureLevelParameteriv MANGLE(GetTextureLevelParameteriv)
#define glGetTextureParameterfvEXT MANGLE(GetTextureParameterfvEXT)
#define glGetTextureParameterfv MANGLE(GetTextureParameterfv)
#define glGetTextureParameterIivEXT MANGLE(GetTextureParameterIivEXT)
#define glGetTextureParameterIiv MANGLE(GetTextureParameterIiv)
#define glGetTextureParameterIuivEXT MANGLE(GetTextureParameterIuivEXT)
#define glGetTextureParameterIuiv MANGLE(GetTextureParameterIuiv)
#define glGetTextureParameterivEXT MANGLE(GetTextureParameterivEXT)
#define glGetTextureParameteriv MANGLE(GetTextureParameteriv)
#define glGetTextureSamplerHandleARB MANGLE(GetTextureSamplerHandleARB)
#define glGetTextureSamplerHandleNV MANGLE(GetTextureSamplerHandleNV)
#define glGetTextureSubImage MANGLE(GetTextureSubImage)
#define glGetTrackMatrixivNV MANGLE(GetTrackMatrixivNV)
#define glGetTransformFeedbacki64_v MANGLE(GetTransformFeedbacki64_v)
#define glGetTransformFeedbacki_v MANGLE(GetTransformFeedbacki_v)
#define glGetTransformFeedbackiv MANGLE(GetTransformFeedbackiv)
#define glGetTransformFeedbackVaryingEXT MANGLE(GetTransformFeedbackVaryingEXT)
#define glGetTransformFeedbackVarying MANGLE(GetTransformFeedbackVarying)
#define glGetTransformFeedbackVaryingNV MANGLE(GetTransformFeedbackVaryingNV)
@@ -1080,11 +1008,8 @@
#define glGetVariantIntegervEXT MANGLE(GetVariantIntegervEXT)
#define glGetVariantPointervEXT MANGLE(GetVariantPointervEXT)
#define glGetVaryingLocationNV MANGLE(GetVaryingLocationNV)
#define glGetVertexArrayIndexed64iv MANGLE(GetVertexArrayIndexed64iv)
#define glGetVertexArrayIndexediv MANGLE(GetVertexArrayIndexediv)
#define glGetVertexArrayIntegeri_vEXT MANGLE(GetVertexArrayIntegeri_vEXT)
#define glGetVertexArrayIntegervEXT MANGLE(GetVertexArrayIntegervEXT)
#define glGetVertexArrayiv MANGLE(GetVertexArrayiv)
#define glGetVertexArrayPointeri_vEXT MANGLE(GetVertexArrayPointeri_vEXT)
#define glGetVertexArrayPointervEXT MANGLE(GetVertexArrayPointervEXT)
#define glGetVertexAttribArrayObjectfvATI MANGLE(GetVertexAttribArrayObjectfvATI)
@@ -1164,8 +1089,6 @@
#define glInvalidateBufferData MANGLE(InvalidateBufferData)
#define glInvalidateBufferSubData MANGLE(InvalidateBufferSubData)
#define glInvalidateFramebuffer MANGLE(InvalidateFramebuffer)
#define glInvalidateNamedFramebufferData MANGLE(InvalidateNamedFramebufferData)
#define glInvalidateNamedFramebufferSubData MANGLE(InvalidateNamedFramebufferSubData)
#define glInvalidateSubFramebuffer MANGLE(InvalidateSubFramebuffer)
#define glInvalidateTexImage MANGLE(InvalidateTexImage)
#define glInvalidateTexSubImage MANGLE(InvalidateTexSubImage)
@@ -1279,9 +1202,7 @@
#define glMapGrid2f MANGLE(MapGrid2f)
#define glMapGrid2xOES MANGLE(MapGrid2xOES)
#define glMapNamedBufferEXT MANGLE(MapNamedBufferEXT)
#define glMapNamedBuffer MANGLE(MapNamedBuffer)
#define glMapNamedBufferRangeEXT MANGLE(MapNamedBufferRangeEXT)
#define glMapNamedBufferRange MANGLE(MapNamedBufferRange)
#define glMapObjectBufferATI MANGLE(MapObjectBufferATI)
#define glMapParameterfvNV MANGLE(MapParameterfvNV)
#define glMapParameterivNV MANGLE(MapParameterivNV)
@@ -1301,20 +1222,14 @@
#define glMatrixIndexubvARB MANGLE(MatrixIndexubvARB)
#define glMatrixIndexuivARB MANGLE(MatrixIndexuivARB)
#define glMatrixIndexusvARB MANGLE(MatrixIndexusvARB)
#define glMatrixLoad3x2fNV MANGLE(MatrixLoad3x2fNV)
#define glMatrixLoad3x3fNV MANGLE(MatrixLoad3x3fNV)
#define glMatrixLoaddEXT MANGLE(MatrixLoaddEXT)
#define glMatrixLoadfEXT MANGLE(MatrixLoadfEXT)
#define glMatrixLoadIdentityEXT MANGLE(MatrixLoadIdentityEXT)
#define glMatrixLoadTranspose3x3fNV MANGLE(MatrixLoadTranspose3x3fNV)
#define glMatrixLoadTransposedEXT MANGLE(MatrixLoadTransposedEXT)
#define glMatrixLoadTransposefEXT MANGLE(MatrixLoadTransposefEXT)
#define glMatrixMode MANGLE(MatrixMode)
#define glMatrixMult3x2fNV MANGLE(MatrixMult3x2fNV)
#define glMatrixMult3x3fNV MANGLE(MatrixMult3x3fNV)
#define glMatrixMultdEXT MANGLE(MatrixMultdEXT)
#define glMatrixMultfEXT MANGLE(MatrixMultfEXT)
#define glMatrixMultTranspose3x3fNV MANGLE(MatrixMultTranspose3x3fNV)
#define glMatrixMultTransposedEXT MANGLE(MatrixMultTransposedEXT)
#define glMatrixMultTransposefEXT MANGLE(MatrixMultTransposefEXT)
#define glMatrixOrthoEXT MANGLE(MatrixOrthoEXT)
@@ -1326,7 +1241,6 @@
#define glMatrixScalefEXT MANGLE(MatrixScalefEXT)
#define glMatrixTranslatedEXT MANGLE(MatrixTranslatedEXT)
#define glMatrixTranslatefEXT MANGLE(MatrixTranslatefEXT)
#define glMemoryBarrierByRegion MANGLE(MemoryBarrierByRegion)
#define glMemoryBarrierEXT MANGLE(MemoryBarrierEXT)
#define glMemoryBarrier MANGLE(MemoryBarrier)
#define glMinmaxEXT MANGLE(MinmaxEXT)
@@ -1335,7 +1249,6 @@
#define glMinSampleShading MANGLE(MinSampleShading)
#define glMultiDrawArraysEXT MANGLE(MultiDrawArraysEXT)
#define glMultiDrawArraysIndirectAMD MANGLE(MultiDrawArraysIndirectAMD)
#define glMultiDrawArraysIndirectBindlessCountNV MANGLE(MultiDrawArraysIndirectBindlessCountNV)
#define glMultiDrawArraysIndirectBindlessNV MANGLE(MultiDrawArraysIndirectBindlessNV)
#define glMultiDrawArraysIndirectCountARB MANGLE(MultiDrawArraysIndirectCountARB)
#define glMultiDrawArraysIndirect MANGLE(MultiDrawArraysIndirect)
@@ -1344,7 +1257,6 @@
#define glMultiDrawElementsBaseVertex MANGLE(MultiDrawElementsBaseVertex)
#define glMultiDrawElementsEXT MANGLE(MultiDrawElementsEXT)
#define glMultiDrawElementsIndirectAMD MANGLE(MultiDrawElementsIndirectAMD)
#define glMultiDrawElementsIndirectBindlessCountNV MANGLE(MultiDrawElementsIndirectBindlessCountNV)
#define glMultiDrawElementsIndirectBindlessNV MANGLE(MultiDrawElementsIndirectBindlessNV)
#define glMultiDrawElementsIndirectCountARB MANGLE(MultiDrawElementsIndirectCountARB)
#define glMultiDrawElementsIndirect MANGLE(MultiDrawElementsIndirect)
@@ -1482,29 +1394,17 @@
#define glMultTransposeMatrixf MANGLE(MultTransposeMatrixf)
#define glMultTransposeMatrixxOES MANGLE(MultTransposeMatrixxOES)
#define glNamedBufferDataEXT MANGLE(NamedBufferDataEXT)
#define glNamedBufferData MANGLE(NamedBufferData)
#define glNamedBufferPageCommitmentARB MANGLE(NamedBufferPageCommitmentARB)
#define glNamedBufferPageCommitmentEXT MANGLE(NamedBufferPageCommitmentEXT)
#define glNamedBufferStorageEXT MANGLE(NamedBufferStorageEXT)
#define glNamedBufferStorage MANGLE(NamedBufferStorage)
#define glNamedBufferSubDataEXT MANGLE(NamedBufferSubDataEXT)
#define glNamedBufferSubData MANGLE(NamedBufferSubData)
#define glNamedCopyBufferSubDataEXT MANGLE(NamedCopyBufferSubDataEXT)
#define glNamedFramebufferDrawBuffer MANGLE(NamedFramebufferDrawBuffer)
#define glNamedFramebufferDrawBuffers MANGLE(NamedFramebufferDrawBuffers)
#define glNamedFramebufferParameteriEXT MANGLE(NamedFramebufferParameteriEXT)
#define glNamedFramebufferParameteri MANGLE(NamedFramebufferParameteri)
#define glNamedFramebufferReadBuffer MANGLE(NamedFramebufferReadBuffer)
#define glNamedFramebufferRenderbufferEXT MANGLE(NamedFramebufferRenderbufferEXT)
#define glNamedFramebufferRenderbuffer MANGLE(NamedFramebufferRenderbuffer)
#define glNamedFramebufferTexture1DEXT MANGLE(NamedFramebufferTexture1DEXT)
#define glNamedFramebufferTexture2DEXT MANGLE(NamedFramebufferTexture2DEXT)
#define glNamedFramebufferTexture3DEXT MANGLE(NamedFramebufferTexture3DEXT)
#define glNamedFramebufferTextureEXT MANGLE(NamedFramebufferTextureEXT)
#define glNamedFramebufferTextureFaceEXT MANGLE(NamedFramebufferTextureFaceEXT)
#define glNamedFramebufferTextureLayerEXT MANGLE(NamedFramebufferTextureLayerEXT)
#define glNamedFramebufferTextureLayer MANGLE(NamedFramebufferTextureLayer)
#define glNamedFramebufferTexture MANGLE(NamedFramebufferTexture)
#define glNamedProgramLocalParameter4dEXT MANGLE(NamedProgramLocalParameter4dEXT)
#define glNamedProgramLocalParameter4dvEXT MANGLE(NamedProgramLocalParameter4dvEXT)
#define glNamedProgramLocalParameter4fEXT MANGLE(NamedProgramLocalParameter4fEXT)
@@ -1518,10 +1418,8 @@
#define glNamedProgramLocalParametersI4uivEXT MANGLE(NamedProgramLocalParametersI4uivEXT)
#define glNamedProgramStringEXT MANGLE(NamedProgramStringEXT)
#define glNamedRenderbufferStorageEXT MANGLE(NamedRenderbufferStorageEXT)
#define glNamedRenderbufferStorage MANGLE(NamedRenderbufferStorage)
#define glNamedRenderbufferStorageMultisampleCoverageEXT MANGLE(NamedRenderbufferStorageMultisampleCoverageEXT)
#define glNamedRenderbufferStorageMultisampleEXT MANGLE(NamedRenderbufferStorageMultisampleEXT)
#define glNamedRenderbufferStorageMultisample MANGLE(NamedRenderbufferStorageMultisample)
#define glNamedStringARB MANGLE(NamedStringARB)
#define glNewList MANGLE(NewList)
#define glNewObjectBufferATI MANGLE(NewObjectBufferATI)
@@ -1576,11 +1474,8 @@
#define glPathCoverDepthFuncNV MANGLE(PathCoverDepthFuncNV)
#define glPathDashArrayNV MANGLE(PathDashArrayNV)
#define glPathFogGenNV MANGLE(PathFogGenNV)
#define glPathGlyphIndexArrayNV MANGLE(PathGlyphIndexArrayNV)
#define glPathGlyphIndexRangeNV MANGLE(PathGlyphIndexRangeNV)
#define glPathGlyphRangeNV MANGLE(PathGlyphRangeNV)
#define glPathGlyphsNV MANGLE(PathGlyphsNV)
#define glPathMemoryGlyphIndexArrayNV MANGLE(PathMemoryGlyphIndexArrayNV)
#define glPathParameterfNV MANGLE(PathParameterfNV)
#define glPathParameterfvNV MANGLE(PathParameterfvNV)
#define glPathParameteriNV MANGLE(PathParameteriNV)
@@ -1693,7 +1588,6 @@
#define glProgramParameteri MANGLE(ProgramParameteri)
#define glProgramParameters4dvNV MANGLE(ProgramParameters4dvNV)
#define glProgramParameters4fvNV MANGLE(ProgramParameters4fvNV)
#define glProgramPathFragmentInputGenNV MANGLE(ProgramPathFragmentInputGenNV)
#define glProgramStringARB MANGLE(ProgramStringARB)
#define glProgramSubroutineParametersuivNV MANGLE(ProgramSubroutineParametersuivNV)
#define glProgramUniform1dEXT MANGLE(ProgramUniform1dEXT)
@@ -1864,7 +1758,6 @@
#define glReadBuffer MANGLE(ReadBuffer)
#define glReadInstrumentsSGIX MANGLE(ReadInstrumentsSGIX)
#define glReadnPixelsARB MANGLE(ReadnPixelsARB)
#define glReadnPixels MANGLE(ReadnPixels)
#define glReadPixels MANGLE(ReadPixels)
#define glRectd MANGLE(Rectd)
#define glRectdv MANGLE(Rectdv)
@@ -2019,10 +1912,6 @@
#define glStencilOpValueAMD MANGLE(StencilOpValueAMD)
#define glStencilStrokePathInstancedNV MANGLE(StencilStrokePathInstancedNV)
#define glStencilStrokePathNV MANGLE(StencilStrokePathNV)
#define glStencilThenCoverFillPathInstancedNV MANGLE(StencilThenCoverFillPathInstancedNV)
#define glStencilThenCoverFillPathNV MANGLE(StencilThenCoverFillPathNV)
#define glStencilThenCoverStrokePathInstancedNV MANGLE(StencilThenCoverStrokePathInstancedNV)
#define glStencilThenCoverStrokePathNV MANGLE(StencilThenCoverStrokePathNV)
#define glStopInstrumentsSGIX MANGLE(StopInstrumentsSGIX)
#define glStringMarkerGREMEDY MANGLE(StringMarkerGREMEDY)
#define glSwizzleEXT MANGLE(SwizzleEXT)
@@ -2183,12 +2072,9 @@
#define glTexSubImage3DEXT MANGLE(TexSubImage3DEXT)
#define glTexSubImage3D MANGLE(TexSubImage3D)
#define glTexSubImage4DSGIS MANGLE(TexSubImage4DSGIS)
#define glTextureBarrier MANGLE(TextureBarrier)
#define glTextureBarrierNV MANGLE(TextureBarrierNV)
#define glTextureBufferEXT MANGLE(TextureBufferEXT)
#define glTextureBuffer MANGLE(TextureBuffer)
#define glTextureBufferRangeEXT MANGLE(TextureBufferRangeEXT)
#define glTextureBufferRange MANGLE(TextureBufferRange)
#define glTextureColorMaskSGIS MANGLE(TextureColorMaskSGIS)
#define glTextureImage1DEXT MANGLE(TextureImage1DEXT)
#define glTextureImage2DEXT MANGLE(TextureImage2DEXT)
@@ -2202,41 +2088,25 @@
#define glTextureNormalEXT MANGLE(TextureNormalEXT)
#define glTexturePageCommitmentEXT MANGLE(TexturePageCommitmentEXT)
#define glTextureParameterfEXT MANGLE(TextureParameterfEXT)
#define glTextureParameterf MANGLE(TextureParameterf)
#define glTextureParameterfvEXT MANGLE(TextureParameterfvEXT)
#define glTextureParameterfv MANGLE(TextureParameterfv)
#define glTextureParameteriEXT MANGLE(TextureParameteriEXT)
#define glTextureParameterIivEXT MANGLE(TextureParameterIivEXT)
#define glTextureParameterIiv MANGLE(TextureParameterIiv)
#define glTextureParameteri MANGLE(TextureParameteri)
#define glTextureParameterIuivEXT MANGLE(TextureParameterIuivEXT)
#define glTextureParameterIuiv MANGLE(TextureParameterIuiv)
#define glTextureParameterivEXT MANGLE(TextureParameterivEXT)
#define glTextureParameteriv MANGLE(TextureParameteriv)
#define glTextureRangeAPPLE MANGLE(TextureRangeAPPLE)
#define glTextureRenderbufferEXT MANGLE(TextureRenderbufferEXT)
#define glTextureStorage1DEXT MANGLE(TextureStorage1DEXT)
#define glTextureStorage1D MANGLE(TextureStorage1D)
#define glTextureStorage2DEXT MANGLE(TextureStorage2DEXT)
#define glTextureStorage2D MANGLE(TextureStorage2D)
#define glTextureStorage2DMultisampleEXT MANGLE(TextureStorage2DMultisampleEXT)
#define glTextureStorage2DMultisample MANGLE(TextureStorage2DMultisample)
#define glTextureStorage3DEXT MANGLE(TextureStorage3DEXT)
#define glTextureStorage3D MANGLE(TextureStorage3D)
#define glTextureStorage3DMultisampleEXT MANGLE(TextureStorage3DMultisampleEXT)
#define glTextureStorage3DMultisample MANGLE(TextureStorage3DMultisample)
#define glTextureStorageSparseAMD MANGLE(TextureStorageSparseAMD)
#define glTextureSubImage1DEXT MANGLE(TextureSubImage1DEXT)
#define glTextureSubImage1D MANGLE(TextureSubImage1D)
#define glTextureSubImage2DEXT MANGLE(TextureSubImage2DEXT)
#define glTextureSubImage2D MANGLE(TextureSubImage2D)
#define glTextureSubImage3DEXT MANGLE(TextureSubImage3DEXT)
#define glTextureSubImage3D MANGLE(TextureSubImage3D)
#define glTextureView MANGLE(TextureView)
#define glTrackMatrixNV MANGLE(TrackMatrixNV)
#define glTransformFeedbackAttribsNV MANGLE(TransformFeedbackAttribsNV)
#define glTransformFeedbackBufferBase MANGLE(TransformFeedbackBufferBase)
#define glTransformFeedbackBufferRange MANGLE(TransformFeedbackBufferRange)
#define glTransformFeedbackStreamAttribsNV MANGLE(TransformFeedbackStreamAttribsNV)
#define glTransformFeedbackVaryingsEXT MANGLE(TransformFeedbackVaryingsEXT)
#define glTransformFeedbackVaryings MANGLE(TransformFeedbackVaryings)
@@ -2351,7 +2221,6 @@
#define glUnmapBufferARB MANGLE(UnmapBufferARB)
#define glUnmapBuffer MANGLE(UnmapBuffer)
#define glUnmapNamedBufferEXT MANGLE(UnmapNamedBufferEXT)
#define glUnmapNamedBuffer MANGLE(UnmapNamedBuffer)
#define glUnmapObjectBufferATI MANGLE(UnmapObjectBufferATI)
#define glUnmapTexture2DINTEL MANGLE(UnmapTexture2DINTEL)
#define glUpdateObjectBufferATI MANGLE(UpdateObjectBufferATI)
@@ -2424,15 +2293,9 @@
#define glVertex4sv MANGLE(Vertex4sv)
#define glVertex4xOES MANGLE(Vertex4xOES)
#define glVertex4xvOES MANGLE(Vertex4xvOES)
#define glVertexArrayAttribBinding MANGLE(VertexArrayAttribBinding)
#define glVertexArrayAttribFormat MANGLE(VertexArrayAttribFormat)
#define glVertexArrayAttribIFormat MANGLE(VertexArrayAttribIFormat)
#define glVertexArrayAttribLFormat MANGLE(VertexArrayAttribLFormat)
#define glVertexArrayBindingDivisor MANGLE(VertexArrayBindingDivisor)
#define glVertexArrayBindVertexBufferEXT MANGLE(VertexArrayBindVertexBufferEXT)
#define glVertexArrayColorOffsetEXT MANGLE(VertexArrayColorOffsetEXT)
#define glVertexArrayEdgeFlagOffsetEXT MANGLE(VertexArrayEdgeFlagOffsetEXT)
#define glVertexArrayElementBuffer MANGLE(VertexArrayElementBuffer)
#define glVertexArrayFogCoordOffsetEXT MANGLE(VertexArrayFogCoordOffsetEXT)
#define glVertexArrayIndexOffsetEXT MANGLE(VertexArrayIndexOffsetEXT)
#define glVertexArrayMultiTexCoordOffsetEXT MANGLE(VertexArrayMultiTexCoordOffsetEXT)
@@ -2451,8 +2314,6 @@
#define glVertexArrayVertexAttribLOffsetEXT MANGLE(VertexArrayVertexAttribLOffsetEXT)
#define glVertexArrayVertexAttribOffsetEXT MANGLE(VertexArrayVertexAttribOffsetEXT)
#define glVertexArrayVertexBindingDivisorEXT MANGLE(VertexArrayVertexBindingDivisorEXT)
#define glVertexArrayVertexBuffer MANGLE(VertexArrayVertexBuffer)
#define glVertexArrayVertexBuffers MANGLE(VertexArrayVertexBuffers)
#define glVertexArrayVertexOffsetEXT MANGLE(VertexArrayVertexOffsetEXT)
#define glVertexAttrib1dARB MANGLE(VertexAttrib1dARB)
#define glVertexAttrib1d MANGLE(VertexAttrib1d)

File diff suppressed because it is too large Load Diff

File diff suppressed because it is too large Load Diff

View File

@@ -518,7 +518,7 @@ typedef struct {
unsigned long serial; /* # of last request processed by server */
Bool send_event; /* true if this came from a SendEvent request */
Display *display; /* Display the event was read from */
Drawable drawable; /* drawable on which event was requested in event mask */
GLXDrawable drawable; /* drawable on which event was requested in event mask */
int event_type;
int64_t ust;
int64_t msc;

View File

@@ -33,10 +33,10 @@ extern "C" {
** used to make the header, and the header can be found at
** http://www.opengl.org/registry/
**
** Khronos $Revision: 27684 $ on $Date: 2014-08-11 01:21:35 -0700 (Mon, 11 Aug 2014) $
** Khronos $Revision: 25407 $ on $Date: 2014-02-18 16:51:56 -0800 (Tue, 18 Feb 2014) $
*/
#define GLX_GLXEXT_VERSION 20140810
#define GLX_GLXEXT_VERSION 20140218
/* Generated C header for:
* API: glx
@@ -158,13 +158,6 @@ __GLXextFuncPtr glXGetProcAddress (const GLubyte *procName);
#endif
#endif /* GLX_VERSION_1_4 */
#ifndef GLX_ARB_context_flush_control
#define GLX_ARB_context_flush_control 1
#define GLX_CONTEXT_RELEASE_BEHAVIOR_ARB 0x2097
#define GLX_CONTEXT_RELEASE_BEHAVIOR_NONE_ARB 0
#define GLX_CONTEXT_RELEASE_BEHAVIOR_FLUSH_ARB 0x2098
#endif /* GLX_ARB_context_flush_control */
#ifndef GLX_ARB_create_context
#define GLX_ARB_create_context 1
#define GLX_CONTEXT_DEBUG_BIT_ARB 0x00000001
@@ -297,23 +290,6 @@ void glXFreeContextEXT (Display *dpy, GLXContext context);
#endif
#endif /* GLX_EXT_import_context */
#ifndef GLX_EXT_stereo_tree
#define GLX_EXT_stereo_tree 1
typedef struct {
int type;
unsigned long serial;
Bool send_event;
Display *display;
int extension;
int evtype;
GLXDrawable window;
Bool stereo_tree;
} GLXStereoNotifyEventEXT;
#define GLX_STEREO_TREE_EXT 0x20F5
#define GLX_STEREO_NOTIFY_MASK_EXT 0x00000001
#define GLX_STEREO_NOTIFY_EXT 0x00000000
#endif /* GLX_EXT_stereo_tree */
#ifndef GLX_EXT_swap_control
#define GLX_EXT_swap_control 1
#define GLX_SWAP_INTERVAL_EXT 0x20F1
@@ -475,16 +451,6 @@ Bool glXSet3DfxModeMESA (int mode);
#endif
#endif /* GLX_MESA_set_3dfx_mode */
#ifndef GLX_NV_copy_buffer
#define GLX_NV_copy_buffer 1
typedef void ( *PFNGLXCOPYBUFFERSUBDATANVPROC) (Display *dpy, GLXContext readCtx, GLXContext writeCtx, GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size);
typedef void ( *PFNGLXNAMEDCOPYBUFFERSUBDATANVPROC) (Display *dpy, GLXContext readCtx, GLXContext writeCtx, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size);
#ifdef GLX_GLXEXT_PROTOTYPES
void glXCopyBufferSubDataNV (Display *dpy, GLXContext readCtx, GLXContext writeCtx, GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size);
void glXNamedCopyBufferSubDataNV (Display *dpy, GLXContext readCtx, GLXContext writeCtx, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size);
#endif
#endif /* GLX_NV_copy_buffer */
#ifndef GLX_NV_copy_image
#define GLX_NV_copy_image 1
typedef void ( *PFNGLXCOPYIMAGESUBDATANVPROC) (Display *dpy, GLXContext srcCtx, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLXContext dstCtx, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth);
@@ -561,8 +527,8 @@ void glXReleaseVideoCaptureDeviceNV (Display *dpy, GLXVideoCaptureDeviceNV devic
#endif
#endif /* GLX_NV_video_capture */
#ifndef GLX_NV_video_out
#define GLX_NV_video_out 1
#ifndef GLX_NV_video_output
#define GLX_NV_video_output 1
typedef unsigned int GLXVideoDeviceNV;
#define GLX_VIDEO_OUT_COLOR_NV 0x20C3
#define GLX_VIDEO_OUT_ALPHA_NV 0x20C4
@@ -588,7 +554,7 @@ int glXReleaseVideoImageNV (Display *dpy, GLXPbuffer pbuf);
int glXSendPbufferToVideoNV (Display *dpy, GLXPbuffer pbuf, int iBufferType, unsigned long *pulCounterPbuffer, GLboolean bBlock);
int glXGetVideoInfoNV (Display *dpy, int screen, GLXVideoDeviceNV VideoDevice, unsigned long *pulCounterOutputPbuffer, unsigned long *pulCounterOutputVideo);
#endif
#endif /* GLX_NV_video_out */
#endif /* GLX_NV_video_output */
#ifndef GLX_OML_swap_method
#define GLX_OML_swap_method 1

View File

@@ -85,7 +85,6 @@ typedef struct __DRIdri2ExtensionRec __DRIdri2Extension;
typedef struct __DRIdri2LoaderExtensionRec __DRIdri2LoaderExtension;
typedef struct __DRI2flushExtensionRec __DRI2flushExtension;
typedef struct __DRI2throttleExtensionRec __DRI2throttleExtension;
typedef struct __DRI2fenceExtensionRec __DRI2fenceExtension;
typedef struct __DRIimageLoaderExtensionRec __DRIimageLoaderExtension;
@@ -280,7 +279,6 @@ struct __DRItexBufferExtensionRec {
#define __DRI2_FLUSH_DRAWABLE (1 << 0) /* the drawable should be flushed. */
#define __DRI2_FLUSH_CONTEXT (1 << 1) /* glFlush should be called */
#define __DRI2_FLUSH_INVALIDATE_ANCILLARY (1 << 2)
enum __DRI2throttleReason {
__DRI2_THROTTLE_SWAPBUFFER,
@@ -340,65 +338,6 @@ struct __DRI2throttleExtensionRec {
enum __DRI2throttleReason reason);
};
/**
* Extension for fences / synchronization objects.
*/
#define __DRI2_FENCE "DRI2_Fence"
#define __DRI2_FENCE_VERSION 1
#define __DRI2_FENCE_TIMEOUT_INFINITE 0xffffffffffffffffllu
#define __DRI2_FENCE_FLAG_FLUSH_COMMANDS (1 << 0)
struct __DRI2fenceExtensionRec {
__DRIextension base;
/**
* Create and insert a fence into the command stream of the context.
*/
void *(*create_fence)(__DRIcontext *ctx);
/**
* Get a fence associated with the OpenCL event object.
* This can be NULL, meaning that OpenCL interoperability is not supported.
*/
void *(*get_fence_from_cl_event)(__DRIscreen *screen, intptr_t cl_event);
/**
* Destroy a fence.
*/
void (*destroy_fence)(__DRIscreen *screen, void *fence);
/**
* This function waits and doesn't return until the fence is signalled
* or the timeout expires. It returns true if the fence has been signaled.
*
* \param ctx the context where commands are flushed
* \param fence the fence
* \param flags a combination of __DRI2_FENCE_FLAG_xxx flags
* \param timeout the timeout in ns or __DRI2_FENCE_TIMEOUT_INFINITE
*/
GLboolean (*client_wait_sync)(__DRIcontext *ctx, void *fence,
unsigned flags, uint64_t timeout);
/**
* This function enqueues a wait command into the command stream of
* the context and then returns. When the execution reaches the wait
* command, no further execution will be done in the context until
* the fence is signaled. This is a no-op if the device doesn't support
* parallel execution of contexts.
*
* \param ctx the context where the waiting is done
* \param fence the fence
* \param flags a combination of __DRI2_FENCE_FLAG_xxx flags that make
* sense with this function (right now there are none)
*/
void (*server_wait_sync)(__DRIcontext *ctx, void *fence, unsigned flags);
};
/*@}*/
/**
@@ -1066,7 +1005,7 @@ struct __DRIdri2ExtensionRec {
* extensions.
*/
#define __DRI_IMAGE "DRI_IMAGE"
#define __DRI_IMAGE_VERSION 11
#define __DRI_IMAGE_VERSION 8
/**
* These formats correspond to the similarly named MESA_FORMAT_*
@@ -1157,8 +1096,6 @@ struct __DRIdri2ExtensionRec {
#define __DRI_IMAGE_ATTRIB_FD 0x2007 /* available in versions
* 7+. Each query will return a
* new fd. */
#define __DRI_IMAGE_ATTRIB_FOURCC 0x2008 /* available in versions 11 */
#define __DRI_IMAGE_ATTRIB_NUM_PLANES 0x2009 /* available in versions 11 */
enum __DRIYUVColorSpace {
__DRI_YUV_COLOR_SPACE_UNDEFINED = 0,
@@ -1180,8 +1117,7 @@ enum __DRIChromaSiting {
};
/**
* \name Reasons that __DRIimageExtensionRec::createImageFromTexture or
* __DRIimageExtensionRec::createImageFromDmaBufs might fail
* \name Reasons that __DRIimageExtensionRec::createImageFromTexture might fail
*/
/*@{*/
/** Success! */
@@ -1190,30 +1126,13 @@ enum __DRIChromaSiting {
/** Memory allocation failure */
#define __DRI_IMAGE_ERROR_BAD_ALLOC 1
/** Client requested an invalid attribute */
/** Client requested an invalid attribute for a texture object */
#define __DRI_IMAGE_ERROR_BAD_MATCH 2
/** Client requested an invalid texture object */
#define __DRI_IMAGE_ERROR_BAD_PARAMETER 3
/** Client requested an invalid pitch and/or offset */
#define __DRI_IMAGE_ERROR_BAD_ACCESS 4
/*@}*/
/**
* \name Capabilities that might be returned by __DRIimageExtensionRec::getCapabilities
*/
/*@{*/
#define __DRI_IMAGE_CAP_GLOBAL_NAMES 1
/*@}*/
/**
* blitImage flags
*/
#define __BLIT_FLAG_FLUSH 0x0001
#define __BLIT_FLAG_FINISH 0x0002
typedef struct __DRIimageRec __DRIimage;
typedef struct __DRIimageExtensionRec __DRIimageExtension;
struct __DRIimageExtensionRec {
@@ -1320,29 +1239,6 @@ struct __DRIimageExtensionRec {
enum __DRIChromaSiting vert_siting,
unsigned *error,
void *loaderPrivate);
/**
* Blit a part of a __DRIimage to another and flushes
*
* flush_flag:
* 0: no flush
* __BLIT_FLAG_FLUSH: flush after the blit operation
* __BLIT_FLAG_FINISH: flush and wait the blit finished
*
* \since 9
*/
void (*blitImage)(__DRIcontext *context, __DRIimage *dst, __DRIimage *src,
int dstx0, int dsty0, int dstwidth, int dstheight,
int srcx0, int srcy0, int srcwidth, int srcheight,
int flush_flag);
/**
* Query for general capabilities of the driver that concern
* buffer sharing and image importing.
*
* \since 10
*/
int (*getCapabilities)(__DRIscreen *screen);
};
@@ -1376,9 +1272,9 @@ typedef struct __DRI2configQueryExtensionRec __DRI2configQueryExtension;
struct __DRI2configQueryExtensionRec {
__DRIextension base;
int (*configQueryb)(__DRIscreen *screen, const char *var, unsigned char *val);
int (*configQueryi)(__DRIscreen *screen, const char *var, int *val);
int (*configQueryf)(__DRIscreen *screen, const char *var, float *val);
int (*configQueryb)(__DRIscreen *screen, const char *var, GLboolean *val);
int (*configQueryi)(__DRIscreen *screen, const char *var, GLint *val);
int (*configQueryf)(__DRIscreen *screen, const char *var, GLfloat *val);
};
/**

View File

@@ -1,5 +1,5 @@
/**
* \file dri_sarea.h
* \file sarea.h
* SAREA definitions.
*
* \author Kevin E. Martin <kevin@precisioninsight.com>

View File

@@ -41,8 +41,10 @@
* OSMesaGetIntegerv - return OSMesa state parameters
*
*
* The limits on the width and height of an image buffer can be retrieved
* via OSMesaGetIntegerv(OSMESA_MAX_WIDTH/OSMESA_MAX_HEIGHT).
* The limits on the width and height of an image buffer are MAX_WIDTH and
* MAX_HEIGHT as defined in Mesa/src/config.h. Defaults are 1280 and 1024.
* You can increase them as needed but beware that many temporary arrays in
* Mesa are dimensioned by MAX_WIDTH or MAX_HEIGHT.
*/

File diff suppressed because it is too large Load Diff

140
include/GL/wmesa.h Normal file
View File

@@ -0,0 +1,140 @@
/*
* Mesa 3-D graphics library
* Copyright (C) 1995-1998 Brian Paul
*
* This library is free software; you can redistribute it and/or
* modify it under the terms of the GNU Library General Public
* License as published by the Free Software Foundation; either
* version 2 of the License, or (at your option) any later version.
*
* This library is distributed in the hope that it will be useful,
* but WITHOUT ANY WARRANTY; without even the implied warranty of
* MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
* Library General Public License for more details.
*
* You should have received a copy of the GNU Library General Public
* License along with this library; if not, write to the Free
* Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
*
*/
/*
* Windows driver by: Mark E. Peterson (markp@ic.mankato.mn.us)
* Updated by Li Wei (liwei@aiar.xjtu.edu.cn)
*
*
***************************************************************
* WMesa *
* version 2.3 *
* *
* By *
* Li Wei *
* Institute of Artificial Intelligence & Robotics *
* Xi'an Jiaotong University *
* Email: liwei@aiar.xjtu.edu.cn *
* Web page: http://sun.aiar.xjtu.edu.cn *
* *
* July 7th, 1997 *
***************************************************************
*/
#ifndef WMESA_H
#define WMESA_H
#ifdef __cplusplus
extern "C" {
#endif
#include "GL/gl.h"
#if defined(_MSV_VER) && !defined(__GNUC__)
# pragma warning (disable:4273)
# pragma warning( disable : 4244 ) /* '=' : conversion from 'const double ' to 'float ', possible loss of data */
# pragma warning( disable : 4018 ) /* '<' : signed/unsigned mismatch */
# pragma warning( disable : 4305 ) /* '=' : truncation from 'const double ' to 'float ' */
# pragma warning( disable : 4013 ) /* 'function' undefined; assuming extern returning int */
# pragma warning( disable : 4761 ) /* integral size mismatch in argument; conversion supplied */
# pragma warning( disable : 4273 ) /* 'identifier' : inconsistent DLL linkage. dllexport assumed */
# if (MESA_WARNQUIET>1)
# pragma warning( disable : 4146 ) /* unary minus operator applied to unsigned type, result still unsigned */
# endif
#endif
/*
* This is the WMesa context 'handle':
*/
typedef struct wmesa_context *WMesaContext;
/*
* Create a new WMesaContext for rendering into a window. You must
* have already created the window of correct visual type and with an
* appropriate colormap.
*
* Input:
* hDC - Windows device or memory context
* Pal - Palette to use
* rgb_flag - GL_TRUE = RGB mode,
* GL_FALSE = color index mode
* db_flag - GL_TRUE = double-buffered,
* GL_FALSE = single buffered
* alpha_flag - GL_TRUE = create software alpha buffer,
* GL_FALSE = no software alpha buffer
*
* Note: Indexed mode requires double buffering under Windows.
*
* Return: a WMesa_context or NULL if error.
*/
extern WMesaContext WMesaCreateContext(HDC hDC,HPALETTE* pPal,
GLboolean rgb_flag,
GLboolean db_flag,
GLboolean alpha_flag);
/*
* Destroy a rendering context as returned by WMesaCreateContext()
*/
extern void WMesaDestroyContext( WMesaContext ctx );
/*
* Make the specified context the current one.
*/
extern void WMesaMakeCurrent( WMesaContext ctx, HDC hdc );
/*
* Return a handle to the current context.
*/
extern WMesaContext WMesaGetCurrentContext( void );
/*
* Swap the front and back buffers for the current context. No action
* taken if the context is not double buffered.
*/
extern void WMesaSwapBuffers(HDC hdc);
/*
* In indexed color mode we need to know when the palette changes.
*/
extern void WMesaPaletteChange(HPALETTE Pal);
extern void WMesaMove(void);
void WMesaShareLists(WMesaContext ctx_to_share, WMesaContext ctx);
#ifdef __cplusplus
}
#endif
#endif

View File

@@ -33,14 +33,14 @@ extern "C" {
** used to make the header, and the header can be found at
** http://www.opengl.org/registry/
**
** Khronos $Revision: 28335 $ on $Date: 2014-09-26 18:55:45 -0700 (Fri, 26 Sep 2014) $
** Khronos $Revision: 25922 $ on $Date: 2014-03-17 03:54:32 -0700 (Mon, 17 Mar 2014) $
*/
#ifndef GL_APIENTRYP
#define GL_APIENTRYP GL_APIENTRY*
#endif
/* Generated on date 20140926 */
/* Generated on date 20140317 */
/* Generated C header for:
* API: gles2
@@ -54,6 +54,7 @@ extern "C" {
#ifndef GL_KHR_blend_equation_advanced
#define GL_KHR_blend_equation_advanced 1
#define GL_BLEND_ADVANCED_COHERENT_KHR 0x9285
#define GL_MULTIPLY_KHR 0x9294
#define GL_SCREEN_KHR 0x9295
#define GL_OVERLAY_KHR 0x9296
@@ -75,17 +76,6 @@ GL_APICALL void GL_APIENTRY glBlendBarrierKHR (void);
#endif
#endif /* GL_KHR_blend_equation_advanced */
#ifndef GL_KHR_blend_equation_advanced_coherent
#define GL_KHR_blend_equation_advanced_coherent 1
#define GL_BLEND_ADVANCED_COHERENT_KHR 0x9285
#endif /* GL_KHR_blend_equation_advanced_coherent */
#ifndef GL_KHR_context_flush_control
#define GL_KHR_context_flush_control 1
#define GL_CONTEXT_RELEASE_BEHAVIOR_KHR 0x82FB
#define GL_CONTEXT_RELEASE_BEHAVIOR_FLUSH_KHR 0x82FC
#endif /* GL_KHR_context_flush_control */
#ifndef GL_KHR_debug
#define GL_KHR_debug 1
typedef void (GL_APIENTRY *GLDEBUGPROCKHR)(GLenum source,GLenum type,GLuint id,GLenum severity,GLsizei length,const GLchar *message,const void *userParam);
@@ -155,34 +145,6 @@ GL_APICALL void GL_APIENTRY glGetPointervKHR (GLenum pname, void **params);
#endif
#endif /* GL_KHR_debug */
#ifndef GL_KHR_robust_buffer_access_behavior
#define GL_KHR_robust_buffer_access_behavior 1
#endif /* GL_KHR_robust_buffer_access_behavior */
#ifndef GL_KHR_robustness
#define GL_KHR_robustness 1
#define GL_CONTEXT_ROBUST_ACCESS_KHR 0x90F3
#define GL_LOSE_CONTEXT_ON_RESET_KHR 0x8252
#define GL_GUILTY_CONTEXT_RESET_KHR 0x8253
#define GL_INNOCENT_CONTEXT_RESET_KHR 0x8254
#define GL_UNKNOWN_CONTEXT_RESET_KHR 0x8255
#define GL_RESET_NOTIFICATION_STRATEGY_KHR 0x8256
#define GL_NO_RESET_NOTIFICATION_KHR 0x8261
#define GL_CONTEXT_LOST_KHR 0x0507
typedef GLenum (GL_APIENTRYP PFNGLGETGRAPHICSRESETSTATUSKHRPROC) (void);
typedef void (GL_APIENTRYP PFNGLREADNPIXELSKHRPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data);
typedef void (GL_APIENTRYP PFNGLGETNUNIFORMFVKHRPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat *params);
typedef void (GL_APIENTRYP PFNGLGETNUNIFORMIVKHRPROC) (GLuint program, GLint location, GLsizei bufSize, GLint *params);
typedef void (GL_APIENTRYP PFNGLGETNUNIFORMUIVKHRPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint *params);
#ifdef GL_GLEXT_PROTOTYPES
GL_APICALL GLenum GL_APIENTRY glGetGraphicsResetStatusKHR (void);
GL_APICALL void GL_APIENTRY glReadnPixelsKHR (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data);
GL_APICALL void GL_APIENTRY glGetnUniformfvKHR (GLuint program, GLint location, GLsizei bufSize, GLfloat *params);
GL_APICALL void GL_APIENTRY glGetnUniformivKHR (GLuint program, GLint location, GLsizei bufSize, GLint *params);
GL_APICALL void GL_APIENTRY glGetnUniformuivKHR (GLuint program, GLint location, GLsizei bufSize, GLuint *params);
#endif
#endif /* GL_KHR_robustness */
#ifndef GL_KHR_texture_compression_astc_hdr
#define GL_KHR_texture_compression_astc_hdr 1
#define GL_COMPRESSED_RGBA_ASTC_4x4_KHR 0x93B0
@@ -238,10 +200,6 @@ GL_APICALL void GL_APIENTRY glEGLImageTargetRenderbufferStorageOES (GLenum targe
#define GL_SAMPLER_EXTERNAL_OES 0x8D66
#endif /* GL_OES_EGL_image_external */
#ifndef GL_OES_compressed_ETC1_RGB8_sub_texture
#define GL_OES_compressed_ETC1_RGB8_sub_texture 1
#endif /* GL_OES_compressed_ETC1_RGB8_sub_texture */
#ifndef GL_OES_compressed_ETC1_RGB8_texture
#define GL_OES_compressed_ETC1_RGB8_texture 1
#define GL_ETC1_RGB8_OES 0x8D64
@@ -554,10 +512,6 @@ GL_APICALL void GL_APIENTRY glGetPerfMonitorCounterDataAMD (GLuint monitor, GLen
#define GL_Z400_BINARY_AMD 0x8740
#endif /* GL_AMD_program_binary_Z400 */
#ifndef GL_ANDROID_extension_pack_es31a
#define GL_ANDROID_extension_pack_es31a 1
#endif /* GL_ANDROID_extension_pack_es31a */
#ifndef GL_ANGLE_depth_texture
#define GL_ANGLE_depth_texture 1
#endif /* GL_ANGLE_depth_texture */
@@ -633,23 +587,6 @@ GL_APICALL void GL_APIENTRY glGetTranslatedShaderSourceANGLE (GLuint shader, GLs
#endif
#endif /* GL_ANGLE_translated_shader_source */
#ifndef GL_APPLE_clip_distance
#define GL_APPLE_clip_distance 1
#define GL_MAX_CLIP_DISTANCES_APPLE 0x0D32
#define GL_CLIP_DISTANCE0_APPLE 0x3000
#define GL_CLIP_DISTANCE1_APPLE 0x3001
#define GL_CLIP_DISTANCE2_APPLE 0x3002
#define GL_CLIP_DISTANCE3_APPLE 0x3003
#define GL_CLIP_DISTANCE4_APPLE 0x3004
#define GL_CLIP_DISTANCE5_APPLE 0x3005
#define GL_CLIP_DISTANCE6_APPLE 0x3006
#define GL_CLIP_DISTANCE7_APPLE 0x3007
#endif /* GL_APPLE_clip_distance */
#ifndef GL_APPLE_color_buffer_packed_float
#define GL_APPLE_color_buffer_packed_float 1
#endif /* GL_APPLE_color_buffer_packed_float */
#ifndef GL_APPLE_copy_texture_levels
#define GL_APPLE_copy_texture_levels 1
typedef void (GL_APIENTRYP PFNGLCOPYTEXTURELEVELSAPPLEPROC) (GLuint destinationTexture, GLuint sourceTexture, GLint sourceBaseLevel, GLsizei sourceLevelCount);
@@ -730,14 +667,6 @@ GL_APICALL void GL_APIENTRY glGetSyncivAPPLE (GLsync sync, GLenum pname, GLsizei
#define GL_TEXTURE_MAX_LEVEL_APPLE 0x813D
#endif /* GL_APPLE_texture_max_level */
#ifndef GL_APPLE_texture_packed_float
#define GL_APPLE_texture_packed_float 1
#define GL_UNSIGNED_INT_10F_11F_11F_REV_APPLE 0x8C3B
#define GL_UNSIGNED_INT_5_9_9_9_REV_APPLE 0x8C3E
#define GL_R11F_G11F_B10F_APPLE 0x8C3A
#define GL_RGB9_E5_APPLE 0x8C3D
#endif /* GL_APPLE_texture_packed_float */
#ifndef GL_ARM_mali_program_binary
#define GL_ARM_mali_program_binary 1
#define GL_MALI_PROGRAM_BINARY_ARM 0x8F61
@@ -762,13 +691,6 @@ GL_APICALL void GL_APIENTRY glGetSyncivAPPLE (GLsync sync, GLenum pname, GLsizei
#define GL_ARM_shader_framebuffer_fetch_depth_stencil 1
#endif /* GL_ARM_shader_framebuffer_fetch_depth_stencil */
#ifndef GL_DMP_program_binary
#define GL_DMP_program_binary 1
#define GL_SMAPHS30_PROGRAM_BINARY_DMP 0x9251
#define GL_SMAPHS_PROGRAM_BINARY_DMP 0x9252
#define GL_DMP_PROGRAM_BINARY_DMP 0x9253
#endif /* GL_DMP_program_binary */
#ifndef GL_DMP_shader_binary
#define GL_DMP_shader_binary 1
#define GL_SHADER_BINARY_DMP 0x9250
@@ -790,14 +712,6 @@ GL_APICALL void GL_APIENTRY glGetSyncivAPPLE (GLsync sync, GLenum pname, GLsizei
#define GL_UNSIGNED_NORMALIZED_EXT 0x8C17
#endif /* GL_EXT_color_buffer_half_float */
#ifndef GL_EXT_copy_image
#define GL_EXT_copy_image 1
typedef void (GL_APIENTRYP PFNGLCOPYIMAGESUBDATAEXTPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth);
#ifdef GL_GLEXT_PROTOTYPES
GL_APICALL void GL_APIENTRY glCopyImageSubDataEXT (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth);
#endif
#endif /* GL_EXT_copy_image */
#ifndef GL_EXT_debug_label
#define GL_EXT_debug_label 1
#define GL_PROGRAM_PIPELINE_OBJECT_EXT 0x8A4F
@@ -915,30 +829,6 @@ GL_APICALL void GL_APIENTRY glDrawBuffersEXT (GLsizei n, const GLenum *bufs);
#endif
#endif /* GL_EXT_draw_buffers */
#ifndef GL_EXT_draw_buffers_indexed
#define GL_EXT_draw_buffers_indexed 1
#define GL_MIN 0x8007
#define GL_MAX 0x8008
typedef void (GL_APIENTRYP PFNGLENABLEIEXTPROC) (GLenum target, GLuint index);
typedef void (GL_APIENTRYP PFNGLDISABLEIEXTPROC) (GLenum target, GLuint index);
typedef void (GL_APIENTRYP PFNGLBLENDEQUATIONIEXTPROC) (GLuint buf, GLenum mode);
typedef void (GL_APIENTRYP PFNGLBLENDEQUATIONSEPARATEIEXTPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha);
typedef void (GL_APIENTRYP PFNGLBLENDFUNCIEXTPROC) (GLuint buf, GLenum src, GLenum dst);
typedef void (GL_APIENTRYP PFNGLBLENDFUNCSEPARATEIEXTPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha);
typedef void (GL_APIENTRYP PFNGLCOLORMASKIEXTPROC) (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a);
typedef GLboolean (GL_APIENTRYP PFNGLISENABLEDIEXTPROC) (GLenum target, GLuint index);
#ifdef GL_GLEXT_PROTOTYPES
GL_APICALL void GL_APIENTRY glEnableiEXT (GLenum target, GLuint index);
GL_APICALL void GL_APIENTRY glDisableiEXT (GLenum target, GLuint index);
GL_APICALL void GL_APIENTRY glBlendEquationiEXT (GLuint buf, GLenum mode);
GL_APICALL void GL_APIENTRY glBlendEquationSeparateiEXT (GLuint buf, GLenum modeRGB, GLenum modeAlpha);
GL_APICALL void GL_APIENTRY glBlendFunciEXT (GLuint buf, GLenum src, GLenum dst);
GL_APICALL void GL_APIENTRY glBlendFuncSeparateiEXT (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha);
GL_APICALL void GL_APIENTRY glColorMaskiEXT (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a);
GL_APICALL GLboolean GL_APIENTRY glIsEnablediEXT (GLenum target, GLuint index);
#endif
#endif /* GL_EXT_draw_buffers_indexed */
#ifndef GL_EXT_draw_instanced
#define GL_EXT_draw_instanced 1
typedef void (GL_APIENTRYP PFNGLDRAWARRAYSINSTANCEDEXTPROC) (GLenum mode, GLint start, GLsizei count, GLsizei primcount);
@@ -949,55 +839,6 @@ GL_APICALL void GL_APIENTRY glDrawElementsInstancedEXT (GLenum mode, GLsizei cou
#endif
#endif /* GL_EXT_draw_instanced */
#ifndef GL_EXT_geometry_point_size
#define GL_EXT_geometry_point_size 1
#endif /* GL_EXT_geometry_point_size */
#ifndef GL_EXT_geometry_shader
#define GL_EXT_geometry_shader 1
#define GL_GEOMETRY_SHADER_EXT 0x8DD9
#define GL_GEOMETRY_SHADER_BIT_EXT 0x00000004
#define GL_GEOMETRY_LINKED_VERTICES_OUT_EXT 0x8916
#define GL_GEOMETRY_LINKED_INPUT_TYPE_EXT 0x8917
#define GL_GEOMETRY_LINKED_OUTPUT_TYPE_EXT 0x8918
#define GL_GEOMETRY_SHADER_INVOCATIONS_EXT 0x887F
#define GL_LAYER_PROVOKING_VERTEX_EXT 0x825E
#define GL_LINES_ADJACENCY_EXT 0x000A
#define GL_LINE_STRIP_ADJACENCY_EXT 0x000B
#define GL_TRIANGLES_ADJACENCY_EXT 0x000C
#define GL_TRIANGLE_STRIP_ADJACENCY_EXT 0x000D
#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS_EXT 0x8DDF
#define GL_MAX_GEOMETRY_UNIFORM_BLOCKS_EXT 0x8A2C
#define GL_MAX_COMBINED_GEOMETRY_UNIFORM_COMPONENTS_EXT 0x8A32
#define GL_MAX_GEOMETRY_INPUT_COMPONENTS_EXT 0x9123
#define GL_MAX_GEOMETRY_OUTPUT_COMPONENTS_EXT 0x9124
#define GL_MAX_GEOMETRY_OUTPUT_VERTICES_EXT 0x8DE0
#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS_EXT 0x8DE1
#define GL_MAX_GEOMETRY_SHADER_INVOCATIONS_EXT 0x8E5A
#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_EXT 0x8C29
#define GL_MAX_GEOMETRY_ATOMIC_COUNTER_BUFFERS_EXT 0x92CF
#define GL_MAX_GEOMETRY_ATOMIC_COUNTERS_EXT 0x92D5
#define GL_MAX_GEOMETRY_IMAGE_UNIFORMS_EXT 0x90CD
#define GL_MAX_GEOMETRY_SHADER_STORAGE_BLOCKS_EXT 0x90D7
#define GL_FIRST_VERTEX_CONVENTION_EXT 0x8E4D
#define GL_LAST_VERTEX_CONVENTION_EXT 0x8E4E
#define GL_UNDEFINED_VERTEX_EXT 0x8260
#define GL_PRIMITIVES_GENERATED_EXT 0x8C87
#define GL_FRAMEBUFFER_DEFAULT_LAYERS_EXT 0x9312
#define GL_MAX_FRAMEBUFFER_LAYERS_EXT 0x9317
#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_EXT 0x8DA8
#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED_EXT 0x8DA7
#define GL_REFERENCED_BY_GEOMETRY_SHADER_EXT 0x9309
typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERTEXTUREEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level);
#ifdef GL_GLEXT_PROTOTYPES
GL_APICALL void GL_APIENTRY glFramebufferTextureEXT (GLenum target, GLenum attachment, GLuint texture, GLint level);
#endif
#endif /* GL_EXT_geometry_shader */
#ifndef GL_EXT_gpu_shader5
#define GL_EXT_gpu_shader5 1
#endif /* GL_EXT_gpu_shader5 */
#ifndef GL_EXT_instanced_arrays
#define GL_EXT_instanced_arrays 1
#define GL_VERTEX_ATTRIB_ARRAY_DIVISOR_EXT 0x88FE
@@ -1070,23 +911,12 @@ GL_APICALL void GL_APIENTRY glGetIntegeri_vEXT (GLenum target, GLuint index, GLi
#define GL_ANY_SAMPLES_PASSED_CONSERVATIVE_EXT 0x8D6A
#endif /* GL_EXT_occlusion_query_boolean */
#ifndef GL_EXT_primitive_bounding_box
#define GL_EXT_primitive_bounding_box 1
#define GL_PRIMITIVE_BOUNDING_BOX_EXT 0x92BE
typedef void (GL_APIENTRYP PFNGLPRIMITIVEBOUNDINGBOXEXTPROC) (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW);
#ifdef GL_GLEXT_PROTOTYPES
GL_APICALL void GL_APIENTRY glPrimitiveBoundingBoxEXT (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW);
#endif
#endif /* GL_EXT_primitive_bounding_box */
#ifndef GL_EXT_pvrtc_sRGB
#define GL_EXT_pvrtc_sRGB 1
#define GL_COMPRESSED_SRGB_PVRTC_2BPPV1_EXT 0x8A54
#define GL_COMPRESSED_SRGB_PVRTC_4BPPV1_EXT 0x8A55
#define GL_COMPRESSED_SRGB_ALPHA_PVRTC_2BPPV1_EXT 0x8A56
#define GL_COMPRESSED_SRGB_ALPHA_PVRTC_4BPPV1_EXT 0x8A57
#define GL_COMPRESSED_SRGB_ALPHA_PVRTC_2BPPV2_IMG 0x93F0
#define GL_COMPRESSED_SRGB_ALPHA_PVRTC_4BPPV2_IMG 0x93F1
#endif /* GL_EXT_pvrtc_sRGB */
#ifndef GL_EXT_read_format_bgra
@@ -1234,18 +1064,10 @@ GL_APICALL void GL_APIENTRY glProgramUniformMatrix4x3fvEXT (GLuint program, GLin
#define GL_FRAGMENT_SHADER_DISCARDS_SAMPLES_EXT 0x8A52
#endif /* GL_EXT_shader_framebuffer_fetch */
#ifndef GL_EXT_shader_implicit_conversions
#define GL_EXT_shader_implicit_conversions 1
#endif /* GL_EXT_shader_implicit_conversions */
#ifndef GL_EXT_shader_integer_mix
#define GL_EXT_shader_integer_mix 1
#endif /* GL_EXT_shader_integer_mix */
#ifndef GL_EXT_shader_io_blocks
#define GL_EXT_shader_io_blocks 1
#endif /* GL_EXT_shader_io_blocks */
#ifndef GL_EXT_shader_pixel_local_storage
#define GL_EXT_shader_pixel_local_storage 1
#define GL_MAX_SHADER_PIXEL_LOCAL_STORAGE_FAST_SIZE_EXT 0x8F63
@@ -1265,109 +1087,6 @@ GL_APICALL void GL_APIENTRY glProgramUniformMatrix4x3fvEXT (GLuint program, GLin
#define GL_SAMPLER_2D_SHADOW_EXT 0x8B62
#endif /* GL_EXT_shadow_samplers */
#ifndef GL_EXT_tessellation_point_size
#define GL_EXT_tessellation_point_size 1
#endif /* GL_EXT_tessellation_point_size */
#ifndef GL_EXT_tessellation_shader
#define GL_EXT_tessellation_shader 1
#define GL_PATCHES_EXT 0x000E
#define GL_PATCH_VERTICES_EXT 0x8E72
#define GL_TESS_CONTROL_OUTPUT_VERTICES_EXT 0x8E75
#define GL_TESS_GEN_MODE_EXT 0x8E76
#define GL_TESS_GEN_SPACING_EXT 0x8E77
#define GL_TESS_GEN_VERTEX_ORDER_EXT 0x8E78
#define GL_TESS_GEN_POINT_MODE_EXT 0x8E79
#define GL_ISOLINES_EXT 0x8E7A
#define GL_QUADS_EXT 0x0007
#define GL_FRACTIONAL_ODD_EXT 0x8E7B
#define GL_FRACTIONAL_EVEN_EXT 0x8E7C
#define GL_MAX_PATCH_VERTICES_EXT 0x8E7D
#define GL_MAX_TESS_GEN_LEVEL_EXT 0x8E7E
#define GL_MAX_TESS_CONTROL_UNIFORM_COMPONENTS_EXT 0x8E7F
#define GL_MAX_TESS_EVALUATION_UNIFORM_COMPONENTS_EXT 0x8E80
#define GL_MAX_TESS_CONTROL_TEXTURE_IMAGE_UNITS_EXT 0x8E81
#define GL_MAX_TESS_EVALUATION_TEXTURE_IMAGE_UNITS_EXT 0x8E82
#define GL_MAX_TESS_CONTROL_OUTPUT_COMPONENTS_EXT 0x8E83
#define GL_MAX_TESS_PATCH_COMPONENTS_EXT 0x8E84
#define GL_MAX_TESS_CONTROL_TOTAL_OUTPUT_COMPONENTS_EXT 0x8E85
#define GL_MAX_TESS_EVALUATION_OUTPUT_COMPONENTS_EXT 0x8E86
#define GL_MAX_TESS_CONTROL_UNIFORM_BLOCKS_EXT 0x8E89
#define GL_MAX_TESS_EVALUATION_UNIFORM_BLOCKS_EXT 0x8E8A
#define GL_MAX_TESS_CONTROL_INPUT_COMPONENTS_EXT 0x886C
#define GL_MAX_TESS_EVALUATION_INPUT_COMPONENTS_EXT 0x886D
#define GL_MAX_COMBINED_TESS_CONTROL_UNIFORM_COMPONENTS_EXT 0x8E1E
#define GL_MAX_COMBINED_TESS_EVALUATION_UNIFORM_COMPONENTS_EXT 0x8E1F
#define GL_MAX_TESS_CONTROL_ATOMIC_COUNTER_BUFFERS_EXT 0x92CD
#define GL_MAX_TESS_EVALUATION_ATOMIC_COUNTER_BUFFERS_EXT 0x92CE
#define GL_MAX_TESS_CONTROL_ATOMIC_COUNTERS_EXT 0x92D3
#define GL_MAX_TESS_EVALUATION_ATOMIC_COUNTERS_EXT 0x92D4
#define GL_MAX_TESS_CONTROL_IMAGE_UNIFORMS_EXT 0x90CB
#define GL_MAX_TESS_EVALUATION_IMAGE_UNIFORMS_EXT 0x90CC
#define GL_MAX_TESS_CONTROL_SHADER_STORAGE_BLOCKS_EXT 0x90D8
#define GL_MAX_TESS_EVALUATION_SHADER_STORAGE_BLOCKS_EXT 0x90D9
#define GL_PRIMITIVE_RESTART_FOR_PATCHES_SUPPORTED 0x8221
#define GL_IS_PER_PATCH_EXT 0x92E7
#define GL_REFERENCED_BY_TESS_CONTROL_SHADER_EXT 0x9307
#define GL_REFERENCED_BY_TESS_EVALUATION_SHADER_EXT 0x9308
#define GL_TESS_CONTROL_SHADER_EXT 0x8E88
#define GL_TESS_EVALUATION_SHADER_EXT 0x8E87
#define GL_TESS_CONTROL_SHADER_BIT_EXT 0x00000008
#define GL_TESS_EVALUATION_SHADER_BIT_EXT 0x00000010
typedef void (GL_APIENTRYP PFNGLPATCHPARAMETERIEXTPROC) (GLenum pname, GLint value);
#ifdef GL_GLEXT_PROTOTYPES
GL_APICALL void GL_APIENTRY glPatchParameteriEXT (GLenum pname, GLint value);
#endif
#endif /* GL_EXT_tessellation_shader */
#ifndef GL_EXT_texture_border_clamp
#define GL_EXT_texture_border_clamp 1
#define GL_TEXTURE_BORDER_COLOR_EXT 0x1004
#define GL_CLAMP_TO_BORDER_EXT 0x812D
typedef void (GL_APIENTRYP PFNGLTEXPARAMETERIIVEXTPROC) (GLenum target, GLenum pname, const GLint *params);
typedef void (GL_APIENTRYP PFNGLTEXPARAMETERIUIVEXTPROC) (GLenum target, GLenum pname, const GLuint *params);
typedef void (GL_APIENTRYP PFNGLGETTEXPARAMETERIIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (GL_APIENTRYP PFNGLGETTEXPARAMETERIUIVEXTPROC) (GLenum target, GLenum pname, GLuint *params);
typedef void (GL_APIENTRYP PFNGLSAMPLERPARAMETERIIVEXTPROC) (GLuint sampler, GLenum pname, const GLint *param);
typedef void (GL_APIENTRYP PFNGLSAMPLERPARAMETERIUIVEXTPROC) (GLuint sampler, GLenum pname, const GLuint *param);
typedef void (GL_APIENTRYP PFNGLGETSAMPLERPARAMETERIIVEXTPROC) (GLuint sampler, GLenum pname, GLint *params);
typedef void (GL_APIENTRYP PFNGLGETSAMPLERPARAMETERIUIVEXTPROC) (GLuint sampler, GLenum pname, GLuint *params);
#ifdef GL_GLEXT_PROTOTYPES
GL_APICALL void GL_APIENTRY glTexParameterIivEXT (GLenum target, GLenum pname, const GLint *params);
GL_APICALL void GL_APIENTRY glTexParameterIuivEXT (GLenum target, GLenum pname, const GLuint *params);
GL_APICALL void GL_APIENTRY glGetTexParameterIivEXT (GLenum target, GLenum pname, GLint *params);
GL_APICALL void GL_APIENTRY glGetTexParameterIuivEXT (GLenum target, GLenum pname, GLuint *params);
GL_APICALL void GL_APIENTRY glSamplerParameterIivEXT (GLuint sampler, GLenum pname, const GLint *param);
GL_APICALL void GL_APIENTRY glSamplerParameterIuivEXT (GLuint sampler, GLenum pname, const GLuint *param);
GL_APICALL void GL_APIENTRY glGetSamplerParameterIivEXT (GLuint sampler, GLenum pname, GLint *params);
GL_APICALL void GL_APIENTRY glGetSamplerParameterIuivEXT (GLuint sampler, GLenum pname, GLuint *params);
#endif
#endif /* GL_EXT_texture_border_clamp */
#ifndef GL_EXT_texture_buffer
#define GL_EXT_texture_buffer 1
#define GL_TEXTURE_BUFFER_EXT 0x8C2A
#define GL_TEXTURE_BUFFER_BINDING_EXT 0x8C2A
#define GL_MAX_TEXTURE_BUFFER_SIZE_EXT 0x8C2B
#define GL_TEXTURE_BINDING_BUFFER_EXT 0x8C2C
#define GL_TEXTURE_BUFFER_DATA_STORE_BINDING_EXT 0x8C2D
#define GL_TEXTURE_BUFFER_OFFSET_ALIGNMENT_EXT 0x919F
#define GL_SAMPLER_BUFFER_EXT 0x8DC2
#define GL_INT_SAMPLER_BUFFER_EXT 0x8DD0
#define GL_UNSIGNED_INT_SAMPLER_BUFFER_EXT 0x8DD8
#define GL_IMAGE_BUFFER_EXT 0x9051
#define GL_INT_IMAGE_BUFFER_EXT 0x905C
#define GL_UNSIGNED_INT_IMAGE_BUFFER_EXT 0x9067
#define GL_TEXTURE_BUFFER_OFFSET_EXT 0x919D
#define GL_TEXTURE_BUFFER_SIZE_EXT 0x919E
typedef void (GL_APIENTRYP PFNGLTEXBUFFEREXTPROC) (GLenum target, GLenum internalformat, GLuint buffer);
typedef void (GL_APIENTRYP PFNGLTEXBUFFERRANGEEXTPROC) (GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size);
#ifdef GL_GLEXT_PROTOTYPES
GL_APICALL void GL_APIENTRY glTexBufferEXT (GLenum target, GLenum internalformat, GLuint buffer);
GL_APICALL void GL_APIENTRY glTexBufferRangeEXT (GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size);
#endif
#endif /* GL_EXT_texture_buffer */
#ifndef GL_EXT_texture_compression_dxt1
#define GL_EXT_texture_compression_dxt1 1
#define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0
@@ -1380,19 +1099,6 @@ GL_APICALL void GL_APIENTRY glTexBufferRangeEXT (GLenum target, GLenum internalf
#define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT 0x83F3
#endif /* GL_EXT_texture_compression_s3tc */
#ifndef GL_EXT_texture_cube_map_array
#define GL_EXT_texture_cube_map_array 1
#define GL_TEXTURE_CUBE_MAP_ARRAY_EXT 0x9009
#define GL_TEXTURE_BINDING_CUBE_MAP_ARRAY_EXT 0x900A
#define GL_SAMPLER_CUBE_MAP_ARRAY_EXT 0x900C
#define GL_SAMPLER_CUBE_MAP_ARRAY_SHADOW_EXT 0x900D
#define GL_INT_SAMPLER_CUBE_MAP_ARRAY_EXT 0x900E
#define GL_UNSIGNED_INT_SAMPLER_CUBE_MAP_ARRAY_EXT 0x900F
#define GL_IMAGE_CUBE_MAP_ARRAY_EXT 0x9054
#define GL_INT_IMAGE_CUBE_MAP_ARRAY_EXT 0x905F
#define GL_UNSIGNED_INT_IMAGE_CUBE_MAP_ARRAY_EXT 0x906A
#endif /* GL_EXT_texture_cube_map_array */
#ifndef GL_EXT_texture_filter_anisotropic
#define GL_EXT_texture_filter_anisotropic 1
#define GL_TEXTURE_MAX_ANISOTROPY_EXT 0x84FE
@@ -1455,19 +1161,6 @@ GL_APICALL void GL_APIENTRY glTextureStorage3DEXT (GLuint texture, GLenum target
#define GL_UNSIGNED_INT_2_10_10_10_REV_EXT 0x8368
#endif /* GL_EXT_texture_type_2_10_10_10_REV */
#ifndef GL_EXT_texture_view
#define GL_EXT_texture_view 1
#define GL_TEXTURE_VIEW_MIN_LEVEL_EXT 0x82DB
#define GL_TEXTURE_VIEW_NUM_LEVELS_EXT 0x82DC
#define GL_TEXTURE_VIEW_MIN_LAYER_EXT 0x82DD
#define GL_TEXTURE_VIEW_NUM_LAYERS_EXT 0x82DE
#define GL_TEXTURE_IMMUTABLE_LEVELS 0x82DF
typedef void (GL_APIENTRYP PFNGLTEXTUREVIEWEXTPROC) (GLuint texture, GLenum target, GLuint origtexture, GLenum internalformat, GLuint minlevel, GLuint numlevels, GLuint minlayer, GLuint numlayers);
#ifdef GL_GLEXT_PROTOTYPES
GL_APICALL void GL_APIENTRY glTextureViewEXT (GLuint texture, GLenum target, GLuint origtexture, GLenum internalformat, GLuint minlevel, GLuint numlevels, GLuint minlayer, GLuint numlayers);
#endif
#endif /* GL_EXT_texture_view */
#ifndef GL_EXT_unpack_subimage
#define GL_EXT_unpack_subimage 1
#define GL_UNPACK_ROW_LENGTH_EXT 0x0CF2

View File

@@ -7,4 +7,4 @@
// Projects needing GL/glu.h and GL/glut.h should now
// include these headers independently as glu and glut
// are no longer core parts of mesa
// are no longe core parts of mesa

746
include/VG/openvg.h Normal file
View File

@@ -0,0 +1,746 @@
/* $Revision: 9203 $ on $Date:: 2009-10-07 02:21:52 -0700 #$ */
/*------------------------------------------------------------------------
*
* OpenVG 1.1 Reference Implementation
* -------------------------------------
*
* Copyright (c) 2008 The Khronos Group Inc.
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and /or associated documentation files
* (the "Materials "), to deal in the Materials without restriction,
* including without limitation the rights to use, copy, modify, merge,
* publish, distribute, sublicense, and/or sell copies of the Materials,
* and to permit persons to whom the Materials are furnished to do so,
* subject to the following conditions:
*
* The above copyright notice and this permission notice shall be included
* in all copies or substantial portions of the Materials.
*
* THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
* IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
* DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
* OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
* THE USE OR OTHER DEALINGS IN THE MATERIALS.
*
*//**
* \file
* \brief OpenVG 1.1 API.
*//*-------------------------------------------------------------------*/
#ifndef _OPENVG_H
#define _OPENVG_H
#include <VG/vgplatform.h>
#ifdef __cplusplus
extern "C" {
#endif
#define OPENVG_VERSION_1_0 1
#define OPENVG_VERSION_1_0_1 1
#define OPENVG_VERSION_1_1 2
#ifndef VG_MAXSHORT
#define VG_MAXSHORT 0x7FFF
#endif
#ifndef VG_MAXINT
#define VG_MAXINT 0x7FFFFFFF
#endif
#ifndef VG_MAX_ENUM
#define VG_MAX_ENUM 0x7FFFFFFF
#endif
typedef VGuint VGHandle;
typedef VGHandle VGPath;
typedef VGHandle VGImage;
typedef VGHandle VGMaskLayer;
typedef VGHandle VGFont;
typedef VGHandle VGPaint;
#define VG_INVALID_HANDLE ((VGHandle)0)
typedef enum {
VG_FALSE = 0,
VG_TRUE = 1,
VG_BOOLEAN_FORCE_SIZE = VG_MAX_ENUM
} VGboolean;
typedef enum {
VG_NO_ERROR = 0,
VG_BAD_HANDLE_ERROR = 0x1000,
VG_ILLEGAL_ARGUMENT_ERROR = 0x1001,
VG_OUT_OF_MEMORY_ERROR = 0x1002,
VG_PATH_CAPABILITY_ERROR = 0x1003,
VG_UNSUPPORTED_IMAGE_FORMAT_ERROR = 0x1004,
VG_UNSUPPORTED_PATH_FORMAT_ERROR = 0x1005,
VG_IMAGE_IN_USE_ERROR = 0x1006,
VG_NO_CONTEXT_ERROR = 0x1007,
VG_ERROR_CODE_FORCE_SIZE = VG_MAX_ENUM
} VGErrorCode;
typedef enum {
/* Mode settings */
VG_MATRIX_MODE = 0x1100,
VG_FILL_RULE = 0x1101,
VG_IMAGE_QUALITY = 0x1102,
VG_RENDERING_QUALITY = 0x1103,
VG_BLEND_MODE = 0x1104,
VG_IMAGE_MODE = 0x1105,
/* Scissoring rectangles */
VG_SCISSOR_RECTS = 0x1106,
/* Color Transformation */
VG_COLOR_TRANSFORM = 0x1170,
VG_COLOR_TRANSFORM_VALUES = 0x1171,
/* Stroke parameters */
VG_STROKE_LINE_WIDTH = 0x1110,
VG_STROKE_CAP_STYLE = 0x1111,
VG_STROKE_JOIN_STYLE = 0x1112,
VG_STROKE_MITER_LIMIT = 0x1113,
VG_STROKE_DASH_PATTERN = 0x1114,
VG_STROKE_DASH_PHASE = 0x1115,
VG_STROKE_DASH_PHASE_RESET = 0x1116,
/* Edge fill color for VG_TILE_FILL tiling mode */
VG_TILE_FILL_COLOR = 0x1120,
/* Color for vgClear */
VG_CLEAR_COLOR = 0x1121,
/* Glyph origin */
VG_GLYPH_ORIGIN = 0x1122,
/* Enable/disable alpha masking and scissoring */
VG_MASKING = 0x1130,
VG_SCISSORING = 0x1131,
/* Pixel layout information */
VG_PIXEL_LAYOUT = 0x1140,
VG_SCREEN_LAYOUT = 0x1141,
/* Source format selection for image filters */
VG_FILTER_FORMAT_LINEAR = 0x1150,
VG_FILTER_FORMAT_PREMULTIPLIED = 0x1151,
/* Destination write enable mask for image filters */
VG_FILTER_CHANNEL_MASK = 0x1152,
/* Implementation limits (read-only) */
VG_MAX_SCISSOR_RECTS = 0x1160,
VG_MAX_DASH_COUNT = 0x1161,
VG_MAX_KERNEL_SIZE = 0x1162,
VG_MAX_SEPARABLE_KERNEL_SIZE = 0x1163,
VG_MAX_COLOR_RAMP_STOPS = 0x1164,
VG_MAX_IMAGE_WIDTH = 0x1165,
VG_MAX_IMAGE_HEIGHT = 0x1166,
VG_MAX_IMAGE_PIXELS = 0x1167,
VG_MAX_IMAGE_BYTES = 0x1168,
VG_MAX_FLOAT = 0x1169,
VG_MAX_GAUSSIAN_STD_DEVIATION = 0x116A,
VG_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGParamType;
typedef enum {
VG_RENDERING_QUALITY_NONANTIALIASED = 0x1200,
VG_RENDERING_QUALITY_FASTER = 0x1201,
VG_RENDERING_QUALITY_BETTER = 0x1202, /* Default */
VG_RENDERING_QUALITY_FORCE_SIZE = VG_MAX_ENUM
} VGRenderingQuality;
typedef enum {
VG_PIXEL_LAYOUT_UNKNOWN = 0x1300,
VG_PIXEL_LAYOUT_RGB_VERTICAL = 0x1301,
VG_PIXEL_LAYOUT_BGR_VERTICAL = 0x1302,
VG_PIXEL_LAYOUT_RGB_HORIZONTAL = 0x1303,
VG_PIXEL_LAYOUT_BGR_HORIZONTAL = 0x1304,
VG_PIXEL_LAYOUT_FORCE_SIZE = VG_MAX_ENUM
} VGPixelLayout;
typedef enum {
VG_MATRIX_PATH_USER_TO_SURFACE = 0x1400,
VG_MATRIX_IMAGE_USER_TO_SURFACE = 0x1401,
VG_MATRIX_FILL_PAINT_TO_USER = 0x1402,
VG_MATRIX_STROKE_PAINT_TO_USER = 0x1403,
VG_MATRIX_GLYPH_USER_TO_SURFACE = 0x1404,
VG_MATRIX_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGMatrixMode;
typedef enum {
VG_CLEAR_MASK = 0x1500,
VG_FILL_MASK = 0x1501,
VG_SET_MASK = 0x1502,
VG_UNION_MASK = 0x1503,
VG_INTERSECT_MASK = 0x1504,
VG_SUBTRACT_MASK = 0x1505,
VG_MASK_OPERATION_FORCE_SIZE = VG_MAX_ENUM
} VGMaskOperation;
#define VG_PATH_FORMAT_STANDARD 0
typedef enum {
VG_PATH_DATATYPE_S_8 = 0,
VG_PATH_DATATYPE_S_16 = 1,
VG_PATH_DATATYPE_S_32 = 2,
VG_PATH_DATATYPE_F = 3,
VG_PATH_DATATYPE_FORCE_SIZE = VG_MAX_ENUM
} VGPathDatatype;
typedef enum {
VG_ABSOLUTE = 0,
VG_RELATIVE = 1,
VG_PATH_ABS_REL_FORCE_SIZE = VG_MAX_ENUM
} VGPathAbsRel;
typedef enum {
VG_CLOSE_PATH = ( 0 << 1),
VG_MOVE_TO = ( 1 << 1),
VG_LINE_TO = ( 2 << 1),
VG_HLINE_TO = ( 3 << 1),
VG_VLINE_TO = ( 4 << 1),
VG_QUAD_TO = ( 5 << 1),
VG_CUBIC_TO = ( 6 << 1),
VG_SQUAD_TO = ( 7 << 1),
VG_SCUBIC_TO = ( 8 << 1),
VG_SCCWARC_TO = ( 9 << 1),
VG_SCWARC_TO = (10 << 1),
VG_LCCWARC_TO = (11 << 1),
VG_LCWARC_TO = (12 << 1),
VG_PATH_SEGMENT_FORCE_SIZE = VG_MAX_ENUM
} VGPathSegment;
typedef enum {
VG_MOVE_TO_ABS = VG_MOVE_TO | VG_ABSOLUTE,
VG_MOVE_TO_REL = VG_MOVE_TO | VG_RELATIVE,
VG_LINE_TO_ABS = VG_LINE_TO | VG_ABSOLUTE,
VG_LINE_TO_REL = VG_LINE_TO | VG_RELATIVE,
VG_HLINE_TO_ABS = VG_HLINE_TO | VG_ABSOLUTE,
VG_HLINE_TO_REL = VG_HLINE_TO | VG_RELATIVE,
VG_VLINE_TO_ABS = VG_VLINE_TO | VG_ABSOLUTE,
VG_VLINE_TO_REL = VG_VLINE_TO | VG_RELATIVE,
VG_QUAD_TO_ABS = VG_QUAD_TO | VG_ABSOLUTE,
VG_QUAD_TO_REL = VG_QUAD_TO | VG_RELATIVE,
VG_CUBIC_TO_ABS = VG_CUBIC_TO | VG_ABSOLUTE,
VG_CUBIC_TO_REL = VG_CUBIC_TO | VG_RELATIVE,
VG_SQUAD_TO_ABS = VG_SQUAD_TO | VG_ABSOLUTE,
VG_SQUAD_TO_REL = VG_SQUAD_TO | VG_RELATIVE,
VG_SCUBIC_TO_ABS = VG_SCUBIC_TO | VG_ABSOLUTE,
VG_SCUBIC_TO_REL = VG_SCUBIC_TO | VG_RELATIVE,
VG_SCCWARC_TO_ABS = VG_SCCWARC_TO | VG_ABSOLUTE,
VG_SCCWARC_TO_REL = VG_SCCWARC_TO | VG_RELATIVE,
VG_SCWARC_TO_ABS = VG_SCWARC_TO | VG_ABSOLUTE,
VG_SCWARC_TO_REL = VG_SCWARC_TO | VG_RELATIVE,
VG_LCCWARC_TO_ABS = VG_LCCWARC_TO | VG_ABSOLUTE,
VG_LCCWARC_TO_REL = VG_LCCWARC_TO | VG_RELATIVE,
VG_LCWARC_TO_ABS = VG_LCWARC_TO | VG_ABSOLUTE,
VG_LCWARC_TO_REL = VG_LCWARC_TO | VG_RELATIVE,
VG_PATH_COMMAND_FORCE_SIZE = VG_MAX_ENUM
} VGPathCommand;
typedef enum {
VG_PATH_CAPABILITY_APPEND_FROM = (1 << 0),
VG_PATH_CAPABILITY_APPEND_TO = (1 << 1),
VG_PATH_CAPABILITY_MODIFY = (1 << 2),
VG_PATH_CAPABILITY_TRANSFORM_FROM = (1 << 3),
VG_PATH_CAPABILITY_TRANSFORM_TO = (1 << 4),
VG_PATH_CAPABILITY_INTERPOLATE_FROM = (1 << 5),
VG_PATH_CAPABILITY_INTERPOLATE_TO = (1 << 6),
VG_PATH_CAPABILITY_PATH_LENGTH = (1 << 7),
VG_PATH_CAPABILITY_POINT_ALONG_PATH = (1 << 8),
VG_PATH_CAPABILITY_TANGENT_ALONG_PATH = (1 << 9),
VG_PATH_CAPABILITY_PATH_BOUNDS = (1 << 10),
VG_PATH_CAPABILITY_PATH_TRANSFORMED_BOUNDS = (1 << 11),
VG_PATH_CAPABILITY_ALL = (1 << 12) - 1,
VG_PATH_CAPABILITIES_FORCE_SIZE = VG_MAX_ENUM
} VGPathCapabilities;
typedef enum {
VG_PATH_FORMAT = 0x1600,
VG_PATH_DATATYPE = 0x1601,
VG_PATH_SCALE = 0x1602,
VG_PATH_BIAS = 0x1603,
VG_PATH_NUM_SEGMENTS = 0x1604,
VG_PATH_NUM_COORDS = 0x1605,
VG_PATH_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGPathParamType;
typedef enum {
VG_CAP_BUTT = 0x1700,
VG_CAP_ROUND = 0x1701,
VG_CAP_SQUARE = 0x1702,
VG_CAP_STYLE_FORCE_SIZE = VG_MAX_ENUM
} VGCapStyle;
typedef enum {
VG_JOIN_MITER = 0x1800,
VG_JOIN_ROUND = 0x1801,
VG_JOIN_BEVEL = 0x1802,
VG_JOIN_STYLE_FORCE_SIZE = VG_MAX_ENUM
} VGJoinStyle;
typedef enum {
VG_EVEN_ODD = 0x1900,
VG_NON_ZERO = 0x1901,
VG_FILL_RULE_FORCE_SIZE = VG_MAX_ENUM
} VGFillRule;
typedef enum {
VG_STROKE_PATH = (1 << 0),
VG_FILL_PATH = (1 << 1),
VG_PAINT_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGPaintMode;
typedef enum {
/* Color paint parameters */
VG_PAINT_TYPE = 0x1A00,
VG_PAINT_COLOR = 0x1A01,
VG_PAINT_COLOR_RAMP_SPREAD_MODE = 0x1A02,
VG_PAINT_COLOR_RAMP_PREMULTIPLIED = 0x1A07,
VG_PAINT_COLOR_RAMP_STOPS = 0x1A03,
/* Linear gradient paint parameters */
VG_PAINT_LINEAR_GRADIENT = 0x1A04,
/* Radial gradient paint parameters */
VG_PAINT_RADIAL_GRADIENT = 0x1A05,
/* Pattern paint parameters */
VG_PAINT_PATTERN_TILING_MODE = 0x1A06,
VG_PAINT_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGPaintParamType;
typedef enum {
VG_PAINT_TYPE_COLOR = 0x1B00,
VG_PAINT_TYPE_LINEAR_GRADIENT = 0x1B01,
VG_PAINT_TYPE_RADIAL_GRADIENT = 0x1B02,
VG_PAINT_TYPE_PATTERN = 0x1B03,
VG_PAINT_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGPaintType;
typedef enum {
VG_COLOR_RAMP_SPREAD_PAD = 0x1C00,
VG_COLOR_RAMP_SPREAD_REPEAT = 0x1C01,
VG_COLOR_RAMP_SPREAD_REFLECT = 0x1C02,
VG_COLOR_RAMP_SPREAD_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGColorRampSpreadMode;
typedef enum {
VG_TILE_FILL = 0x1D00,
VG_TILE_PAD = 0x1D01,
VG_TILE_REPEAT = 0x1D02,
VG_TILE_REFLECT = 0x1D03,
VG_TILING_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGTilingMode;
typedef enum {
/* RGB{A,X} channel ordering */
VG_sRGBX_8888 = 0,
VG_sRGBA_8888 = 1,
VG_sRGBA_8888_PRE = 2,
VG_sRGB_565 = 3,
VG_sRGBA_5551 = 4,
VG_sRGBA_4444 = 5,
VG_sL_8 = 6,
VG_lRGBX_8888 = 7,
VG_lRGBA_8888 = 8,
VG_lRGBA_8888_PRE = 9,
VG_lL_8 = 10,
VG_A_8 = 11,
VG_BW_1 = 12,
VG_A_1 = 13,
VG_A_4 = 14,
/* {A,X}RGB channel ordering */
VG_sXRGB_8888 = 0 | (1 << 6),
VG_sARGB_8888 = 1 | (1 << 6),
VG_sARGB_8888_PRE = 2 | (1 << 6),
VG_sARGB_1555 = 4 | (1 << 6),
VG_sARGB_4444 = 5 | (1 << 6),
VG_lXRGB_8888 = 7 | (1 << 6),
VG_lARGB_8888 = 8 | (1 << 6),
VG_lARGB_8888_PRE = 9 | (1 << 6),
/* BGR{A,X} channel ordering */
VG_sBGRX_8888 = 0 | (1 << 7),
VG_sBGRA_8888 = 1 | (1 << 7),
VG_sBGRA_8888_PRE = 2 | (1 << 7),
VG_sBGR_565 = 3 | (1 << 7),
VG_sBGRA_5551 = 4 | (1 << 7),
VG_sBGRA_4444 = 5 | (1 << 7),
VG_lBGRX_8888 = 7 | (1 << 7),
VG_lBGRA_8888 = 8 | (1 << 7),
VG_lBGRA_8888_PRE = 9 | (1 << 7),
/* {A,X}BGR channel ordering */
VG_sXBGR_8888 = 0 | (1 << 6) | (1 << 7),
VG_sABGR_8888 = 1 | (1 << 6) | (1 << 7),
VG_sABGR_8888_PRE = 2 | (1 << 6) | (1 << 7),
VG_sABGR_1555 = 4 | (1 << 6) | (1 << 7),
VG_sABGR_4444 = 5 | (1 << 6) | (1 << 7),
VG_lXBGR_8888 = 7 | (1 << 6) | (1 << 7),
VG_lABGR_8888 = 8 | (1 << 6) | (1 << 7),
VG_lABGR_8888_PRE = 9 | (1 << 6) | (1 << 7),
VG_IMAGE_FORMAT_FORCE_SIZE = VG_MAX_ENUM
} VGImageFormat;
typedef enum {
VG_IMAGE_QUALITY_NONANTIALIASED = (1 << 0),
VG_IMAGE_QUALITY_FASTER = (1 << 1),
VG_IMAGE_QUALITY_BETTER = (1 << 2),
VG_IMAGE_QUALITY_FORCE_SIZE = VG_MAX_ENUM
} VGImageQuality;
typedef enum {
VG_IMAGE_FORMAT = 0x1E00,
VG_IMAGE_WIDTH = 0x1E01,
VG_IMAGE_HEIGHT = 0x1E02,
VG_IMAGE_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGImageParamType;
typedef enum {
VG_DRAW_IMAGE_NORMAL = 0x1F00,
VG_DRAW_IMAGE_MULTIPLY = 0x1F01,
VG_DRAW_IMAGE_STENCIL = 0x1F02,
VG_IMAGE_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGImageMode;
typedef enum {
VG_RED = (1 << 3),
VG_GREEN = (1 << 2),
VG_BLUE = (1 << 1),
VG_ALPHA = (1 << 0),
VG_IMAGE_CHANNEL_FORCE_SIZE = VG_MAX_ENUM
} VGImageChannel;
typedef enum {
VG_BLEND_SRC = 0x2000,
VG_BLEND_SRC_OVER = 0x2001,
VG_BLEND_DST_OVER = 0x2002,
VG_BLEND_SRC_IN = 0x2003,
VG_BLEND_DST_IN = 0x2004,
VG_BLEND_MULTIPLY = 0x2005,
VG_BLEND_SCREEN = 0x2006,
VG_BLEND_DARKEN = 0x2007,
VG_BLEND_LIGHTEN = 0x2008,
VG_BLEND_ADDITIVE = 0x2009,
VG_BLEND_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGBlendMode;
typedef enum {
VG_FONT_NUM_GLYPHS = 0x2F00,
VG_FONT_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGFontParamType;
typedef enum {
VG_IMAGE_FORMAT_QUERY = 0x2100,
VG_PATH_DATATYPE_QUERY = 0x2101,
VG_HARDWARE_QUERY_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGHardwareQueryType;
typedef enum {
VG_HARDWARE_ACCELERATED = 0x2200,
VG_HARDWARE_UNACCELERATED = 0x2201,
VG_HARDWARE_QUERY_RESULT_FORCE_SIZE = VG_MAX_ENUM
} VGHardwareQueryResult;
typedef enum {
VG_VENDOR = 0x2300,
VG_RENDERER = 0x2301,
VG_VERSION = 0x2302,
VG_EXTENSIONS = 0x2303,
VG_STRING_ID_FORCE_SIZE = VG_MAX_ENUM
} VGStringID;
/* Function Prototypes */
#ifndef VG_API_CALL
# error VG_API_CALL must be defined
#endif
#ifndef VG_API_ENTRY
# error VG_API_ENTRY must be defined
#endif
#ifndef VG_API_EXIT
# error VG_API_EXIT must be defined
#endif
VG_API_CALL VGErrorCode VG_API_ENTRY vgGetError(void) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgFlush(void) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgFinish(void) VG_API_EXIT;
/* Getters and Setters */
VG_API_CALL void VG_API_ENTRY vgSetf (VGParamType type, VGfloat value) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSeti (VGParamType type, VGint value) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetfv(VGParamType type, VGint count,
const VGfloat * values) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetiv(VGParamType type, VGint count,
const VGint * values) VG_API_EXIT;
VG_API_CALL VGfloat VG_API_ENTRY vgGetf(VGParamType type) VG_API_EXIT;
VG_API_CALL VGint VG_API_ENTRY vgGeti(VGParamType type) VG_API_EXIT;
VG_API_CALL VGint VG_API_ENTRY vgGetVectorSize(VGParamType type) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetfv(VGParamType type, VGint count, VGfloat * values) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetiv(VGParamType type, VGint count, VGint * values) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetParameterf(VGHandle object,
VGint paramType,
VGfloat value) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetParameteri(VGHandle object,
VGint paramType,
VGint value) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetParameterfv(VGHandle object,
VGint paramType,
VGint count, const VGfloat * values) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetParameteriv(VGHandle object,
VGint paramType,
VGint count, const VGint * values) VG_API_EXIT;
VG_API_CALL VGfloat VG_API_ENTRY vgGetParameterf(VGHandle object,
VGint paramType) VG_API_EXIT;
VG_API_CALL VGint VG_API_ENTRY vgGetParameteri(VGHandle object,
VGint paramType);
VG_API_CALL VGint VG_API_ENTRY vgGetParameterVectorSize(VGHandle object,
VGint paramType) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetParameterfv(VGHandle object,
VGint paramType,
VGint count, VGfloat * values) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetParameteriv(VGHandle object,
VGint paramType,
VGint count, VGint * values) VG_API_EXIT;
/* Matrix Manipulation */
VG_API_CALL void VG_API_ENTRY vgLoadIdentity(void) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgLoadMatrix(const VGfloat * m) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetMatrix(VGfloat * m) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgMultMatrix(const VGfloat * m) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgTranslate(VGfloat tx, VGfloat ty) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgScale(VGfloat sx, VGfloat sy) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgShear(VGfloat shx, VGfloat shy) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgRotate(VGfloat angle) VG_API_EXIT;
/* Masking and Clearing */
VG_API_CALL void VG_API_ENTRY vgMask(VGHandle mask, VGMaskOperation operation,
VGint x, VGint y,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgRenderToMask(VGPath path,
VGbitfield paintModes,
VGMaskOperation operation) VG_API_EXIT;
VG_API_CALL VGMaskLayer VG_API_ENTRY vgCreateMaskLayer(VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDestroyMaskLayer(VGMaskLayer maskLayer) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgFillMaskLayer(VGMaskLayer maskLayer,
VGint x, VGint y,
VGint width, VGint height,
VGfloat value) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgCopyMask(VGMaskLayer maskLayer,
VGint dx, VGint dy,
VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgClear(VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
/* Paths */
VG_API_CALL VGPath VG_API_ENTRY vgCreatePath(VGint pathFormat,
VGPathDatatype datatype,
VGfloat scale, VGfloat bias,
VGint segmentCapacityHint,
VGint coordCapacityHint,
VGbitfield capabilities) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgClearPath(VGPath path, VGbitfield capabilities) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDestroyPath(VGPath path) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgRemovePathCapabilities(VGPath path,
VGbitfield capabilities) VG_API_EXIT;
VG_API_CALL VGbitfield VG_API_ENTRY vgGetPathCapabilities(VGPath path) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgAppendPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgAppendPathData(VGPath dstPath,
VGint numSegments,
const VGubyte * pathSegments,
const void * pathData) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgModifyPathCoords(VGPath dstPath, VGint startIndex,
VGint numSegments,
const void * pathData) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgTransformPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT;
VG_API_CALL VGboolean VG_API_ENTRY vgInterpolatePath(VGPath dstPath,
VGPath startPath,
VGPath endPath,
VGfloat amount) VG_API_EXIT;
VG_API_CALL VGfloat VG_API_ENTRY vgPathLength(VGPath path,
VGint startSegment, VGint numSegments) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgPointAlongPath(VGPath path,
VGint startSegment, VGint numSegments,
VGfloat distance,
VGfloat * x, VGfloat * y,
VGfloat * tangentX, VGfloat * tangentY) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgPathBounds(VGPath path,
VGfloat * minX, VGfloat * minY,
VGfloat * width, VGfloat * height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgPathTransformedBounds(VGPath path,
VGfloat * minX, VGfloat * minY,
VGfloat * width, VGfloat * height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDrawPath(VGPath path, VGbitfield paintModes) VG_API_EXIT;
/* Paint */
VG_API_CALL VGPaint VG_API_ENTRY vgCreatePaint(void) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDestroyPaint(VGPaint paint) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetPaint(VGPaint paint, VGbitfield paintModes) VG_API_EXIT;
VG_API_CALL VGPaint VG_API_ENTRY vgGetPaint(VGPaintMode paintMode) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetColor(VGPaint paint, VGuint rgba) VG_API_EXIT;
VG_API_CALL VGuint VG_API_ENTRY vgGetColor(VGPaint paint) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgPaintPattern(VGPaint paint, VGImage pattern) VG_API_EXIT;
/* Images */
VG_API_CALL VGImage VG_API_ENTRY vgCreateImage(VGImageFormat format,
VGint width, VGint height,
VGbitfield allowedQuality) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDestroyImage(VGImage image) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgClearImage(VGImage image,
VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgImageSubData(VGImage image,
const void * data, VGint dataStride,
VGImageFormat dataFormat,
VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetImageSubData(VGImage image,
void * data, VGint dataStride,
VGImageFormat dataFormat,
VGint x, VGint y,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL VGImage VG_API_ENTRY vgChildImage(VGImage parent,
VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
VG_API_CALL VGImage VG_API_ENTRY vgGetParent(VGImage image) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgCopyImage(VGImage dst, VGint dx, VGint dy,
VGImage src, VGint sx, VGint sy,
VGint width, VGint height,
VGboolean dither) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDrawImage(VGImage image) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetPixels(VGint dx, VGint dy,
VGImage src, VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgWritePixels(const void * data, VGint dataStride,
VGImageFormat dataFormat,
VGint dx, VGint dy,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetPixels(VGImage dst, VGint dx, VGint dy,
VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgReadPixels(void * data, VGint dataStride,
VGImageFormat dataFormat,
VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgCopyPixels(VGint dx, VGint dy,
VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
/* Text */
VG_API_CALL VGFont VG_API_ENTRY vgCreateFont(VGint glyphCapacityHint) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDestroyFont(VGFont font) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetGlyphToPath(VGFont font,
VGuint glyphIndex,
VGPath path,
VGboolean isHinted,
const VGfloat glyphOrigin [2],
const VGfloat escapement[2]) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetGlyphToImage(VGFont font,
VGuint glyphIndex,
VGImage image,
const VGfloat glyphOrigin [2],
const VGfloat escapement[2]) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgClearGlyph(VGFont font,VGuint glyphIndex) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDrawGlyph(VGFont font,
VGuint glyphIndex,
VGbitfield paintModes,
VGboolean allowAutoHinting) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDrawGlyphs(VGFont font,
VGint glyphCount,
const VGuint *glyphIndices,
const VGfloat *adjustments_x,
const VGfloat *adjustments_y,
VGbitfield paintModes,
VGboolean allowAutoHinting) VG_API_EXIT;
/* Image Filters */
VG_API_CALL void VG_API_ENTRY vgColorMatrix(VGImage dst, VGImage src,
const VGfloat * matrix) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgConvolve(VGImage dst, VGImage src,
VGint kernelWidth, VGint kernelHeight,
VGint shiftX, VGint shiftY,
const VGshort * kernel,
VGfloat scale,
VGfloat bias,
VGTilingMode tilingMode) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSeparableConvolve(VGImage dst, VGImage src,
VGint kernelWidth,
VGint kernelHeight,
VGint shiftX, VGint shiftY,
const VGshort * kernelX,
const VGshort * kernelY,
VGfloat scale,
VGfloat bias,
VGTilingMode tilingMode) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGaussianBlur(VGImage dst, VGImage src,
VGfloat stdDeviationX,
VGfloat stdDeviationY,
VGTilingMode tilingMode) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgLookup(VGImage dst, VGImage src,
const VGubyte * redLUT,
const VGubyte * greenLUT,
const VGubyte * blueLUT,
const VGubyte * alphaLUT,
VGboolean outputLinear,
VGboolean outputPremultiplied) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgLookupSingle(VGImage dst, VGImage src,
const VGuint * lookupTable,
VGImageChannel sourceChannel,
VGboolean outputLinear,
VGboolean outputPremultiplied) VG_API_EXIT;
/* Hardware Queries */
VG_API_CALL VGHardwareQueryResult VG_API_ENTRY vgHardwareQuery(VGHardwareQueryType key,
VGint setting) VG_API_EXIT;
/* Renderer and Extension Information */
VG_API_CALL const VGubyte * VG_API_ENTRY vgGetString(VGStringID name) VG_API_EXIT;
#ifdef __cplusplus
} /* extern "C" */
#endif
#endif /* _OPENVG_H */

233
include/VG/vgext.h Normal file
View File

@@ -0,0 +1,233 @@
/* $Revision: 6810 $ on $Date:: 2008-10-29 07:31:37 -0700 #$ */
/*------------------------------------------------------------------------
*
* VG extensions Reference Implementation
* -------------------------------------
*
* Copyright (c) 2008 The Khronos Group Inc.
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and /or associated documentation files
* (the "Materials "), to deal in the Materials without restriction,
* including without limitation the rights to use, copy, modify, merge,
* publish, distribute, sublicense, and/or sell copies of the Materials,
* and to permit persons to whom the Materials are furnished to do so,
* subject to the following conditions:
*
* The above copyright notice and this permission notice shall be included
* in all copies or substantial portions of the Materials.
*
* THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
* IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
* DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
* OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
* THE USE OR OTHER DEALINGS IN THE MATERIALS.
*
*//**
* \file
* \brief VG extensions
*//*-------------------------------------------------------------------*/
#ifndef _VGEXT_H
#define _VGEXT_H
#ifdef __cplusplus
extern "C" {
#endif
#include <VG/openvg.h>
#include <VG/vgu.h>
#ifndef VG_API_ENTRYP
# define VG_API_ENTRYP VG_API_ENTRY*
#endif
#ifndef VGU_API_ENTRYP
# define VGU_API_ENTRYP VGU_API_ENTRY*
#endif
/*-------------------------------------------------------------------------------
* KHR extensions
*------------------------------------------------------------------------------*/
typedef enum {
#ifndef VG_KHR_iterative_average_blur
VG_MAX_AVERAGE_BLUR_DIMENSION_KHR = 0x116B,
VG_AVERAGE_BLUR_DIMENSION_RESOLUTION_KHR = 0x116C,
VG_MAX_AVERAGE_BLUR_ITERATIONS_KHR = 0x116D,
#endif
VG_PARAM_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM
} VGParamTypeKHR;
#ifndef VG_KHR_EGL_image
#define VG_KHR_EGL_image 1
/* VGEGLImageKHR is an opaque handle to an EGLImage */
typedef void* VGeglImageKHR;
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL VGImage VG_API_ENTRY vgCreateEGLImageTargetKHR(VGeglImageKHR image);
#endif
typedef VGImage (VG_API_ENTRYP PFNVGCREATEEGLIMAGETARGETKHRPROC) (VGeglImageKHR image);
#endif
#ifndef VG_KHR_iterative_average_blur
#define VG_KHR_iterative_average_blur 1
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL void vgIterativeAverageBlurKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
#endif
typedef void (VG_API_ENTRYP PFNVGITERATIVEAVERAGEBLURKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
#endif
#ifndef VG_KHR_advanced_blending
#define VG_KHR_advanced_blending 1
typedef enum {
VG_BLEND_OVERLAY_KHR = 0x2010,
VG_BLEND_HARDLIGHT_KHR = 0x2011,
VG_BLEND_SOFTLIGHT_SVG_KHR = 0x2012,
VG_BLEND_SOFTLIGHT_KHR = 0x2013,
VG_BLEND_COLORDODGE_KHR = 0x2014,
VG_BLEND_COLORBURN_KHR = 0x2015,
VG_BLEND_DIFFERENCE_KHR = 0x2016,
VG_BLEND_SUBTRACT_KHR = 0x2017,
VG_BLEND_INVERT_KHR = 0x2018,
VG_BLEND_EXCLUSION_KHR = 0x2019,
VG_BLEND_LINEARDODGE_KHR = 0x201a,
VG_BLEND_LINEARBURN_KHR = 0x201b,
VG_BLEND_VIVIDLIGHT_KHR = 0x201c,
VG_BLEND_LINEARLIGHT_KHR = 0x201d,
VG_BLEND_PINLIGHT_KHR = 0x201e,
VG_BLEND_HARDMIX_KHR = 0x201f,
VG_BLEND_CLEAR_KHR = 0x2020,
VG_BLEND_DST_KHR = 0x2021,
VG_BLEND_SRC_OUT_KHR = 0x2022,
VG_BLEND_DST_OUT_KHR = 0x2023,
VG_BLEND_SRC_ATOP_KHR = 0x2024,
VG_BLEND_DST_ATOP_KHR = 0x2025,
VG_BLEND_XOR_KHR = 0x2026,
VG_BLEND_MODE_KHR_FORCE_SIZE= VG_MAX_ENUM
} VGBlendModeKHR;
#endif
#ifndef VG_KHR_parametric_filter
#define VG_KHR_parametric_filter 1
typedef enum {
VG_PF_OBJECT_VISIBLE_FLAG_KHR = (1 << 0),
VG_PF_KNOCKOUT_FLAG_KHR = (1 << 1),
VG_PF_OUTER_FLAG_KHR = (1 << 2),
VG_PF_INNER_FLAG_KHR = (1 << 3),
VG_PF_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM
} VGPfTypeKHR;
typedef enum {
VGU_IMAGE_IN_USE_ERROR = 0xF010,
VGU_ERROR_CODE_KHR_FORCE_SIZE = VG_MAX_ENUM
} VGUErrorCodeKHR;
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL void VG_API_ENTRY vgParametricFilterKHR(VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguDropShadowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA) ;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
#endif
typedef void (VG_API_ENTRYP PFNVGPARAMETRICFILTERKHRPROC) (VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUDROPSHADOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
#endif
/*-------------------------------------------------------------------------------
* NDS extensions
*------------------------------------------------------------------------------*/
#ifndef VG_NDS_paint_generation
#define VG_NDS_paint_generation 1
typedef enum {
VG_PAINT_COLOR_RAMP_LINEAR_NDS = 0x1A10,
VG_COLOR_MATRIX_NDS = 0x1A11,
VG_PAINT_COLOR_TRANSFORM_LINEAR_NDS = 0x1A12,
VG_PAINT_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGPaintParamTypeNds;
typedef enum {
VG_DRAW_IMAGE_COLOR_MATRIX_NDS = 0x1F10,
VG_IMAGE_MODE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGImageModeNds;
#endif
#ifndef VG_NDS_projective_geometry
#define VG_NDS_projective_geometry 1
typedef enum {
VG_CLIP_MODE_NDS = 0x1180,
VG_CLIP_LINES_NDS = 0x1181,
VG_MAX_CLIP_LINES_NDS = 0x1182,
VG_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGParamTypeNds;
typedef enum {
VG_CLIPMODE_NONE_NDS = 0x3000,
VG_CLIPMODE_CLIP_CLOSED_NDS = 0x3001,
VG_CLIPMODE_CLIP_OPEN_NDS = 0x3002,
VG_CLIPMODE_CULL_NDS = 0x3003,
VG_CLIPMODE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGClipModeNds;
typedef enum {
VG_RQUAD_TO_NDS = ( 13 << 1 ),
VG_RCUBIC_TO_NDS = ( 14 << 1 ),
VG_PATH_SEGMENT_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGPathSegmentNds;
typedef enum {
VG_RQUAD_TO_ABS_NDS = (VG_RQUAD_TO_NDS | VG_ABSOLUTE),
VG_RQUAD_TO_REL_NDS = (VG_RQUAD_TO_NDS | VG_RELATIVE),
VG_RCUBIC_TO_ABS_NDS = (VG_RCUBIC_TO_NDS | VG_ABSOLUTE),
VG_RCUBIC_TO_REL_NDS = (VG_RCUBIC_TO_NDS | VG_RELATIVE),
VG_PATH_COMMAND_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGPathCommandNds;
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL void VG_API_ENTRY vgProjectiveMatrixNDS(VGboolean enable) ;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguTransformClipLineNDS(const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
#endif
typedef void (VG_API_ENTRYP PFNVGPROJECTIVEMATRIXNDSPROC) (VGboolean enable) ;
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUTRANSFORMCLIPLINENDSPROC) (const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
#endif
#ifdef __cplusplus
} /* extern "C" */
#endif
#endif /* _VGEXT_H */

92
include/VG/vgplatform.h Normal file
View File

@@ -0,0 +1,92 @@
/* $Revision: 6810 $ on $Date:: 2008-10-29 07:31:37 -0700 #$ */
/*------------------------------------------------------------------------
*
* VG platform specific header Reference Implementation
* ----------------------------------------------------
*
* Copyright (c) 2008 The Khronos Group Inc.
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and /or associated documentation files
* (the "Materials "), to deal in the Materials without restriction,
* including without limitation the rights to use, copy, modify, merge,
* publish, distribute, sublicense, and/or sell copies of the Materials,
* and to permit persons to whom the Materials are furnished to do so,
* subject to the following conditions:
*
* The above copyright notice and this permission notice shall be included
* in all copies or substantial portions of the Materials.
*
* THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
* IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
* DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
* OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
* THE USE OR OTHER DEALINGS IN THE MATERIALS.
*
*//**
* \file
* \brief VG platform specific header
*//*-------------------------------------------------------------------*/
#ifndef _VGPLATFORM_H
#define _VGPLATFORM_H
#include <KHR/khrplatform.h>
#ifdef __cplusplus
extern "C" {
#endif
#ifndef VG_API_CALL
#if defined(OPENVG_STATIC_LIBRARY)
# define VG_API_CALL
#else
# define VG_API_CALL KHRONOS_APICALL
#endif /* defined OPENVG_STATIC_LIBRARY */
#endif /* ifndef VG_API_CALL */
#ifndef VGU_API_CALL
#if defined(OPENVG_STATIC_LIBRARY)
# define VGU_API_CALL
#else
# define VGU_API_CALL KHRONOS_APICALL
#endif /* defined OPENVG_STATIC_LIBRARY */
#endif /* ifndef VGU_API_CALL */
#ifndef VG_API_ENTRY
#define VG_API_ENTRY
#endif
#ifndef VG_API_EXIT
#define VG_API_EXIT
#endif
#ifndef VGU_API_ENTRY
#define VGU_API_ENTRY
#endif
#ifndef VGU_API_EXIT
#define VGU_API_EXIT
#endif
typedef float VGfloat;
typedef signed char VGbyte;
typedef unsigned char VGubyte;
typedef signed short VGshort;
typedef signed int VGint;
typedef unsigned int VGuint;
typedef unsigned int VGbitfield;
#ifndef VG_VGEXT_PROTOTYPES
#define VG_VGEXT_PROTOTYPES
#endif
#ifdef __cplusplus
} /* extern "C" */
#endif
#endif /* _VGPLATFORM_H */

Some files were not shown because too many files have changed in this diff Show More