Compare commits

..

248 Commits

Author SHA1 Message Date
Emil Velikov
cb154bb221 docs: Add sha256 sums for the 10.4.7 release
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-03-21 00:50:13 +00:00
Emil Velikov
d26f3c1f86 Add release notes for the 10.4.7 release
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-03-21 00:26:27 +00:00
Emil Velikov
b7b218f3f6 Update version to 10.4.7
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-03-21 00:19:39 +00:00
Marek Olšák
832c94a55c radeonsi: increase coords array size for radeon_llvm_emit_prepare_cube_coords
radeon_llvm_emit_prepare_cube_coords uses coords[4] in some cases (TXB2 etc.)

Discovered by Coverity. Reported by Ilia Mirkin.

Cc: 10.5 10.4 <mesa-stable@lists.freedesktop.org>
Reviewed-by: Michel Dänzer <michel.daenzer@amd.com>
(cherry picked from commit a984abdad3)
2015-03-18 21:49:33 +00:00
Mario Kleiner
70832be2f1 glx: Handle out-of-sequence swap completion events correctly. (v2)
The code for emitting INTEL_swap_events swap completion
events needs to translate from 32-Bit sbc on the wire to
64-Bit sbc for the events and handle wraparound accordingly.

It assumed that events would be sent by the server in the
order their corresponding swap requests were emitted from
the client, iow. sbc count should be always increasing. This
was correct for DRI2.

This is not always the case under the DRI3/Present backend,
where the Present extension can execute presents and send out
completion events in a different order than the submission
order of the present requests, due to client code specifying
targetMSC target vblank counts which are not strictly
monotonically increasing. This confused the wraparound
handling. This patch fixes the problem by handling 32-Bit
wraparound in both directions. As long as successive swap
completion events real 64-Bit sbc's don't differ by more
than 2^30, this should be able to do the right thing.

How this is supposed to work:

awire->sbc contains the low 32-Bits of the true 64-Bit sbc
of the current swap event, transmitted over the wire.

glxDraw->lastEventSbc contains the low 32-Bits of the 64-Bit
sbc of the most recently processed swap event.

glxDraw->eventSbcWrap is a 64-Bit offset which tracks the upper
32-Bits of the current sbc. The final 64-Bit output sbc
aevent->sbc is computed from the sum of awire->sbc and
glxDraw->eventSbcWrap.

Under DRI3/Present, swap completion events can be received
slightly out of order due to non-monotic targetMsc specified
by client code, e.g., present request submission:

Submission sbc:   1   2   3
targetMsc:        10  11  9

Reception of completion events:
Completion sbc:   3   1   2

The completion sequence 3, 1, 2 would confuse the old wraparound
handling made for DRI2 as 1 < 3 --> Assumes a 32-Bit wraparound
has happened when it hasn't.

The client can queue multiple present requests, in the case of
Mesa up to n requests for n-buffered rendering, e.g., n =  2-4 in
the current Mesa GLX DRI3/Present implementation. In the case of
direct Pixmap presents via xcb_present_pixmap() the number n is
limited by the amount of memory available.

We reasonably assume that the number of outstanding requests n is
much less than 2 billion due to memory contraints and common sense.
Therefore while the order of received sbc's can be a bit scrambled,
successive 64-Bit sbc's won't deviate by much, a given sbc may be
a few counts lower or higher than the previous received sbc.

Therefore any large difference between the incoming awire->sbc and
the last recorded glxDraw->lastEventSbc will be due to 32-Bit
wraparound and we need to adapt glxDraw->eventSbcWrap accordingly
to adjust the upper 32-Bits of the sbc.

Two cases, correponding to the two if-statements in the patch:

a) Previous sbc event was below the last 2^32 boundary, in the previous
glxDraw->eventSbcWrap epoch, the new sbc event is in the next 2^32
epoch, therefore the low 32-Bit awire->sbc wrapped around to zero,
or close to zero --> awire->sbc is apparently much lower than the
glxDraw->lastEventSbc recorded for the previous epoch

--> We need to increment glxDraw->eventSbcWrap by 2^32 to adjust
the current epoch to be one higher than the previous one.

--> Case a) also handles the old DRI2 behaviour.

b) Previous sbc event was above closest 2^32 boundary, but now a
late event from the previous 2^32 epoch arrives, with a true sbc
that belongs to the previous 2^32 segment, so the awire->sbc of
this late event has a high count close to 2^32, whereas
glxDraw->lastEventSbc is closer to zero --> awire->sbc is much
greater than glXDraw->lastEventSbc.

--> We need to decrement glxDraw->eventSbcWrap by 2^32 to adjust
the current epoch back to the previous lower epoch of this late
completion event.

We assume such a wraparound to a higher (a) epoch or lower (b)
epoch has happened if awire->sbc and glxDraw->lastEventSbc differ
by more than 2^30 counts, as such a difference can only happen
on wraparound, or if somehow 2^30 present requests would be pending
for a given drawable inside the server, which is rather unlikely.

v2: Explain the reason for this patch and the new wraparound handling
    much more extensive in commit message, no code change wrt. initial
    version.

Cc: "10.3 10.4 10.5" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Mario Kleiner <mario.kleiner.de@gmail.com>
Reviewed-by: Michel Dänzer <michel.daenzer@amd.com>
(cherry picked from commit cc5ddd584d)
2015-03-18 21:49:25 +00:00
Emil Velikov
ad259df2e0 auxiliary/os: fix the android build - s/drm_munmap/os_munmap/
Squash this silly typo introduced with commit c63eb5dd5ec(auxiliary/os: get
the mmap/munmap wrappers working with android)

Cc: "10.4 10.5" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Brian Paul <brianp@vmware.com>
(cherry picked from commit 55f0c0a29f)
2015-03-18 21:49:18 +00:00
Emil Velikov
df2db2a55f loader: include <sys/stat.h> for non-sysfs builds
Required by fstat(), otherwise we'll error out due to implicit function
declaration.

Cc: "10.4 10.5" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=89530
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
Reported-by: Vadim Rutkovsky <vrutkovs@redhat.com>
Tested-by: Vadim Rutkovsky <vrutkovs@redhat.com>
(cherry picked from commit 771cd266b9)
2015-03-18 21:49:05 +00:00
Rob Clark
0506f69f08 freedreno: update generated headers
Fix a3xx texture layer-size.

Signed-off-by: Rob Clark <robclark@freedesktop.org>
Cc: "10.4 10.5" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit e92bc6b38e)
[Emil Velikov: sqush trivial conflicts, drop the a4xx.xml.h changes]

Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>

Conflicts:
	src/gallium/drivers/freedreno/a2xx/a2xx.xml.h
	src/gallium/drivers/freedreno/a3xx/a3xx.xml.h
	src/gallium/drivers/freedreno/a4xx/a4xx.xml.h
	src/gallium/drivers/freedreno/adreno_common.xml.h
	src/gallium/drivers/freedreno/adreno_pm4.xml.h
2015-03-18 21:48:40 +00:00
Ilia Mirkin
a563045009 freedreno: fix slice pitch calculations
For example if width were 65, the first slice would get 96 while the
second would get 32. However the hardware appears to expect the second
pitch to be 64, based on halving the 96 (and aligning up to 32).

This fixes texelFetch piglit tests on a3xx below a certain size. Going
higher they break again, but most likely due to unrelated reasons.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.4 10.5" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Rob Clark <robclark@freedesktop.org>
(cherry picked from commit 620e29b748)
2015-03-18 21:32:21 +00:00
Samuel Iglesias Gonsalvez
b2e243f70c glsl: optimize (0 cmp x + y) into (-x cmp y).
The optimization done by commit 34ec1a24d did not take it into account.

Fixes:

dEQP-GLES3.functional.shaders.random.all_features.fragment.20

Signed-off-by: Samuel Iglesias Gonsalvez <siglesias@igalia.com>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Cc: "10.4 10.5" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit b43bbfa90a)
2015-03-18 21:15:35 +00:00
Iago Toral Quiroga
8c25b0f2d1 i965: Fix out-of-bounds accesses into pull_constant_loc array
The piglit test glsl-fs-uniform-array-loop-unroll.shader_test was designed
to do an out of bounds access into an uniform array to make sure that we
handle that situation gracefully inside the driver, however, as Ken describes
in bug 79202, Valgrind reports that this is leading to an out-of-bounds access
in fs_visitor::demote_pull_constants().

Before accessing the pull_constant_loc array we should make sure that
the uniform we are trying to access is valid.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=79202
Reviewed-by: Matt Turner <mattst88@gmail.com>
(cherry picked from commit 6ac1bc90c4)
Nominated-by: Matt Turner <mattst88@gmail.com>
2015-03-11 17:46:03 +00:00
Rob Clark
a91ee1e187 freedreno/ir3: fix silly typo for binning pass shaders
Was resulting in gl_PointSize write being optimized out, causing
particle system type shaders to hang if hw binning enabled.

Fixes neverball, OGLES2ParticleSystem, etc.

Signed-off-by: Rob Clark <robclark@freedesktop.org>
(cherry picked from commit 60096ed906)
2015-03-11 17:44:38 +00:00
Marek Olšák
977626f10a r300g: fix sRGB->sRGB blits
Cc: 10.5 10.4 <mesa-stable@lists.freedesktop.org>
(cherry picked from commit c939231e72)
2015-03-11 17:42:52 +00:00
Marek Olšák
b451a2ffbf r300g: fix a crash when resolving into an sRGB texture
Cc: 10.5 10.4 <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 9953586af2)
2015-03-11 17:42:38 +00:00
Marek Olšák
a561eee82c r300g: fix RGTC1 and LATC1 SNORM formats
Cc: 10.5 10.4 <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 74a757f92f)
2015-03-11 17:42:07 +00:00
Stefan Dösinger
80ef80d087 r300g: Fix the ATI1N swizzle (RGTC1 and LATC1)
This fixes the GL_COMPRESSED_RED_RGTC1 part of piglit's rgtc-teximage-01
test as well as the precision part of Wine's 3dc format test (fd.o bug
89156).

The Z component seems to contain a lower precision version of the
result, probably a temporary value from the decompression computation.
The Y and W component contain different data that depends on the input
values as well, but I could not make sense of them (Not that I tried
very hard).

GL_COMPRESSED_SIGNED_RED_RGTC1 still seems to have precision problems in
piglit, and both formats are affected by a compiler bug if they're
sampled by the shader with a swizzle other than .xyzw. Wine uses .xxxx,
which returns random garbage.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=89156
Signed-off-by: Marek Olšák <marek.olsak@amd.com>
Cc: 10.5 10.4 <mesa-stable@lists.freedesktop.org>
(cherry picked from commit f710b99071)
2015-03-11 17:41:43 +00:00
Ilia Mirkin
fa8bfb3ed1 freedreno/ir3: get the # of miplevels from getinfo
This fixes ARB_texture_query_levels to actually return the desired
value.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Rob Clark <robclark@freedesktop.org>
Cc: "10.4 10.5" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit cb3eb43ad6)
2015-03-11 17:41:32 +00:00
Ilia Mirkin
025cf8cb3f freedreno/ir3: fix array count returned by TXQ
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Rob Clark <robclark@freedesktop.org>
Cc: "10.4 10.5" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 8ac957a51c)
2015-03-11 17:41:20 +00:00
Ilia Mirkin
4db4f70546 freedreno: move fb state copy after checking for size change
Fixes: 1f3ca56b ("freedreno: use util_copy_framebuffer_state()")
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Rob Clark <robclark@freedesktop.org>
Cc: "10.4 10.5" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit f3dfe6513c)
2015-03-11 17:40:59 +00:00
Andrey Sudnik
d4a95ffcda i965/vec4: Don't lose the saturate modifier in copy propagation.
Cc: 10.4, 10.5 <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=89224
Reviewed-by: Matt Turner <mattst88@gmail.com>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
(cherry picked from commit 0dfec59a27)
2015-03-07 16:41:16 +00:00
Emil Velikov
97b0219ed5 mesa: rename format_info.c to format_info.h
The file is auto-generated, and #included by formats.c. Let's rename it
to reflect the latter. This will also help up fix the dependency
tracking by adding it to the _SOURCES variable, without the side effect
of it being compiled (twice).

v2: Update .gitignore to reflect the rename.

Cc: "10.4, 10.5" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Matt Turner <mattst88@gmail.com>
(cherry picked from commit 3f6c28f2a9)

Conflicts:
	src/mesa/Makefile.am
	src/mesa/main/.gitignore
2015-03-07 16:40:27 +00:00
Matt Turner
93273f16af r300g: Check return value of snprintf().
Would have at least prevented the crash the previous patch fixed.

Cc: 10.4, 10.5 <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.gentoo.org/show_bug.cgi?id=540970
Reviewed-by: Tom Stellard <thomas.stellard@amd.com>
(cherry picked from commit ade0b580e7)
2015-03-07 16:37:22 +00:00
Matt Turner
8e8d215cae r300g: Use PATH_MAX instead of limiting ourselves to 100 chars.
When built with Gentoo's package manager, the Mesa source directory
exists seven directories deep. The path to the .test file is too long
and is silently truncated, leading to a crash. Just use PATH_MAX.

Cc: 10.4, 10.5 <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.gentoo.org/show_bug.cgi?id=540970
Reviewed-by: Tom Stellard <thomas.stellard@amd.com>
(cherry picked from commit f5e2aa1324)
2015-03-07 16:37:15 +00:00
Daniel Stone
1a929baa0b egl: Take alpha bits into account when selecting GBM formats
This fixes piglit when using PIGLIT_PLATFORM=gbm

Tom Stellard:
  - Fix ARGB2101010 format

Cc: "10.4 10.5" <mesa-stable@lists.freedesktop.org>

Reviewed-by: Alex Deucher <alexander.deucher@amd.com>
Reviewed-by: Chad Versace <chad.versace@intel.com>
(cherry picked from commit 65c8965d03)
2015-03-07 16:37:04 +00:00
Marc-Andre Lureau
3a625d0b3f gallium/auxiliary/indices: fix start param
Since commit 28f3f8d, indices generator take a start parameter. However, some
index values have been left to start at 0.

This fixes the glean/fbo test with the virgl driver, and copytexsubimage
with freedreno.

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.4 10.5" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 073a5d2e84)
2015-03-07 16:36:47 +00:00
Emil Velikov
944ef59b2f cherry-ignore: add not applicable/rejected commits
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-03-07 16:36:05 +00:00
Emil Velikov
fc9dd495b2 docs: Add sha256 sums for the 10.4.6 release
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-03-06 19:44:55 +00:00
Emil Velikov
542a754524 Add release notes for the 10.4.6 release
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-03-06 19:23:34 +00:00
Emil Velikov
e559d126f9 Update version to 10.4.6
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-03-06 19:16:58 +00:00
Emil Velikov
fc5881ad73 Revert "gallivm: Update for RTDyldMemoryManager becoming an unique_ptr."
This reverts commit 66a3f104a5.

The commit is likely insufficient for normal work with LLVM 3.6.
The full discussion and reason can be found at
http://lists.freedesktop.org/archives/mesa-dev/2015-March/078795.html
2015-03-06 19:16:28 +00:00
Emil Velikov
9508ca24f1 mesa: cherry-pick the second half of commit 2aa71e9485
Missed out by commit 39ae85732d2(mesa: Fix error validating args for
TexSubImage3D)

Reported-by: Matt Turner <mattst88@gmail.com>
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-03-06 19:16:19 +00:00
Matt Turner
644bbf88ec mesa: Correct backwards NULL check.
Cc: "10.4, 10.5" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
(cherry picked from commit 491d42135a)
2015-03-06 18:45:13 +00:00
Ian Romanick
a369361f9e mesa: Always generate GL_INVALID_OPERATION in _mesa_GetProgramBinary
There are no binary formats supported, so what are you doing?  At least
this gives the application developer some feedback about what's going
on.  The spec gives no guidance about what to do in this scenario.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=87516
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
Acked-by: Leight Bade <leith@mapbox.com>
(cherry picked from commit f591712efe)
2015-03-06 18:44:52 +00:00
Ian Romanick
f1663a5236 mesa: Ensure that length is set to zero in _mesa_GetProgramBinary
v2: Fix assignment of length.  Noticed by Julien Cristau.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=87516
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
Acked-by: Leight Bade <leith@mapbox.com>
(cherry picked from commit 4fd8b30123)
2015-03-06 18:44:37 +00:00
Ian Romanick
e1b5bc9330 mesa: Add missing error checks in _mesa_ProgramBinary
Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=87516
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
Acked-by: Leight Bade <leith@mapbox.com>
(cherry picked from commit 201b9c1818)

Conflicts:
	src/mesa/main/shaderapi.c
2015-03-06 18:42:51 +00:00
Emil Velikov
93edf3e7dc Revert "mesa: Correct backwards NULL check."
This reverts commit a598a9bdfe.

The patch was applied without the required dependencies.
2015-03-06 18:40:09 +00:00
José Fonseca
66a3f104a5 gallivm: Update for RTDyldMemoryManager becoming an unique_ptr.
Trivial.

Fixes https://bugs.freedesktop.org/show_bug.cgi?id=86958

(cherry picked from commit ef7e0b39a2)
Nominated-by: Sedat Dilek <sedat.dilek@gmail.com>
2015-03-04 01:51:36 +00:00
Abdiel Janulgue
afa7a851da st/mesa: For vertex shaders, don't emit saturate when SM 3.0 is unsupported
There is a bug in the current lowering pass implementation where we lower saturate
to clamp only for vertex shaders on drivers supporting SM 3.0. The correct behavior
is to actually lower to clamp only when we don't support saturate which happens
on drivers that don't support SM 3.0

Reviewed-by: Marek Olšák <marek.olsak@amd.com>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Signed-off-by: Abdiel Janulgue <abdiel.janulgue@linux.intel.com>
(cherry picked from commit 49e0431211)
Nominated-by: Matt Turner <mattst88@gmail.com>
2015-03-04 01:51:36 +00:00
Abdiel Janulgue
d880aa573c glsl: Don't optimize min/max into saturate when EmitNoSat is set
v3: Fix multi-line comment format (Ian)

Reviewed-by: Matt Turner <mattst88@gmail.com>
Signed-off-by: Abdiel Janulgue <abdiel.janulgue@linux.intel.com>
(cherry picked from commit 4ea8c8d56c)
2015-03-04 01:51:36 +00:00
Matt Turner
741aeba26f i965/fs: Don't use backend_visitor::instructions after creating the CFG.
This is a fix for a regression introduced in commit a9f8296d ("i965/fs:
Preserve the CFG in a few more places.").

The errata this code works around is described in a comment before the function:

   "[DevBW, DevCL] Errata: A destination register from a send can not be
    used as a destination register until after it has been sourced by an
    instruction with a different destination register.

The framebuffer write's sources must be in message registers, which SEND
instructions cannot have as a destination. There's no way for this
errata to affect anything at the end of the program. Just remove the
code.

Cc: 10.4, 10.5 <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=84613
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit e214000f25)
2015-03-04 01:51:36 +00:00
Matt Turner
a598a9bdfe mesa: Correct backwards NULL check.
Cc: "10.4, 10.5" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
(cherry picked from commit 491d42135a)
[Emil Velikov: the patch hunk has a different offset.]
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>

Conflicts:
	src/mesa/main/shaderapi.c
2015-03-04 01:51:36 +00:00
Chris Forbes
0c46d850d9 i965/gs: Check newly-generated GS-out VUE map against correct stage
Previously, we compared our new GS-out VUE map to the existing *VS*-out
VUE map, which is bogus.

This would mostly manifest as redundant dirty flagging where the GS is
in use but the VS and GS output layouts differ; but there is a scary
case where we would fail to flag a GS-out layout change if it happened
to match the VS-out layout.

Signed-off-by: Chris Forbes <chrisf@ijw.co.nz>
Cc: "10.5, 10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=88885
(cherry picked from commit b51ff50a76)
2015-03-04 01:51:36 +00:00
Jonathan Gray
da46b1b160 auxilary/os: correct sysctl use in os_get_total_physical_memory()
The length argument passed to sysctl was the size of the pointer
not the type.  The result of this is sysctl calls would fail on
32 bit BSD/Mac OS X.

Additionally the wrong pointer was passed as an argument to store
the result of the sysctl call.

Cc: "10.4, 10.5" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Jonathan Gray <jsg@jsg.id.au>
Reviewed-by: Emil Velikov <emil.l.velikov@gmail.com>
(cherry picked from commit 7983a3d2e0)
2015-03-04 01:51:36 +00:00
Matt Turner
7e723c98ce glsl: Rewrite and fix min/max to saturate optimization.
There were some bugs, and the code was really difficult to follow. We
would optimize

   min(max(x, b), 1.0) into max(sat(x), b)

but not pay attention to the order of min/max and also do

   max(min(x, b), 1.0) into max(sat(x), b)

Corrects four shaders from Champions of Regnum that do

   min(max(x, 1), 10)

and corrects rendering of Mass Effect under VMware Workstation.

Cc: "10.4 10.5" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=89180
Reviewed-by: Abdiel Janulgue <abdiel.janulgue@linux.intel.com>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
(cherry picked from commit cb25087c7b)
2015-03-04 01:51:36 +00:00
Andreas Boll
0a51529a28 glx: Fix returned values of GLX_RENDERER_PREFERRED_PROFILE_MESA
If the renderer supports the core profile the query returned incorrectly
0x8 as value, because it was using (1U << __DRI_API_OPENGL_CORE) for the
returned value.

The same happened with the compatibility profile. It returned 0x1
(1U << __DRI_API_OPENGL) instead of 0x2.

Internal DRI defines:
   dri_interface.h: #define __DRI_API_OPENGL       0
   dri_interface.h: #define __DRI_API_OPENGL_CORE  3

Those two bits are supposed for internal usage only and should be
translated to GLX_CONTEXT_CORE_PROFILE_BIT_ARB (0x1) for a preferred
core context profile and GLX_CONTEXT_COMPATIBILITY_PROFILE_BIT_ARB (0x2)
for a preferred compatibility context profile.

This patch implements the above translation in the glx module.

v2: Fix the incorrect behavior in the glx module

Cc: "10.3 10.4 10.5" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Andreas Boll <andreas.boll.dev@gmail.com>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
(cherry picked from commit 6d164f65c5)
2015-03-04 01:51:36 +00:00
Leo Liu
2a9e9b5aeb st/omx/dec/h264: fix picture out-of-order with poc type 0 v2
poc counter should be reset with IDR frame,
otherwise there would be a re-order issue with
frames before and after IDR

v2: add commit message

Signed-off-by: Leo Liu <leo.liu@amd.com>
Reviewed-by: Christian König <christian.koenig@amd.com>
Cc: "10.4 10.5" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 9c7b343bc0)
2015-03-04 01:51:36 +00:00
Emil Velikov
120792fa04 install-lib-links: remove the .install-lib-links file
With earlier commit (install-lib-links: don't depend on .libs directory)
we moved the location of the file from .libs/ to the current dir.
Although we did not attribute that in the former case autotools was
doing us a favour and removing the file. Explicitly remove the file at
clean-local time, otherwise we'll end up with dangling files.

Cc: "10.3 10.4 10.5" <mesa-stable@lists.freedesktop.org>
Cc: Matt Turner <mattst88@gmail.com>
Cc: Lucas Stach <l.stach@pengutronix.de>
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
(cherry picked from commit fece147be5)
2015-03-04 01:51:35 +00:00
Eduardo Lima Mitev
39ae85732d mesa: Fix error validating args for TexSubImage3D
The zoffset and depth values were not being considered when calling
error_check_subtexture_dimensions().

Fixes 2 dEQP tests:
* dEQP-GLES3.functional.negative_api.texture.texsubimage3d_neg_offset
* dEQP-GLES3.functional.negative_api.texture.texsubimage3d_invalid_offset

Reviewed-by: Brian Paul <brianp@vmware.com>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Cc: "10.4 10.5" <mesa-stable@lists.freedestkop.org>
(cherry picked from commit 2aa71e9485)
[Emil Velikov: Resolve trivial conflicts]
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>

Conflicts:
	src/mesa/main/teximage.c
2015-03-04 01:51:35 +00:00
Marek Olšák
61c1aabb9f radeonsi: fix point sprites
Broken by a27b74819a.

This fix is critical and should be ported to stable ASAP.

Cc: 10.5 10.4 <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 7820a11e3d)

Squashed with commit

radeonsi: fix a warning caused by previous commit

Cc: 10.5 10.4 <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 050bf75c8b)

[Emil Velikov: The file was renamed si_state_{shaders,draw}.c]
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>

Conflicts:
	src/gallium/drivers/radeonsi/si_state_shader.c
2015-03-04 01:51:16 +00:00
Marek Olšák
6da4e66d4e vbo: fix an unitialized-variable warning
It looks like a bug to me.

Cc: 10.5 10.4 10.3 <mesa-stable@lists.freedesktop.org>
Reviewed-by: Brian Paul <brianp@vmware.com>
(cherry picked from commit 0feb0b7373)
2015-03-04 00:39:01 +00:00
Brian Paul
7e57411b9a st/mesa: fix sampler view reference counting bug in glDraw/CopyPixels
Use pipe_sampler_view_reference() instead of ordinary assignment.
Also add a new sanity check assertion.

Fixes piglit gl-1.0-drawpixels-color-index test crash.  But note
that the test still fails.

Cc: "10.4, 10.5" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
(cherry picked from commit 62a8883f32)
2015-03-04 00:38:31 +00:00
Brian Paul
1e6735ead1 swrast: fix multiple color buffer writing
If a fragment program wrote to more than one color buffer, the
first fragment color got replicated to all dest buffers.  This
fixes 5 piglit FBO tests, including fbo-drawbuffers-arbfp.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=45348
Cc: "10.4, 10.5" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Eric Anholt <eric@anholt.net>
(cherry picked from commit 89c96afe3c)
2015-03-04 00:38:23 +00:00
Lucas Stach
deea686c71 install-lib-links: don't depend on .libs directory
This snippet can be included in Makefiles that may, depending on the
project configuration, not actually build any installable libraries.

In that case we don't have anything to depend on and this part of
the makefile may be executed before the .libs directory is created,
so do not depend on it being there.

Cc: "10.3 10.4 10.5" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Signed-off-by: Lucas Stach <l.stach@pengutronix.de>
(cherry picked from commit 5c1aac17ad)
2015-03-04 00:38:11 +00:00
Emil Velikov
41bdeda102 docs: Add sha256 sums for the 10.4.5 release
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-02-21 12:31:51 +00:00
Emil Velikov
a5c608e951 Add release notes for the 10.4.5 release
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-02-21 12:22:08 +00:00
Emil Velikov
e0276bc297 Update version to 10.4.5
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-02-21 12:17:35 +00:00
Michel Dänzer
dc16fb1969 Revert "radeon/llvm: enable unsafe math for graphics shaders"
This reverts commit 0e9cdedd2e.

It caused the grass to disappear in The Talos Principle.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=89069
Cc: "10.5 10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Tom Stellard <thomas.stellard@amd.com>
Reviewed-by: Marek Olšák <marek.olsak@amd.com>
(cherry picked from commit 4db985a5fa)
2015-02-18 12:17:44 +00:00
Kenneth Graunke
aaa823569b glsl: Reduce memory consumption of copy propagation passes.
opt_copy_propagation and opt_copy_propagation_elements create new ACP
and Kill sets each time they enter a new control flow block.  For if
blocks, they also copy the entire existing ACP set contents into the
new set.

When we exit the control flow block, we discard the new sets.  However,
we weren't freeing them - so they lived on until the pass finished.
This can waste a lot of memory (57MB on one pessimal shader).

This patch makes the pass allocate ACP entries using this->acp as the
memory context, and Kill entries out of this->kill.  It also steals
kill entries when moving them from the inner kill list to the parent.

It then frees the lists, including their contents.

v2: Move ralloc_free(this->acp) just before this->acp = orig_acp
    (suggested by Eric Anholt).

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Eric Anholt <eric@anholt.net>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Cc: "10.5 10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 76960a55e6)
2015-02-18 12:17:44 +00:00
Laura Ekstrand
f57b41758d main: Fixed _mesa_GetCompressedTexImage_sw to copy slices correctly.
Previously array textures were not working with GetCompressedTextureImage,
leading to failures in the test
arb_direct_state_access/getcompressedtextureimage.c.

Tested-by: Laura Ekstrand <laura@jlekstrand.net>
Reviewed-by: Brian Paul <brianp@vmware.com>

Cc: "10.4, 10.5" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 92163482bd)
2015-02-18 12:17:44 +00:00
Marek Olšák
67ac6a3951 radeonsi: fix a crash if a stencil ref state is set before a DSA state
+ minor indentation fixes

Discovered by Axel Davy.

This can't be reproduced with any app, because all state trackers set a DSA
state first.

Cc: 10.5 10.4 10.3 <mesa-stable@lists.freedesktop.org>
Reviewed-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit 2ead74888a)
2015-02-18 12:17:44 +00:00
Marek Olšák
5d04b9eeed mesa: fix AtomicBuffer typo in _mesa_DeleteBuffers
Cc: 10.5 10.4 10.3 <mesa-stable@lists.freedesktop.org>
Reviewed-by: Brian Paul <brianp@vmware.com>
(cherry picked from commit e8625a29fe)
2015-02-18 12:17:43 +00:00
Marek Olšák
53041aecef radeonsi: small fix in SPI state
Cc: 10.5 10.4 <mesa-stable@lists.freedesktop.org>
Reviewed-by: Michel Dänzer <michel.daenzer@amd.com>

(cherry picked from commit a27b74819a)
[Emil Velikov: The file was renamed si_state_{shaders,draw}.c]
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>

Conflicts:
        src/gallium/drivers/radeonsi/si_state_shader.c
2015-02-18 12:14:04 +00:00
Ilia Mirkin
f76bcbb4cd nvc0: allow holes in xfb target lists
Tested with a modified xfb-streams test which outputs to streams 0, 2,
and 3.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.4 10.5" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 854eb06bee)
2015-02-18 12:09:55 +00:00
Ilia Mirkin
89289934fc st/mesa: treat resource-less xfb buffers as if they weren't there
If a transform feedback buffer's size is 0, st_bufferobj_data doesn't
end up creating a buffer for it. There's no point in trying to write to
such a buffer, so just pretend as if it's not really there.

This fixes arb_gpu_shader5-xfb-streams-without-invocations on nvc0.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Marek Olšák <marek.olsak@amd.com>
Cc: "10.4 10.5" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 80d373ed5b)
2015-02-18 12:09:54 +00:00
Ilia Mirkin
dbf82d753b nvc0: bail out of 2d blits with non-A8_UNORM alpha formats
This fixes the teximage-colors uploads with GL_ALPHA format and
non-GL_UNSIGNED_BYTE type.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.4 10.5" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 68e4f3f572)
2015-02-18 12:09:54 +00:00
Emil Velikov
b786e6332b get-pick-list.sh: Require explicit "10.4" for nominating stable patches
A nomination unadorned with a specific version is now interpreted as
being aimed at the 10.5 branch, which was recently opened.

Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-02-18 12:09:54 +00:00
Carl Worth
c0ce908a90 Revert use of Mesa IR optimizer for ARB_fragment_programs
Commit f82f2fb3dc added use of the Mesa
IR optimizer for both ARB_fragment_program and ARB_vertex_program, but
only justified the vertex-program portions with measured performance
improvements.

Meanwhile, the optimizer was seen to generate hundreds of unused
immediates without discarding them, causing failures.

Discard the use of the optimizer for now to fix the regression. (In
the future, we anticpate things moving from Mesa IR to NIR for better
optimization anyway.)

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=82477

Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>

CC: "10.3 10.4 10.5" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 55a57834bf)
2015-02-18 12:09:54 +00:00
Kenneth Graunke
c83c5f4b69 i965: Fix integer border color on Haswell.
+82 Piglits - 100% of border color tests now pass on Haswell.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Jason Ekstrand <jason.ekstrand@intel.com>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
Cc: mesa-stable@lists.freedesktop.org
(cherry picked from commit 08a06b6b89)
2015-02-18 12:09:54 +00:00
Kenneth Graunke
f2663112f6 i965: Use a gl_color_union for sampler border color.
This should have no effect, but will make it easier to implement other
bug fixes.

v2: Eliminate "unsigned one" local; just use the value where necessary.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Cc: mesa-stable@lists.freedesktop.org
(cherry picked from commit e1e73443c5)
2015-02-18 12:09:54 +00:00
Kenneth Graunke
2ad93851ff i965: Override swizzles for integer luminance formats.
The hardware's integer luminance formats are completely unusable;
currently we fall back to RGBA.  This means we need to override
the texture swizzle to obtain the XXX1 values expected for luminance
formats.

Fixes spec/EXT_texture_integer/texwrap formats bordercolor [swizzled]
on Broadwell - 100% of border color tests now pass on Broadwell.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
Cc: mesa-stable@lists.freedesktop.org
(cherry picked from commit 8cb18760cc)
2015-02-18 12:09:54 +00:00
Michel Dänzer
e35e6773c2 st/mesa: Don't use PIPE_USAGE_STREAM for GL_PIXEL_UNPACK_BUFFER_ARB
The latter currently implies CPU read access, so only PIPE_USAGE_STAGING
can be expected to be fast.

Mesa demos src/tests/streaming_rect on Kaveri (radeonsi):

Unpatched:  42 frames in  1.023 seconds = 41.056 FPS
Patched:   615 frames in  1.000 seconds = 615.000 FPS

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=88658
Cc: "10.3 10.4" <mesa-stable@lists.freedestkop.org>
Reviewed-by: Marek Olšák <marek.olsak@amd.com>
(cherry picked from commit a338dc0186)
2015-02-18 12:09:54 +00:00
Marek Olšák
51bdd19c97 radeonsi: fix instanced arrays with non-zero start instance
Fixes piglit ARB_base_instance/arb_base_instance-drawarrays.

Cc: 10.3 10.4 <mesa-stable@lists.freedesktop.org>
Reviewed-by: Michel Dänzer <michel.daenzer@amd.com>
(cherry picked from commit 50908a8918)
2015-02-18 12:09:54 +00:00
Marek Olšák
5c623ff071 r600g,radeonsi: don't append to streamout buffers that haven't been used yet
The FILLED_SIZE counter is uninitialized at the beginning, so we can't use it.
Instead, use offset = 0, which is what we always do when not appending.

This unexpectedly fixes spec/ARB_texture_multisample/sample-position/*.
Yes, the test does use transform feedback.

Cc: 10.3 10.4 <mesa-stable@lists.freedesktop.org>
Reviewed-by: Glenn Kennard <glenn.kennard@gmail.com>
Reviewed-by: Michel Dänzer <michel.daenzer@amd.com>
(cherry picked from commit 658f1d4cfe)
2015-02-18 12:09:53 +00:00
Jeremy Huddleston Sequoia
654f197f19 darwin: build fix
xfont.c:237:14: error: implicit declaration of function 'GetGLXDRIDrawable' is invalid in C99 [-Werror,-Wimplicit-function-declaration]
   glxdraw = GetGLXDRIDrawable(CC->currentDpy, CC->currentDrawable);
             ^
Fixes regression from 291be28476

Signed-off-by: Jeremy Huddleston Sequoia <jeremyhu@apple.com>
(cherry picked from commit e68b67b53f)
2015-02-11 00:24:04 -08:00
Jeremy Huddleston Sequoia
162cee83ba darwin: build fix
../../../src/mesa/main/compiler.h:47:10: fatal error: 'util/macros.h' file not found

Signed-off-by: Jeremy Huddleston Sequoia <jeremyhu@apple.com>
(cherry picked from commit 1c67a5687a)
2015-02-10 20:35:33 -08:00
Emil Velikov
54da987bae docs: Add sha256 sums for the 10.4.4 release
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-02-07 00:47:18 +00:00
Emil Velikov
62eb27ac8b Add release notes for the 10.4.4 release
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-02-07 00:17:09 +00:00
Emil Velikov
a824179af5 Update version to 10.4.4
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-02-07 00:12:04 +00:00
Park, Jeongmin
fecedb6c43 st/osmesa: Fix osbuffer->textures indexing
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=88930
Cc: 10.4 <mesa-stable@lists.freedesktop.org>
Reviewed-by: Brian Paul <brianp@vmware.com>
(cherry picked from commit 6fd4a61ad6)
2015-02-04 01:37:33 +00:00
Matt Turner
9d1d1f46c7 gallium/util: Don't use __builtin_clrsb in util_last_bit().
Unclear circumstances lead to undefined symbols on x86.

Bugzilla: https://bugs.gentoo.org/show_bug.cgi?id=536916
Cc: mesa-stable@lists.freedesktop.org
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
(cherry picked from commit 32e98e8ef0)
2015-02-04 01:37:20 +00:00
José Fonseca
b51d369690 egl: Pass the correct X visual depth to xcb_put_image().
The dri2_x11_add_configs_for_visuals() function happily matches a 32
bits EGLconfig with a 24 bits X visual.  However it was passing 32bits
depth to xcb_put_image(), making X server unhappy:

  https://github.com/apitrace/apitrace/issues/313#issuecomment-70571911

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 11a955aef4)
2015-02-02 00:12:04 +00:00
Niels Ole Salscheider
eab8dc28ed configure: Link against all LLVM targets when building clover
Since 8e7df519bd, we initialise all targets in
clover. This fixes bug 85380.

v2: Mention correct bug in commit message

Signed-off-by: Niels Ole Salscheider <niels_ole@salscheider-online.de>
Reviewed-by: Tom Stellard <thomas.stellard@amd.com>
Reviewed-by: Jan Vesely <jan.vesely@rutgers.edu>
Reviewed-by: Francisco Jerez <currojerez@riseup.net>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 4b94c3fc31)
2015-02-02 00:12:04 +00:00
Ville Syrjälä
cc580045a8 i965: Fix max_wm_threads for CHV
Change max_wm_threads to match the spec on CHV. The max number of
threads in 3DSTATE_PS is always programmed to 64 and the hardware
internally scales that depending on the GT SKU. So this doesn't
change the max number of threads actually used, but it does affect
the scratch space calculation.

On CHV the old value was too small, so the amount of scratch space
allocated wasn't sufficient to satisfy the actual max number of
threads used.

Cc: mesa-stable@lists.freedesktop.org
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
Signed-off-by: Ville Syrjälä <ville.syrjala@linux.intel.com>
(cherry picked from commit 99754446ab)
2015-02-02 00:12:04 +00:00
Mario Kleiner
0d721fa1d6 glx/dri3: Request non-vsynced Present for swapinterval zero. (v3)
Restores proper immediate tearing swap behaviour for
OpenGL bufferswap under DRI3/Present.

Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>

v2: Add Frank Binns signed off by for his original earlier
patch from April 2014, which is identical to this one, and
Chris Wilsons reviewed tag from May 2014 for that patch, ergo
also for this one.

v3: Incorporate comment about triple buffering as suggested
by Axel Davy, and reference to relevant spec provided by
Eric Anholt.

Signed-off-by: Frank Binns <frank.binns@imgtec.com>
Signed-off-by: Mario Kleiner <mario.kleiner.de@gmail.com>
Reviewed-by: Chris Wilson <chris@chris-wilson.co.uk>
Reviewed-by: Axel Davy <axel.davy@ens.fr>
Reviewed-by: Eric Anholt <eric@anholt.net>
(cherry picked from commit 455d3036fa)
2015-02-02 00:12:04 +00:00
Brian Paul
c96ed76b3d mesa: fix display list 8-byte alignment issue
The _mesa_dlist_alloc() function is only guaranteed to return a pointer
with 4-byte alignment.  On 64-bit systems which don't support unaligned
loads (e.g. SPARC or MIPS) this could lead to a bus error in the VBO code.

The solution is to add a new  _mesa_dlist_alloc_aligned() function which
will return a pointer to an 8-byte aligned address on 64-bit systems.
This is accomplished by inserting a 4-byte NOP instruction in the display
list when needed.

The only place this actually matters is the VBO code where we need to
allocate a 'struct vbo_save_vertex_list' which needs to be 8-byte
aligned (just as if it were malloc'd).

The gears demo and others hit this bug.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=88662
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: José Fonseca <jfonseca@vmware.com>
(cherry picked from commit 53b01938ed)
2015-01-30 08:51:51 -07:00
Emil Velikov
49a5bce780 docs: Add sha256 sums for the 10.4.3 release
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-01-24 12:54:33 +00:00
Emil Velikov
e92bfa3f95 Add release notes for the 10.4.3 release
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-01-24 12:49:17 +00:00
Emil Velikov
f70e4d4afd Update version to 10.4.3
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-01-24 12:44:46 +00:00
Axel Davy
42806f12a9 st/nine: Allocate vs constbuf buffer for indirect addressing once.
When the shader does indirect addressing on the constants,
we allocate a temporary constant buffer to which we copy
the constants from the app given user constants and
the constants filled in the shader.

This patch makes this buffer be allocated once.

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Signed-off-by: Tiziano Bacocco <tizbac2@gmail.com>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit f8a74410f1)
2015-01-23 00:47:26 +00:00
Axel Davy
4c9b64fc44 st/nine: Allocate the correct size for the user constant buffer
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit e0f75044c8)
2015-01-23 00:47:26 +00:00
Axel Davy
69c7cf70e7 st/nine: Add variables containing the size of the constant buffers
Reviewed-by: Tiziano Bacocco <tizbac2@gmail.com>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit b9cbea9dbc)
2015-01-23 00:47:26 +00:00
Axel Davy
4d04fd0871 st/nine: Fix sm3 relative addressing for non-debug build
Relative addressing needs the constant buffer to get all
the correct constants, even those defined by the shader.

The code to copy the shader constants to the constant buffer
was enabled only for debug build. Enable it always.

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit a721987077)
2015-01-23 00:47:25 +00:00
Axel Davy
0727ab961c st/nine: Remove unused code for ps
Since constant indirect adressing is not allowed for ps,
we can remove our code to handle that.

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 4b7a9cfddb)
2015-01-23 00:47:25 +00:00
Axel Davy
7280ddea9d st/nine: Correct rules for relative adressing and constants.
relative adressing for constants is possible only for vs float
constants.

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 9690bf33d7)
2015-01-23 00:47:25 +00:00
Axel Davy
425bc89720 st/nine: Implement TEXREG2AR, TEXREG2GB and TEXREG2RGB
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit bce94ce831)
2015-01-23 00:47:25 +00:00
Axel Davy
0b3f8c72f7 st/nine: Implement TEXDP3TEX
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 9e23b64c15)
2015-01-23 00:47:25 +00:00
Axel Davy
63e668eb18 st/nine: Implement TEXDP3
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 09eb1e901f)
2015-01-23 00:47:24 +00:00
Axel Davy
2b4c577730 st/nine: Implement TEXDEPTH
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit f19e699368)
2015-01-23 00:47:24 +00:00
Axel Davy
e3a393b4c3 st/nine: Implement TEXM3x3SPEC
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 3676ab02fb)
2015-01-23 00:47:24 +00:00
Axel Davy
7ecd0f9528 st/nine: Implement TEXM3x2TEX
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 2b9f079ae3)
2015-01-23 00:47:24 +00:00
Axel Davy
336887bca1 st/nine: implement TEXM3x2DEPTH
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit fdff111dc8)
2015-01-23 00:47:24 +00:00
Axel Davy
8e08ba6f96 st/nine: Fix TEXM3x3 and implement TEXM3x3VSPEC
The fix is that this line:
"src[s] = tx->regs.vT[s];" is wrong if s doesn't start from 0.
Instead access tx->regs.vT directly when needed.

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 7865210670)

Conflicts:
	src/gallium/state_trackers/nine/nine_shader.c
2015-01-23 00:47:09 +00:00
Axel Davy
77e1136f44 st/nine: Fill missing dst and src number for some instructions.
Not filling them correctly results in bad padding and later crash.

Reviewed-by: David Heidelberg <david@ixit.cz>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit b1259544e3)
2015-01-23 00:44:42 +00:00
Axel Davy
22c75f9f5a st/nine: Implement TEXCOORD special behaviours
texcoord for ps < 1_4 should clamp between 0 and 1 the values.

texcrd (texcoord ps 1_4) does not clamp and can be used with
two modifiers _dw and _dz that means the channels are divided
by w or z.
Implement those in shared code, since the same modifiers can be used
for texld ps 1_4.

v2: replace DIV by RCP + MUL
v3: Remove an useless MOV

Reviewed-by: Tiziano Bacocco <tizbac2@gmail.com>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 5399119fb1)

Conflicts:
	src/gallium/state_trackers/nine/nine_shader.c
2015-01-23 00:43:57 +00:00
Axel Davy
4b65be8860 st/nine: Fix some fixed function pipeline operation
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 6378d74937)
2015-01-22 23:43:28 +00:00
Axel Davy
9ea8e7f0df st/nine: Clamp ps 1.X constants
This is wine (and windows) behaviour.

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 018407b5d8)
2015-01-22 23:43:28 +00:00
Axel Davy
d0d09a4eee st/nine: Fix CND implementation
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Signed-off-by: Tiziano Bacocco <tizbac2@gmail.com>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 3ca67f8810)
2015-01-22 23:43:27 +00:00
Axel Davy
75f39e45f0 st/nine: Rewrite LOOP implementation, and a0 aL handling
Previous implementation didn't work well with nested loops.

Instead of using several address registers, put a0 and aL
into normal registers, and copy them to one address register when
we need to use them.

Wine tests loop_index_test() and nested_loop_test() now pass correctly.

Fixes r600g crash while loading Bioshock -
bug https://bugs.freedesktop.org/show_bug.cgi?id=85696

Tested-by: David Heidelberg <david@ixit.cz>
Reviewed-by: Tiziano Bacocco <tizbac2@gmail.com>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 6a8e5e48be)
2015-01-22 23:43:27 +00:00
Axel Davy
553089093f st/nine: Correct LOG on negative values
We should take the absolute value of the input.

Also return -FLT_MAX instead of -Inf for an input of 0.

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit c9aa9a0add)
2015-01-22 23:43:27 +00:00
Axel Davy
add30f01ef st/nine: Handle NRM with input of null norm
When the input's xyz are 0.0, the output
should be 0.0. This is due to the fact that
Inf * 0 = 0 for dx9. To handle this case,
cap the result of RSQ to FLT_MAX. We have
FLT_MAX * 0 = 0.

Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit f5e8e3fb80)
2015-01-22 23:43:27 +00:00
Axel Davy
0dfb9c9e86 st/nine: Handle RSQ special cases
We should use the absolute value of the input as input to ureg_RSQ.

Moreover, an input of 0.0 should return FLT_MAX.

Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 2487f73574)
2015-01-22 23:43:27 +00:00
Axel Davy
7e26cf83ba st/nine: Fix POW implementation
POW doesn't match directly TGSI, since we should
take the absolute value of src0.

Fixes black textures in some games

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit c12f8c2088)
2015-01-22 23:43:27 +00:00
Axel Davy
00d22ce0fa st/nine: Fix typo for M4x4
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit e0dd9ca985)
2015-01-22 23:43:26 +00:00
Axel Davy
7f700cc35b st/nine: Correctly declare NineTranslateInstruction_Mkxn inputs
Let's say we have c1 and c2 declared in the shader and c0 given by the app

Then here we would have read c0, c1 and c2 given by the app, instead
of the correct c0, c1, c2.

This correction fixes several issues in some games.

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 53dc992f20)
2015-01-22 23:43:26 +00:00
Axel Davy
e6167e749c st/nine: Saturate oFog and oPts vs outputs
According to docs and Wine, these two vs outputs have
to be saturated.

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 9fb58a74a0)
2015-01-22 23:43:26 +00:00
Axel Davy
bce0058333 st/nine: Remove some shader unused code
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit a214838181)
2015-01-22 23:43:26 +00:00
Axel Davy
9a0647ba7f st/nine: Convert integer constants to floats before storing them when cards don't support integers
The shader code is already behaving as if they are floats when the the card doesn't support integers

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit d08c7b0b88)
2015-01-22 23:43:26 +00:00
Axel Davy
669c5d6d44 st/nine: Rework of boolean constants
Convert them to shader booleans at earlier stage.
Previous code is fine, but later patch will make
integers being converted at earlier stage, so do
the same for booleans

Reviewed-by: Tiziano Bacocco <tizbac2@gmail.com>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit d9d18fe39f)
2015-01-22 23:43:26 +00:00
Axel Davy
87ac37074f st/nine: Add ATI1 and ATI2 support
Adds ATI1 and ATI2 support to nine.

They map to PIPE_FORMAT_RGTC1_UNORM and PIPE_FORMAT_RGTC2_UNORM,
but need special handling.

Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Signed-off-by: Xavier Bouchoux <xavierb@gmail.com>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 77f0ecf9ce)
2015-01-22 23:43:25 +00:00
Axel Davy
e1bcca4f13 st/nine: Check if srgb format is supported before trying to use it.
According to msdn, we must act as if user didn't ask srgb if we don't
support it.

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit b0b5430322)
2015-01-22 23:43:25 +00:00
Stanislaw Halik
50ea1c1f5f st/nine: Hack to generate resource if it doesn't exist when getting view
Buffers in the MANAGED pool are supposed to have the content in a ram buffer,
a copy in VRAM if there is enough memory (driver manages memory and decide when
to delete the buffer in VRAM).

This is not implemented properly in nine, and a VRAM copy is going to be created
when the RAM memory is filled, and the VRAM copy will get synced with the RAM
memory updates.

Due to some issues (in the implementation or in app logic), it can happen
we try to create a sampler view of the resource while we haven't created the
VRAM resource. This hack creates the resource when we hit this case, which prevents
crashing, but doesn't help with the resource content.

This fixes several games crashing at launch.

Acked-by: Axel Davy <axel.davy@ens.fr>
Acked-by: David Heidelberg <david@ixit.cz>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Stanislaw Halik <sthalik@misaki.pl>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 82810d3b66)
2015-01-22 23:43:25 +00:00
Axel Davy
3ca8b93476 st/nine: NineBaseTexture9: update sampler view creation
While previous code was having the correct behaviour in general,
this new code is more readable (without checking all gallium formats
manually) and has a more defined behaviour for depth stencil resources.

Reviewed-by: Tiziano Bacocco <tizbac2@gmail.com>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 47280d777d)
2015-01-22 23:43:25 +00:00
Axel Davy
d06b403377 st/nine: Return D3DERR_INVALIDCALL when trying to create a texture of bad format
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit 0abfb80dac)
2015-01-22 23:43:12 +00:00
Axel Davy
481af42f28 st/nine: Fix crash when deleting non-implicit swapchain
The implicit swapchains are destroyed when the device instance is
destroyed. However for non-implicit swapchains, it is not the case,
and the application can have kept an reference on the swapchain
buffers to reuse them.

Fixes problems with battle.net launcher.

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Tested-by: Nick Sarnie <commendsarnex@gmail.com>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit 0d2c22e648)
2015-01-22 23:41:09 +00:00
Axel Davy
393fffd07d st/nine: CubeTexture: fix GetLevelDesc
This->surfaces contains the surfaces associated to the levels
and faces. This->surfaces[6*Level] is what we want here,
since it gives us a face descriptor for the level 'Level'.

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Signed-off-by: Xavier Bouchoux <xavierb@gmail.com>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 9232161178)
2015-01-22 23:41:08 +00:00
Axel Davy
c159b4095c st/nine: NineBaseTexture9: fix setting of last_layer
Use same similar settings as u_sampler_view_default_template

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 18c7e70226)
2015-01-22 23:41:08 +00:00
Axel Davy
b80b5b35a3 st/nine: Correctly advertise D3DPMISCCAPS_CLIPTLVERTS
The cap means D3DFVF_XYZRHW vertices will see clipping.
This is not the case when
PIPE_CAP_TGSI_VS_WINDOW_SPACE_POSITION is supported, since
it'll disable clipping.

Reviewed-by: Tiziano Bacocco <tizbac2@gmail.com>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 05e20e1045)
2015-01-22 23:41:08 +00:00
Xavier Bouchoux
41ca03a7b4 st/nine: Fix D3DRS_POINTSPRITE support
It's done by testing the existence of the point sprite output register *after* parsing the vertex shader.

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Reviewed-by: Axel Davy <axel.davy@ens.fr>
Signed-off-by: Xavier Bouchoux <xavierb@gmail.com>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit dc88989189)
2015-01-22 23:41:08 +00:00
Axel Davy
18ac34825b st/nine: Add new texture format strings
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit d2f2a550cf)
2015-01-22 23:41:07 +00:00
Xavier Bouchoux
15ef84ccfb st/nine: Add missing c++ declaration for IDirect3DVolumeTexture9
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Reviewed-by: Axel Davy <axel.davy@ens.fr>
Signed-off-by: Xavier Bouchoux <xavierb@gmail.com>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 072e2ba8e1)
2015-01-22 23:41:07 +00:00
Xavier Bouchoux
44ee59d300 st/nine: Additional defines to d3dtypes.h
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Reviewed-by: Axel Davy <axel.davy@ens.fr>
Signed-off-by: Xavier Bouchoux <xavierb@gmail.com>

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 8bb550b958)
2015-01-22 23:41:07 +00:00
Jose Fonseca
1e0ab5b826 nine: Drop use of TGSI_OPCODE_CND.
This was the only state tracker emitting it, and hardware was just having
to lower it anyway (or failing to lower it at all).

v2: Extracted from a larger patch by Jose (which also dropped DP2A), fixed
    to actually not reference TGSI_OPCODE_CND.  Change by anholt.

Reviewed-by: Jose Fonseca <jfonseca@vmware.com>
Reviewed-by: Axel Davy <axel.davy@ens.fr>
Reviewed-by: David Heidelberg <david@ixit.cz>
(cherry picked from commit 925cb75f89)
2015-01-22 23:40:09 +00:00
Jonathan Gray
a3381286d8 glsl: Link glsl_test with pthreads library.
Otherwise pthread_mutex_lock will be an undefined reference
on OpenBSD.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=88219
Signed-off-by: Jonathan Gray <jsg@jsg.id.au>
Reviewed-by: Emil Velikov <emil.l.velikov@gmail.com>
Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit c5be9c126d)
2015-01-22 22:27:12 +00:00
Kenneth Graunke
882f702441 i965: Work around mysterious Gen4 GPU hangs with minimal state changes.
Gen4 hardware appears to GPU hang frequently when using Chromium, and
also when running 'glmark2 -b ideas'.  Most of the error states contain
3DPRIMITIVE commands in quick succession, with very few state packets
between them - usually VERTEX_BUFFERS/ELEMENTS and CONSTANT_BUFFER.

I trimmed an apitrace of the glmark2 hang down to two draw calls with a
glUniformMatrix4fv call between the two.  Either draw by itself works
fine, but together, they hang the GPU.  Removing the glUniform call
makes the hangs disappear.  In the hardware state, this translates to
removing the CONSTANT_BUFFER packet between the two 3DPRIMITIVE packets.

Flushing before emitting CONSTANT_BUFFER packets also appears to make
the hangs disappear.  I observed a slowdown in glxgears by doing it all
the time, so I've chosen to only do it when BRW_NEW_BATCH and
BRW_NEW_PSP are unset (i.e. we haven't done a CS_URB_STATE change or
already flushed the whole pipeline).

I'd much rather understand the problem, but at this point, I don't see
how we'd ever be able to track it down further.  We have no real tools,
and the hardware people moved on years ago.  I've analyzed 20+ error
states and read every scrap of documentation I could find.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=80568
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=85367
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Acked-by: Matt Turner <mattst88@gmail.com>
Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit c4fd0c9052)
2015-01-22 16:11:03 +00:00
Jason Ekstrand
a25e26f67f mesa: Fix clamping to -1.0 in snorm_to_float
This patch fixes the return of a wrong value when x is lower than
-MAX_INT(src_bits) as the result would not be between [-1.0 1.0].

v2 by Samuel Iglesias <siglesias@igalia.com>:
    - Modify snorm_to_float() to avoid doing the division when
      x == -MAX_INT(src_bits)

Cc: 10.4 <mesa-stable@lists.freedesktop.org>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Jason Ekstrand <jason.ekstrand@intel.com>
(cherry picked from commit 7d1b08ac44)
2015-01-17 14:59:56 +00:00
Kenneth Graunke
021d71b848 i965: Respect the no_8 flag on Gen6, not just Gen7+.
When doing repclears, we only want to use the SIMD16 program, not the
SIMD8 one.  Kristian added this to the Gen7+ code, but apparently we
missed it in the Gen6 code.  This patch copies that code over.

Approximately doubles the performance in a clear microbenchmark from
mesa-demos (clearspd -width 500 -height 500 +color) on Sandybridge.

Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Kristian Høgsberg <krh@bitplanet.net>
Reviewed-by: Matt Turner <mattst88@gmail.com>
References: https://code.google.com/p/chrome-os-partner/issues/detail?id=34681
(cherry picked from commit f95733ddb7)

Conflicts:
	src/mesa/drivers/dri/i965/gen6_wm_state.c
2015-01-17 14:59:08 +00:00
Emil Velikov
14f1659b43 docs: Add sha256 sums for the 10.4.2 release
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-01-12 10:37:09 +00:00
Emil Velikov
02f2e97c3e Add release notes for the 10.4.2 release
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-01-12 10:30:28 +00:00
Emil Velikov
5906dd6c99 Update version to 10.4.2
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2015-01-12 10:24:59 +00:00
Dave Airlie
2d05942b74 r600g/sb: implement r600 gpr index workaround. (v3.1)
r600, rv610 and rv630 all have a bug in their GPR indexing
and how the hw inserts access to PV.

If the base index for the src is the same as the dst gpr
in a previous group, then it will use PV instead of using
the indexed gpr correctly.

The workaround is to insert a NOP when you detect this.

v2: add second part of fix detecting DST rel writes followed
by same src base index reads.

v3: forget adding stuff to structs, just iterate over the
previous node group again, makes it more obvious.
v3.1: drop local_nop.

Fixes ~200 piglit regressions on rv635 since SB was introduced.

Reviewed-By: Glenn Kennard <glenn.kennard@gmail.com>
Signed-off-by: Dave Airlie <airlied@redhat.com>
(cherry picked from commit 3c8ef3a74b)
2015-01-07 17:39:52 +00:00
Dave Airlie
099ed78a04 r600g: fix regression since UCMP change
Since d8da6decea where the
state tracker started using UCMP on cayman a number of tests
regressed.

this seems to be r600g is doing CNDGE_INT for UCMP which is >= 0,
we should be doing CNDE_INT with reverse arguments.

Reviewed-by: Glenn Kennard <glenn.kennard@gmail.com>
Signed-off-by: Dave Airlie <airlied@redhat.com>
(cherry picked from commit 0d4272cd8e)
2015-01-07 17:35:39 +00:00
Vadim Girlin
91c5770ba1 r600g/sb: fix issues with loops created for switch
Signed-off-by: Dave Airlie <airlied@redhat.com>
(cherry picked from commit de0fd375f6)
2015-01-07 17:31:12 +00:00
Dave Airlie
3306ed6fd7 Revert "r600g/sb: fix issues cause by GLSL switching to loops for switch"
This reverts commit 7b0067d23a.

Vadim's patch fixes this a lot better.

(cherry picked from commit 34e512d9ea)
2015-01-07 17:29:01 +00:00
Marek Olšák
81f8006f7d radeonsi: fix VertexID for OpenGL
This fixes all failing piglit VertexID tests.

Cc: 10.4 <mesa-stable@lists.freedesktop.org>
Reviewed-by: Michel Dänzer <michel.daenzer@amd.com>
(cherry picked from commit d7c6f397f4)
2015-01-07 17:25:06 +00:00
Marek Olšák
1b498cf5b7 st/mesa: fix GL_PRIMITIVE_RESTART_FIXED_INDEX
Cc: 10.2 10.3 10.4 <mesa-stable@lists.freedesktop.org>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit eaae92a349)
2015-01-07 17:04:21 +00:00
Marek Olšák
8c77be7ef9 vbo: ignore primitive restart if FixedIndex is enabled in DrawArrays
From GL 4.4 Core profile:

  If both PRIMITIVE_RESTART and PRIMITIVE_RESTART_FIXED_INDEX are
  enabled, the index value determined by PRIMITIVE_RESTART_FIXED_INDEX is
  used. If PRIMITIVE_RESTART_FIXED_INDEX is enabled, primitive restart is not
  performed for array elements transferred by any drawing command not taking a
  type parameter, including all of the *Draw* commands other than *DrawEle-
  ments*.

Cc: 10.2 10.3 10.4 <mesa-stable@lists.freedesktop.org>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 8f5d309521)
2015-01-07 16:51:02 +00:00
Leonid Shatz
ef43d21bbc gallium/util: make sure cache line size is not zero
The "normal" detection (querying clflush size) already made sure it is
non-zero, however another method did not. This lead to crashes if this
value happened to be zero (apparently can happen in virtualized environments
at least).
This fixes https://bugs.freedesktop.org/show_bug.cgi?id=87913

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 5fea39ace3)
2015-01-06 16:21:03 +00:00
Roland Scheidegger
ac3ca98a1b gallium/util: fix crash with daz detection on x86
The code used PIPE_ALIGN_VAR for the variable used by fxsave, however this
does not work if the stack isn't aligned. Hence use PIPE_ALIGN_STACK function
decoration to fix the segfault which can happen if stack alignment is only
4 bytes.
This fixes https://bugs.freedesktop.org/show_bug.cgi?id=87658.

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit b59c7ed0ab)
2015-01-06 16:02:10 +00:00
Ilia Mirkin
af1a690075 nv50/ir: fix texture offsets in release builds
assert's get compiled out in release builds, so they can't be relied
upon to perform logic.

Reported-by: Pierre Moreau <pierre.morrow@free.fr>
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Tested-by: Roy Spliet <rspliet@eclipso.eu>
Cc: "10.2 10.3 10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit fb1afd1ea5)
2015-01-06 15:52:12 +00:00
Chad Versace
fffe533f08 i965: Use safer pointer arithmetic in gather_oa_results()
This patch reduces the likelihood of pointer arithmetic overflow bugs in
gather_oa_results(), like the one fixed by b69c7c5dac.

I haven't yet encountered any overflow bugs in the wild along this
patch's codepath. But I get nervous when I see code patterns like this:

   (void*) + (int) * (int)

I smell 32-bit overflow all over this code.

This patch retypes 'snapshot_size' to 'ptrdiff_t', which should fix any
potential overflow.

Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
Signed-off-by: Chad Versace <chad.versace@linux.intel.com>
(cherry picked from commit 414be86c96)
2015-01-04 21:39:10 +00:00
Chad Versace
4d5e0f78b7 i965: Use safer pointer arithmetic in intel_texsubimage_tiled_memcpy()
This patch reduces the likelihood of pointer arithmetic overflow bugs in
intel_texsubimage_tiled_memcpy() , like the one fixed by b69c7c5dac.

I haven't yet encountered any overflow bugs in the wild along this
patch's codepath. But I recently solved, in commit b69c7c5dac, an overflow
bug in a line of code that looks very similar to pointer arithmetic in
this function.

This patch conceptually applies the same fix as in b69c7c5dac. Instead
of retyping the variables, though, this patch adds some casts. (I tried
to retype the variables as ptrdiff_t, but it quickly got very messy. The
casts are cleaner).

Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
Signed-off-by: Chad Versace <chad.versace@linux.intel.com>
(cherry picked from commit 225a09790d)
2015-01-04 21:39:00 +00:00
Marek Olšák
b9e56ea151 glsl_to_tgsi: fix a bug in copy propagation
This fixes the new piglit test: arb_uniform_buffer_object/2-buffers-bug

Cc: 10.2 10.3 10.4 <mesa-stable@lists.freedesktop.org>
Reviewed-by: Brian Paul <brianp@vmware.com>
(cherry picked from commit 48094d0e65)
2015-01-04 21:38:26 +00:00
Kenneth Graunke
e05c595acd i965: Fix start/base_vertex_location for >1 prims but !BRW_NEW_VERTICES.
This is a partial revert of c89306983c.
It split the {start,base}_vertex_location handling into several steps:

1. Set brw->draw.start_vertex_location = prim[i].start
   and brw->draw.base_vertex_location = prim[i].basevertex.
   (This happened once per _mesa_prim, in the main drawing loop.)
2. Add brw->vb.start_vertex_bias and brw->ib.start_vertex_offset
   appropriately.  (This happened in brw_prepare_shader_draw_parameters,
   which was called just after brw_prepare_vertices, as part of state
   upload, and only happened when BRW_NEW_VERTICES was flagged.)
3. Use those values when emitting 3DPRIMITIVE (once per _mesa_prim).

If we drew multiple _mesa_prims, but didn't flag BRW_NEW_VERTICES on
the second (or later) primitives, we would do step #1, but not #2.
The first _mesa_prim would get correct values, but subsequent ones
would only get the first half of the summation.

The reason I originally did this was because I needed the value of
gl_BaseVertexARB to exist in a buffer object prior to uploading
3DSTATE_VERTEX_BUFFERS.  I believed I wanted to upload the value
of 3DPRIMITIVE's "Base Vertex Location" field, which was computed
as: (prims[i].indexed ? prims[i].start : prims[i].basevertex) +
brw->vb.start_vertex_bias.  The latter value wasn't available until
after brw_prepare_vertices, and the former weren't available in the
state upload code at all.  Hence the awkward split.

However, I believe that including brw->vb.start_vertex_bias was a
mistake.  It's an extra bias we apply when uploading vertex data into
VBOs, to move [min_index, max_index] to [0, max_index - min_index].

>From the GL_ARB_shader_draw_parameters specification:
"<gl_BaseVertexARB> holds the integer value passed to the <baseVertex>
 parameter to the command that resulted in the current shader
 invocation.  In the case where the command has no <baseVertex>
 parameter, the value of <gl_BaseVertexARB> is zero."

I conclude that gl_BaseVertexARB should only include the baseVertex
parameter from glDraw*Elements*, not any internal biases we add for
optimization purposes.

With that in mind, gl_BaseVertexARB only needs prim[i].start or
prim[i].basevertex.  We can simply store that, and go back to computing
start_vertex_location and base_vertex_location in brw_emit_prim(), like
we used to.  This is much simpler, and should actually fix two bugs.

Fixes missing geometry in Unvanquished.

Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=85529
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Acked-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
(cherry picked from commit c633528cba)
2015-01-04 21:38:16 +00:00
Ilia Mirkin
c48d0d8dd2 nv50,nvc0: set vertex id base to index_bias
Fixes the piglits which check that gl_VertexID includes the base vertex
offset:
  arb_draw_indirect-vertexid elements
  gl-3.2-basevertex-vertexid

Note that this leaves out the original G80, for which this will continue
to fail. It could be fixed by passing a driver constbuf value in, but
that's beyond the scope of this change.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit be0311c962)
2015-01-04 21:37:51 +00:00
Tiziano Bacocco
aafd13027a nv50,nvc0: implement half_pixel_center
LAST_LINE_PIXEL has actually been renamed to PIXEL_CENTER_INTEGER in
rnndb; use that method to implement the rasterizer setting, used for
st/nine.

Signed-off-by: Tiziano Bacocco <tizbac2@gmail.com>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 609c3e51f5)
2015-01-04 21:37:32 +00:00
Michel Dänzer
1f42230fa7 radeonsi: Don't modify PA_SC_RASTER_CONFIG register value if rb_mask == 0
E.g. this could happen on older kernels which don't support the
RADEON_INFO_SI_BACKEND_ENABLED_MASK query yet. The code in
si_write_harvested_raster_configs() doesn't deal with this correctly and
would probably mangle the value badly.

Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Marek Olšák <marek.olsak@amd.com>
Reviewed-by: Tom Stellard <thomas.stellard@amd.com>
(cherry picked from commit b3057f8097)
2015-01-04 21:34:08 +00:00
Kenneth Graunke
2b85ed72db i965: Add missing BRW_NEW_*_PROG_DATA to texture/renderbuffer atoms.
This was probably missed when moving from a fixed binding table layout
to a dynamic one that changes based on the shader.

Fixes newly proposed Piglit test fbo-mrt-new-bind.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=87619
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
Reviewed-by: Mike Stroyan <mike@LunarG.com>
Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 4616b2ef85)
2015-01-04 21:33:26 +00:00
Emil Velikov
4cd38a592e docs: Add sha256 sums for the 10.4.1 release
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2014-12-30 02:38:02 +00:00
Emil Velikov
60e2e04fe8 Add release notes for the 10.4.1 release
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2014-12-30 02:11:34 +00:00
Emil Velikov
1a3df8cc77 Update version to 10.4.1
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2014-12-30 02:07:33 +00:00
Emil Velikov
45416a255f Revert "glx/dri3: Request non-vsynced Present for swapinterval zero. (v3)"
This reverts commit ee241a6889.

May not be the correct fix. Discussion is ongoing.

http://lists.freedesktop.org/archives/mesa-dev/2014-December/072969.html
2014-12-30 01:03:14 +00:00
Cody Northrop
fb3f7c0bc5 i965: Require pixel alignment for GPU copy blit
The blitter will start at a pixel's natural alignment. For PBOs, if the
provided offset if not aligned, bits will get dropped.

This change adds offset alignment check for src and dst, kicking back if
the requirements are not met.

The change is based on following verbiage from BSPEC:
 Color pixel sizes supported are 8, 16, and 32 bits per pixel (bpp).
 All pixels are naturally aligned.

Found in the following locations:
page 35 of intel-gfx-prm-osrc-hsw-blitter.pdf
page 29 of ivb_ihd_os_vol1_part4.pdf
page 29 of snb_ihd_os_vol1_part5.pdf

This behavior was observed with Steam Big Picture rendering incorrect
icon colors.  The fix has been tested on Ubuntu and SteamOS on Haswell.

Signed-off-by: Cody Northrop <cody@lunarg.com>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=83908
Reviewed-by: Neil Roberts <neil@linux.intel.com>
(cherry picked from commit 83e8bb5b1a)
Nominated-by: Matt Turner <mattst88@gmail.com>
2014-12-21 21:19:31 +00:00
Ian Romanick
4f570f2fb3 linker: Assign varying locations geometry shader inputs for SSO
Previously only geometry shader outputs would be assigned locations if
the geometry shader was the only stage in the linked program.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
Cc: pavol@klacansky.com
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=82585
Reviewed-by: Jordan Justen <jordan.l.justen@intel.com>
(cherry picked from commit a909b995d9)
Nominted-by: Ian Romanick <ian.d.romanick@intel.com>
2014-12-21 21:18:09 +00:00
Ian Romanick
a4c8348597 linker: Wrap access of producer_var with a NULL check
producer_var could be NULL if consumer_var is not NULL and
consumer_is_fs is false.  This will occur when the producer is NULL and
the consumer is the geometry shader for a program that contains only a
geometry shader.  This will occur starting with the next patch.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
Cc: pavol@klacansky.com
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=82585
Reviewed-by: Jordan Justen <jordan.l.justen@intel.com>
(cherry picked from commit 5eca78a00a)
Nominated-by: Ian Romanick <ian.d.romanick@intel.com>
2014-12-21 21:17:45 +00:00
Maxence Le Doré
893583776e glsl: Add gl_MaxViewports to available builtin constants
It seems to have been forgotten during viewports array implementation time.

Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Matt Turner <mattst88@gmail.com>
(cherry picked from commit 19e05d6898)
2014-12-21 21:17:24 +00:00
Andres Gomez
2d669f6583 i965/brw_reg: struct constructor now needs explicit negate and abs values.
We were assuming, when constructing a new brw_reg struct, that the
negate and abs register modifiers would not be present by default in
the new register.

Now, we force explicitly setting these values when constructing a new
register.

This will avoid problems like forgetting to properly set them when we
are using a previous register to generate this new register, as it was
happening in the dFdx and dFdy generation functions.

Fixes piglit test shaders/glsl-deriv-varyings

Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=82991
Reviewed-by: Matt Turner <mattst88@gmail.com>
(cherry picked from commit 8517e665bc)
2014-12-21 21:17:16 +00:00
Mario Kleiner
bccfe7ae0f glx/dri3: Don't fail on glXSwapBuffersMscOML(dpy, window, 0, 0, 0) (v2)
glXSwapBuffersMscOML() with target_msc=divisor=remainder=0 gets
translated into target_msc=divisor=0 but remainder=1 by the mesa
api. This is done for server DRI2 where there needs to be a way
to tell the server-side DRI2ScheduleSwap implementation if a call
to glXSwapBuffers() or glXSwapBuffersMscOML(dpy,window,0,0,0) was
done. remainder = 1 was (ab)used as a flag to tell the server to
select proper semantic. The DRI3/Present backend ignored this
signalling, treated any target_msc=0 as glXSwapBuffers() request,
and called xcb_present_pixmap with invalid divisor=0, remainder=1
combo. The present extension responded kindly to this with a
BadValue error and dropped the request, but mesa's DRI3/Present
backend doesn't check for error codes. From there on stuff went
downhill quickly for the calling OpenGL client...

This patch fixes the problem.

v2: Change comments to be more clear, with reference to
relevant spec, as suggested by Eric Anholt.

Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Mario Kleiner <mario.kleiner.de@gmail.com>
Reviewed-by: Axel Davy <axel.davy@ens.fr>
Reviewed-by: Eric Anholt <eric@anholt.net>
(cherry picked from commit 0d7f4c8658)
2014-12-14 15:45:27 +00:00
Mario Kleiner
ee241a6889 glx/dri3: Request non-vsynced Present for swapinterval zero. (v3)
Restores proper immediate tearing swap behaviour for
OpenGL bufferswap under DRI3/Present.

Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>

v2: Add Frank Binns signed off by for his original earlier
patch from April 2014, which is identical to this one, and
Chris Wilsons reviewed tag from May 2014 for that patch, ergo
also for this one.

v3: Incorporate comment about triple buffering as suggested
by Axel Davy, and reference to relevant spec provided by
Eric Anholt.

Signed-off-by: Frank Binns <frank.binns@imgtec.com>
Signed-off-by: Mario Kleiner <mario.kleiner.de@gmail.com>
Reviewed-by: Chris Wilson <chris@chris-wilson.co.uk>
Reviewed-by: Axel Davy <axel.davy@ens.fr>
Reviewed-by: Eric Anholt <eric@anholt.net>
(cherry picked from commit 455d3036fa)
2014-12-14 15:45:21 +00:00
Mario Kleiner
4b37a18da5 glx/dri3: Track separate (ust, msc) for PresentPixmap vs. PresentNotifyMsc (v2)
Prevent calls to glXGetSyncValuesOML() and glXWaitForMscOML()
from overwriting the (ust,msc) values of the last successfull
swapbuffers call (PresentPixmapCompleteNotify event), as
glXWaitForSbcOML() relies on those values corresponding to
the most recent completed swap, not to whatever was last
returned from the server.

Problematic call sequence without this patch would have been, e.g.,

glXSwapBuffers()
... wait ...
swap completes -> PresentPixmapComplete event -> (ust,msc)
updated to reflect swap completion time and count.
... wait for at least 1 video refresh cycle/vblank increment.

glXGetSyncValuesOML()
-> PresentNotifyMsc event overwrites (ust,msc) of swap
completion with (ust,msc) of most recent vblank

glXWaitForSbcOML()
-> Returns sbc of last completed swap but (ust,msc) of last
completed vblank, not of last completed swap.
-> Client is confused.

Do this by tracking a separate set of (ust, msc) for the
dri3_wait_for_msc() call than for the dri3_wait_for_sbc()
call.

This makes the glXWaitForSbcOML() call robust again and restores
consistent behaviour with the DRI2 implementation.

Fixes applications originally written and tested against
DRI2 which also rely on this not regressing under DRI3/Present,
e.g., Neuro-Science software like Psychtoolbox-3.

This patch fixes the problem.

v2: Rename vblank_msc/ust to notify_msc/ust as suggested by
Axel Davy for better clarity.

Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Mario Kleiner <mario.kleiner.de@gmail.com>
Reviewed-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit ad8b0e8bf6)
2014-12-14 15:45:15 +00:00
Mario Kleiner
93f6f55983 glx/dri3: Fix glXWaitForSbcOML() to handle targetSBC==0 correctly. (v2)
targetSBC == 0 is a special case, which asks the function
to block until all pending OpenGL bufferswap requests have
completed.

Currently the function just falls through for targetSBC == 0,
returning bogus results.

This breaks applications originally written and tested against
DRI2 which also rely on this not regressing under DRI3/Present,
e.g., Neuro-Science software like Psychtoolbox-3.

This patch fixes the problem.

v2: Simplify as suggested by Axel Davy. Add comments proposed
by Eric Anholt.

Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Mario Kleiner <mario.kleiner.de@gmail.com>
Reviewed-by: Axel Davy <axel.davy@ens.fr>
Reviewed-by: Eric Anholt <eric@anholt.net>
(cherry picked from commit 8cab54de16)
2014-12-14 15:45:10 +00:00
Emil Velikov
af0c82099b docs: Add 10.4 sha256 sums, news item and link release notes
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2014-12-14 13:57:54 +00:00
Emil Velikov
5fe79b0b12 docs: Update 10.4.0 release notes
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2014-12-14 13:45:54 +00:00
Emil Velikov
45f3aa0bc7 Bump version to 10.4.0 (final)
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2014-12-14 13:32:44 +00:00
Alexander von Gluck IV
90239276ff mesa/drivers: Add missing mesautil lib to Haiku swrast
* Resolves missing util_format_linear_to_srgb_8unorm_table symbol.

(cherry picked from commit ad2ffd3bc6)
2014-12-11 13:54:54 +00:00
Roland Scheidegger
57868b1ee4 llvmpipe: fix lp_test_arit denorm handling
llvmpipe disables denorms on purpose (on x86/sse only), because denorms are
generally neither required nor desired for graphic apis (and in case of d3d10,
they are forbidden).
However, this caused some arithmetic tests using denorms to fail on some
systems, because the reference did not generate the same results anymore.
(It did not fail on all systems - behavior of these math functions is sort
of undefined when called with non-standard floating point mode, hence the
result differing depending on implementation and in particular the sse
capabilities.)
So, for the reference, simply flush all (input/output) denorms manually
to zero in this case.

This fixes https://bugs.freedesktop.org/show_bug.cgi?id=67672.

Reviewed-by: Jose Fonseca <jfonseca@vmware.com>
(cherry picked from commit 8148a06b8f)
Nominated-by: Matt Turner <mattst88@gmail.com>
2014-12-11 13:54:54 +00:00
Marek Olšák
fe2eac2237 docs/relnotes: document the removal of GALLIUM_MSAA
Cc: 10.2.10.3 10.4 <mesa-stable@lists.freedesktop.org>
(cherry picked from commit ac319d94d3)
2014-12-11 13:54:54 +00:00
Matt Turner
db784a09f1 i965: Disable unlit-centroid workaround on Gen < 6.
Back to the original commit (8313f444) adding the workaround, we were
enabling it on gens <= 7, even though gens <= 5 can't do multisampling.

I cannot find documentation that says that Sandybridge needs this
workaround but in practice disabling it causes these piglit tests to
fail:

EXT_framebuffer_multisample/interpolation {2,4} centroid-deriv{,-disabled}

On Ironlake:

total instructions in shared programs: 4358478 -> 4349671 (-0.20%)
instructions in affected programs:     117680 -> 108873 (-7.48%)

A bunch of shaders in TF2, Portal 2, and L4D2 are cut by 25~30%.

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Chris Forbes <chrisf@ijw.co.nz>
(cherry picked from commit 1a2de7dce8)
2014-12-11 13:54:53 +00:00
Dave Airlie
d9f4aaa095 r600g: only init GS_VERT_ITEMSIZE on r600
On evergreen there are 4 regs, on r600/700 there is only one.

Don't initialise regs and trash someone elses state.

Not sure this fixes anything, but hey one less stupid.

Reviewed-By: Glenn Kennard <glenn.kennard@gmail.com>
Cc: "10.3 10.4" mesa-stable@lists.freedesktop.org
Signed-off-by: Dave Airlie <airlied@redhat.com>
(cherry picked from commit 7f21cf7198)
2014-12-11 13:54:53 +00:00
Timothy Arceri
e340a28dba mesa: use build flag to ensure stack is realigned on x86
Nowadays GCC assumes stack pointer is 16-byte aligned even on 32-bits, but that is an assumption OpenGL drivers (or any dynamic library for that matter) can't afford to make as there are many closed- and open- source application binaries out there that only assume 4-byte stack alignment.

V4: fix comment and indentation

V3: move all sse4.1 build flag config to the same location
 and add comment as to why we need to do the realign

V2: use $target_cpu rather than $host_cpu
  and setup build flags in config rather than makefile

https://bugs.freedesktop.org/show_bug.cgi?id=86788
Signed-off-by: Timothy Arceri <t_arceri@yahoo.com.au>
Reviewed-by: Matt Turner <mattst88@gmail.com>
CC: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit f1b5f2b157)
2014-12-11 13:54:53 +00:00
Tom Stellard
6b908efd58 radeonsi: Program RASTER_CONFIG for harvested GPUs v5
Harvested GPUs have some of their render backends disabled, so
in order to prevent the hardware from trying to render things
with these disabled backends we need to correctly program
the PA_SC_RASTER_CONFIG register.

v2:
  - Write RASTER_CONFIG for all SEs.

v3:
  - Set GRBM_GFX_INDEX.INSTANCE_BROADCAST_WRITES bit.
  - Set GRBM_GFX_INFEX.SH_BROADCAST_WRITES bit when done setting
    PA_SC_RASTER_CONFIG.
  - Get num_se and num_sh_per_se from kernel.

v4:
  - Get correct value for num_se
  - Remove loop for setting PA_SC_RASTER_CONFIG
  - Only compute raster config when a backend has been disabled.

v5: Michel Dänzer
  - Fix computation for chips with multiple SEs

https://bugs.freedesktop.org/show_bug.cgi?id=60879

CC: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 67dcbcd92c)
2014-12-11 13:54:53 +00:00
Abdiel Janulgue
65f03e6733 ir_to_mesa: Remove sat to clamp lowering pass
Fixes an infinite loop in swrast where the lowering pass unpacks saturate into
clamp but the opt_algebraic pass tries to do the opposite.

v3 (Ian):
This is a revert of commit cfa8c1cb "ir_to_mesa: lower ir_unop_saturate" on
the ir_to_mesa.cpp portion. prog_execute.c can handle saturates in vertex
shaders, so classic swrast shouldn't need this lowering pass.

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=83463
Reviewed-by: Matt Turner <mattst88@gmail.com>
Signed-off-by: Abdiel Janulgue <abdiel.janulgue@linux.intel.com>
(cherry picked from commit 39f7b72428)
2014-12-11 13:54:53 +00:00
Chris Forbes
ffaf58e7d0 i965/Gen6-7: Fix point sprites with PolygonMode(GL_POINT)
This was an oversight in the original patch. When PolygonMode is
used, then front faces, back faces, or both may be rendered as
points and are affected by point sprite state.

Note that SNB/IVB can't actually be fully conformant here, for
a legacy context -- we don't have separate sets of pointsprite
enables for front and back faces. Haswell ignores pointsprite
state correctly in hardware for non-point rasterization, so can
do this correctly, but it doesn't seem worth it.

Signed-off-by: Chris Forbes <chrisf@ijw.co.nz>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=86764
Reviewed-by: Matt Turner <mattst88@gmail.com>
(cherry picked from commit ed56c16820)
2014-12-11 13:54:53 +00:00
Ben Widawsky
bb9dea8a29 i965/gs: Avoid DW * DW mul
The GS has an interesting use for mul. Because the GS can emit multiple
vertices per input vertex, and it also has a unique count at the top of the URB
payload, the GS unit needs to be able to dynamically specify URB write offsets
(relative to the global offset). The documentation in the function has a very
good explanation from Paul on the mechanics.

This fixes around 2000 piglit tests on BSW.

v2:
Reworded commit message (Ben) no mention of CHV (Matt)
Change SHRT_MAX to USHRT_MAX (Ken, and Matt)
Update comment in code to reflect the use of UW (Ben)
Add Gen7+ assertion for the relevant GS code, since it won't work on Gen6- (Ken)
Drop the bogus hunk in emit_control_data_bits() (Ken)

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=84777 (with many dupes)
Cc: "10.4 10.3 10.2" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Ben Widawsky <ben@bwidawsk.net>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Matt Turner <mattst88@gmail.com>
(cherry picked from commit f13870db09)
2014-12-11 13:54:53 +00:00
José Fonseca
be59440b53 util/primconvert: Avoid point arithmetic; apply offset on all cases.
Matches what u_vbuf_get_minmax_index() does.

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
(cherry picked from commit f9098f0972)
2014-12-11 13:54:52 +00:00
Ilia Mirkin
ac8d596498 util/primconvert: take ib offset into account
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Brian Paul <brianp@vmware.com>
Reviewed-by: Rob Clark <robclark@freedesktop.org>
(cherry picked from commit c3bed13604)
2014-12-11 13:54:52 +00:00
Ilia Mirkin
112d2fdb17 util/primconvert: support instanced rendering
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Brian Paul <brianp@vmware.com>
Reviewed-by: Rob Clark <robclark@freedesktop.org>
(cherry picked from commit fb434e675f)
2014-12-11 13:54:52 +00:00
Ilia Mirkin
c6353cee0c util/primconvert: pass index bias through
The index_bias (aka base_vertex) applies to the downstream draw just as
much, since the actual index values are never modified.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Brian Paul <brianp@vmware.com>
Reviewed-by: Rob Clark <robclark@freedesktop.org>
(cherry picked from commit 1dfa039168)
2014-12-11 13:54:52 +00:00
Emil Velikov
09e4f1a50f Increment version to 10.4.0-rc4
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2014-12-05 18:52:11 +00:00
Axel Davy
c7b9a2e38a st/nine: Fix vertex declarations for non-standard (usage/index)
Nine code to match vertex declaration to vs inputs was limiting
the number of possible combinations.

Some sm3 games have issues with that, because arbitrary (usage/index)
can be used.

This patch does the following changes to fix the problem:
. Change the numbers given to (usage/index) combinations to uint16
. Do not put limits on the indices when it doesn't make sense
. change the conversion rule (usage/index) -> number to fit all combinations
. Instead of having a table usage_map mapping a (usage/index) number to
an input index, usage_map maps input indices to their (usage/index)

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Tested-by: Yaroslav Andrusyak <pontostroy@gmail.com>
Acked-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit 712a4c5438)
2014-12-03 23:20:56 +00:00
Axel Davy
6fcbf9aee3 st/nine: sm1_declusage_to_tgsi, do not restrict indices with TGSI_SEMANTIC_GENERIC
With sm3, you can declare an input/output with an usage and an usage index.

Nine code hardcodes the translation usage/index to a corresponding TGSI code.
The translation was limited to a few usage/index combinations that were corresponding
to most of the needs of games, but some games did not work.

This patch rewrites that Nine code to map all possible usage/index combination
to TGSI code. The index associated to TGSI_SEMANTIC_GENERIC doesn't need to be low
for good performance, as the old code was supposing, and is not particularly bounded
(it's UINT16). Given the index is BYTE, we can map all combinations.

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Tested-by: Yaroslav Andrusyak <pontostroy@gmail.com>
Reviewed-by: Marek Olšák <marek.olsak@amd.com>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit 5d6d260833)
2014-12-03 23:20:01 +00:00
Axel Davy
fd2852fe5b st/nine: Queries: Fix D3DISSUE_END behaviour.
Issuing D3DISSUE_END should:
. reset previous queries if possible
. end the query

Previous behaviour wasn't calling end_query for
queries not needing D3DISSUE_BEGIN, nor resetting
previous queries.

This fixes several applications not launching properly.

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Tested-by: David Heidelberg <david@ixit.cz>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit eac0b9b68a)

Conflicts:
	src/gallium/state_trackers/nine/query9.c
2014-12-03 23:18:48 +00:00
Brian Paul
57057c439e mesa: fix height error check for 1D array textures
height=0 is legal for 1D array textures (as depth=0 is legal for
2D arrays).  Fixes new piglit ext_texture_array-errors test.

Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: José Fonseca <jfonseca@vmware.com>
(cherry picked from commit 4e6244e80f)
2014-12-03 23:16:36 +00:00
Dave Airlie
b5cc04b6ad r600g/sb: fix issues cause by GLSL switching to loops for switch
Since 73dd50acf6
glsl: implement switch flow control using a loop

The SB backend was falling over in an assert or crashing.

Tracked this down to the loops having no repeats, but requiring
a working break, initial code just called the loop handler for
all non-if statements, but this caused a regression in
tests/shaders/dead-code-break-interaction.shader_test.
So I had to add further code to detect if all the departure
nodes are empty and avoid generating an empty loop for that case.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=86089
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-By: Glenn Kennard <glenn.kennard@gmail.com>
Signed-off-by: Dave Airlie <airlied@redhat.com>
(cherry picked from commit 7b0067d23a)
2014-12-03 23:15:27 +00:00
Brian Paul
d2e9fd5b6d mesa: fix arithmetic error in _mesa_compute_compressed_pixelstore()
We need parenthesis around the expression which computes the number of
blocks per row.

Reviewed-by: Matt Turner <mattst88@gmail.com>
Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 991d5cf8ce)
2014-12-03 23:15:12 +00:00
Ilia Mirkin
b61192f2ae freedreno/ir3: fix UMAD
Looks like none of the mad variants do u16 * u16 + u32, so just add in
the extra value "by hand".

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit de83ef677f)
2014-12-03 23:15:05 +00:00
Ilia Mirkin
75c4824d2f freedreno/a3xx: only enable blend clamp for non-float formats
This fixes arb_color_buffer_float-render GL_RGBA16F.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Rob Clark <robclark@freedesktop.org>
(cherry picked from commit 3de9fa8ff4)
2014-12-03 23:14:48 +00:00
Christoph Bumiller
f30fbbdbdd nv50/ir/tgsi: handle TGSI_OPCODE_ARR
This instruction is used by st/nine.

Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit f3b4b263c2)
2014-12-03 23:14:34 +00:00
Emil Velikov
b247956c77 cherry-ignore: drop whitespace commit
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2014-12-03 23:13:53 +00:00
Axel Davy
72a802a9c2 st/nine: Fix setting of the shift modifier in nine_shader
It is an sint_4, but it was stored in a uint_8...
The code using it was acting as if it was signed.

Problem found thanks to Coverity

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Tested-by: David Heidelberg <david@ixit.cz>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit d52328fc39)
2014-12-03 22:59:28 +00:00
David Heidelberg
cfbc474d80 st/nine: remove unused pipe_viewport_state::translate[3] and scale[3]
2efabd9f5a removed them as unused.

This caused random memory overwrites (reported by Coverity).

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Marek Olšák <marek.olsak@amd.com>
Reviewed-by: Axel Davy <axel.davy@ens.fr>
Signed-off-by: David Heidelberg <david@ixit.cz>
(cherry picked from commit 90fea6b3e0)
2014-12-03 22:59:21 +00:00
Axel Davy
360872a45e st/nine: fix wrong variable reset
Error detected by Coverity (COPY_PASTE_ERROR)

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
Signed-off-by: David Heidelberg <david@ixit.cz>
(cherry picked from commit 614d9387c7)
2014-12-03 22:59:12 +00:00
David Heidelberg
42839ea5ba st/nine: return GetAvailableTextureMem in bytes as expected (v2)
PIPE_CAP_VIDEO_MEMORY returns the amount of video memory in megabytes,
so need to converted it to bytes.

Fixed Warframe memory detection.

v2: also prepare for cards with more than 4GB memory

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Tested-by: Yaroslav Andrusyak <pontostroy@gmail.com>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Axel Davy <axel.davy@ens.fr>
Signed-off-by: David Heidelberg <david@ixit.cz>
(cherry picked from commit a99f31bced)
2014-12-03 22:59:07 +00:00
Axel Davy
8dc03bd575 st/nine: Add pool check to SetTexture (v2)
D3DPOOL_SCRATCH is disallowed according to spec.
D3DPOOL_SYSTEMMEM should be allowed but we don't handle it right for now.

v2: Fixes segfault in SetTexture when unsetting the texture

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Tested-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit 4eea2496bc)
2014-12-03 22:58:54 +00:00
Axel Davy
41906e9764 st/nine: propertly declare constants (v2)
Fixes "Error : CONST[20]: Undeclared source register" when running
dx9_alpha_blending_material. Also artifacts on ilo.

v2: also remove unused MISC_CONST

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Tested-by: David Heidelberg <david@ixit.cz>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit 890f963d64)
2014-12-03 22:58:49 +00:00
Stanislaw Halik
56572002fc st/nine: call DBG() at more external entry points
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: David Heidelberg <david@ixit.cz>
Reviewed-by: Axel Davy <axel.davy@ens.fr>
Signed-off-by: Stanislaw Halik <sthalik@misaki.pl>
(cherry picked from commit 7f74b9d479)
2014-12-03 22:58:44 +00:00
Axel Davy
c0e0de45dc st/nine: rework the way D3DPOOL_SYSTEMMEM is handled
This patch moves the data field from Resource9 to Surface9 and cleans
D3DPOOL_SYSTEMMEM handling in Texture9. This fixes HL2 lost coast.

It also removes in Texture9 some code written to support importing
and exporting non D3DPOOL_SYSTEMMEM shared buffers. This code hadn't
the design required to support the feature and wasn't used.

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Tested-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit 6aeae7442d)
2014-12-03 22:58:39 +00:00
Axel Davy
b75a285633 st/nine: Rework Basetexture9 and Resource9.
Instead of having parts of the structures initialised by the parents,
have them initialised by the children.

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Tested-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit 133b2087c5)
2014-12-03 22:58:35 +00:00
Axel Davy
1cf4dbdc81 st/nine: clean device9ex.
Pass ex specific parameters as arguments to device9 ctor instead
of passing them by filling the structure.

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit 104b5a8193)
2014-12-03 22:58:29 +00:00
Emil Velikov
c29ddc923f Increment version to 10.4.0-rc3
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2014-11-28 17:58:26 +00:00
Ilia Mirkin
085de45812 freedreno/ir3: don't pass consts to madsh.m16 in MOD logic
madsh.m16 can't handle a const in src1, make sure to unconst it

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Rob Clark <robdclark@gmail.com>
Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 37fe347542)
2014-11-28 17:29:29 +00:00
Dave Airlie
31c7e6c51d r600g: merge the TXQ and BUFFER constant buffers (v1.1)
We are using 1 more buffer than we have, although in the future the
driver should just end up using one buffer in total probably, this
is a good first step, it merges the txq cube array and buffer info
constants on r600 and evergreen.

This should in theory fix geom shader tests on r600.

v1.1: fix comments from Glenn.

Reviewed-by: Glenn Kennard <glenn.kennard@gmail.com>
Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org
Signed-off-by: Dave Airlie <airlied@redhat.com>
(cherry picked from commit 07ae69753c)

Squashed with commit

r600g: fix fallout from last patch

I accidentally rebased from the wrong machine and missed some
fixes that were on my r600 box.

doh.

this fixes a bunch of geom shader textureSize tests on rv635
from gpu reset to pass.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=86760
Reported-by: wolput@onsneteindhoven.nl
Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Dave Airlie <airlied@redhat.com>
(cherry picked from commit b10ddf962f)

Squashed with commit

r600g: make llvm code compile this time

Actually compiling the code helps make it compile.

Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Dave Airlie <airlied@redhat.com>
(cherry picked from commit 91a827624c)
2014-11-28 17:29:07 +00:00
José Fonseca
2a0290d5f5 st/wgl: Don't export wglGetExtensionsStringARB.
It's not exported by the official opengl32.dll neither.  Applications are
supposed to get it via wglGetProcAddress(), not GetProcAddress().

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Brian Paul <brianp@vmware.com>
Reviewed-by: Roland Scheidegger <sroland@vmware.com>
(cherry picked from commit cb009bdd44)
2014-11-28 17:28:28 +00:00
José Fonseca
f77a97f057 mapi/glapi: Fix dll linkage of GLES1 symbols.
This fixes several MSVC warnings like:

  warning C4273: 'glClearColorx' : inconsistent dll linkage

In fact, we should avoid using `declspec(dllexport)` altogether, and use
exclusively the .DEF instead, which gives more precise control of which
symbols must be exported, but all the public GL/GLES headers practically
force us to pick between `declspec(dllexport)` or
`declspec(dllimport)`.

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Brian Paul <brianp@vmware.com>
Reviewed-by: Roland Scheidegger <sroland@vmware.com>
(cherry picked from commit 5fdb6d6839)
2014-11-28 17:28:20 +00:00
José Fonseca
d45c35c3d7 util/u_snprintf: Don't redefine HAVE_STDINT_H as 0.
We now always guarantee availability of stdint.h on MSVC -- if MSVC
doesn't supply one we use our own.

Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Brian Paul <brianp@vmware.com>
Reviewed-by: Roland Scheidegger <sroland@vmware.com>
(cherry picked from commit 4b6e93650c)
2014-11-28 17:28:13 +00:00
Emil Velikov
16eaf01a6a nine: the .pc file should not follow mesa version
The version provided by it should be the same as the one
provided/handled by the module. Add the missing tiny version.

Cc: <mesa-stable@lists.freedesktop.org>
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
Reviewed-by: David Heidelberg <david@ixit.cz>
(cherry picked from commit 9b7037a369)
2014-11-26 21:23:59 +00:00
Chris Forbes
6316d415c4 i965/Gen6-7: Do not replace texcoords with point coord if not drawing points
Fixes broken rendering in Windows-based QtQuick2 apps run through Wine.
This library sets all texture units' GL_COORD_REPLACE, leaves point
sprite mode enabled, and then draws a triangle fan.

Will need a slightly different fix for Gen4-5, but I don't have my old
machines in a usable state currently.

V2: - Simplify patch -- the real changes are no longer duplicated across
      the Gen6 and Gen7 atoms.
    - Also don't clobber attr overrides -- which matters on Haswell too,
      and fixes the other half of the problem
    - Fix newly-introduced warnings
V3: - Use BRW_NEW_GEOMETRY_PROGRAM and brw->geometry_program rather than
      core flag and state; keep the state flags in order.

Signed-off-by: Chris Forbes <chrisf@ijw.co.nz>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=84651
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 0008d0e59e)
2014-11-26 21:23:23 +00:00
Kenneth Graunke
dca88397ca glsl: Make lower_constant_arrays_to_uniforms require dereferences.
Ilia noticed that my lowering pass was converting the constant array
used by textureGatherOffsets' offsets parameter to a uniform.  This
broke textureGather for Nouveau, and is generally a horrible plan,
since it violates the GLSL constraint that offsets must be an
immediate constant.

When I wrote this pass, I neglected to consider whole array assignment.
I figured opt_array_splitting would handle constant indexing, so this
pass was really about fixing variable indexing.

textureGatherOffsets is an example of whole array access that we really
don't want to touch.  Whole array copies don't appear to benefit from
this either - they're most likely initializers for temporary arrays
which are going to be mutated anyway.  Since you're copying, you may
as well copy from immediates, not uniforms.

This patch makes the pass look for ir_dereference_arrays of
ir_constants, rather than looking for any ir_constant directly.
This way, it ignores whole array assignment.

No shader-db changes or Piglit regressions on Haswell.  Some Piglit
tests generate different code (fixing textureGatherOffsets on Nouveau).

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Tested-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 60f011af1a)
2014-11-26 21:23:14 +00:00
Chris Forbes
6c383aaadd mesa: Fix Get(GL_TRANSPOSE_CURRENT_MATRIX_ARB) to transpose
This was just returning the same value as GL_CURRENT_MATRIX_ARB.
Spotted while investigating something else in apitrace.

Signed-off-by: Chris Forbes <chrisf@ijw.co.nz>
Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 2b4fe85f0e)
2014-11-26 21:23:08 +00:00
Chris Forbes
7e47ae3185 glsl: Generate unique names for each const array lowered to uniforms
Uniform names (even for hidden uniforms) are required to be unique; some
parts of the compiler assume they can be looked up by name.

Fixes the piglit test: tests/spec/glsl-1.20/linker/array-initializers-1

Signed-off-by: Chris Forbes <chrisf@ijw.co.nz>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit 129178893b)
2014-11-26 21:20:33 +00:00
Chris Forbes
9e94c05936 i965: Handle nested uniform array indexing
When converting a uniform array reference to a pull constant load, the
`reladdr` expression itself may have its own `reladdr`, arbitrarily
deeply. This arises from expressions like:

   a[b[x]]     where a, b are uniform arrays (or lowered const arrays),
               and x is not a constant.

Just iterate the lowering to pull constants until we stop seeing these
nested. For most shaders, there will be only one pass through this loop.

Fixes the piglit test:
tests/spec/glsl-1.20/linker/double-indirect-1.shader_test

Signed-off-by: Chris Forbes <chrisf@ijw.co.nz>
Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
(cherry picked from commit adefccd12a)
2014-11-26 21:20:11 +00:00
Dave Airlie
4952c49f21 r600g: do all CUBE ALU operations before gradient texture operations (v2.1)
This moves all the CUBE section above the gradients section,
so that the gradient emission happens on one block which
is what sb/hardware expect.

v2: avoid changes to bytecode by using spare temps
v2.1: shame gcc, oh the shame. (uninit var warnings)

Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Glenn Kennard <glenn.kennard@gmail.com>
Signed-off-by: Dave Airlie <airlied@redhat.com>
(cherry picked from commit c88385603a)
2014-11-26 21:20:05 +00:00
Dave Airlie
013eba0ec1 r600: fix texture gradients instruction emission (v2)
The piglit tests were failing, and it appeared to be SB
optimising out things, but Glenn pointed out the gradients
are meant to be clause local, so we should emit the texture
instructions in the same clause. This moves things around
to always copy to a temp and then emit the texture clauses
for H/V.

v2: Glenn pointed out we could get another ALU fetch in
the wrong place, so load the src gpr earlier as well.

Fixes at least:
./bin/tex-miplevel-selection textureGrad 2D

Reviewed-by: Glenn Kennard <glenn.kennard@gmail.com>
Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Dave Airlie <airlied@redhat.com>
(cherry picked from commit 38ec184419)
2014-11-26 21:19:56 +00:00
Ilia Mirkin
db9a6b96ab nv50,nvc0: buffer resources can be bound as other things down the line
res->bind is not an indicator of how the resource is currently bound.
buffers can be rebound across different binding points without changing
underlying storage.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit fecae4625c)
2014-11-24 00:55:28 +00:00
Ilia Mirkin
4d9c0445dd nv50,nvc0: actually check constbufs for invalidation
The number of vertex buffers has nothing to do with the number of bound
constbufs.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit e80a0a7d9a)
2014-11-24 00:55:22 +00:00
Ilia Mirkin
1a8f90dc70 nv50/ir: set neg modifiers on min/max args
Fixes: https://bugs.freedesktop.org/show_bug.cgi?id=86618
Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 7d07083cfd)
2014-11-24 00:55:17 +00:00
Emil Velikov
7fe9292069 Increment version to 10.4.0-rc2
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2014-11-22 03:58:31 +00:00
Chad Versace
c260cb700b i965: Fix segfault in WebGL Conformance on Ivybridge
Fixes regression of WebGL Conformance test texture-size-limit [1] on
Ivybridge Mobile GT2 0x0166 with Google Chrome R38.

Regression introduced by

    commit 6c04423153
    Author: Kenneth Graunke <kenneth@whitecape.org>
    Date:   Sun Feb 2 02:58:42 2014 -0800

        i965: Bump GL_MAX_CUBE_MAP_TEXTURE_SIZE to 8192.

The test regressed because the pointer offset arithmetic in
intel_miptree_map_gtt() overflows for large textures. The pointer
arithmetic is not 64-bit safe.

[1] 52f0dc240f/sdk/tests/conformance/textures/texture-size-limit.html

Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Fixes: https://bugs.freedesktop.org/show_bug.cgi?id=78770
Fixes: Intel CHRMOS-1377
Reported-by: Lu Hua <huax.lu@intel.com>
Reviewed-by: Ian Romanic <ian.d.romanick@intel.com>
Signed-off-by: Chad Versace <chad.versace@linux.intel.com>
(cherry picked from commit b69c7c5dac)
2014-11-19 18:58:22 +00:00
Dave Airlie
aab3758916 r600g: limit texture offset application to specific types (v2)
For 1D and 2D arrays we don't want the other coordinates being
offset and affecting where we sample. I wrote this patch 6 months
ago but lost it.

Fixes:
./bin/tex-miplevel-selection textureLodOffset 1DArray
./bin/tex-miplevel-selection textureLodOffset 2DArray
./bin/tex-miplevel-selection textureOffset 1DArray
./bin/tex-miplevel-selection textureOffset 1DArrayShadow
./bin/tex-miplevel-selection textureOffset 2DArray
./bin/tex-miplevel-selection textureOffset(bias) 1DArray
./bin/tex-miplevel-selection textureOffset(bias) 2DArray

v2: rewrite to handle more cases and be consistent with code
above.

Reviewed-by: Glenn Kennard <glenn.kennard@gmail.com>
Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Dave Airlie <airlied@redhat.com>
(cherry picked from commit 1830138cc0)
2014-11-19 00:53:30 +00:00
Dave Airlie
be24d54195 r600g: geom shaders: always load texture src regs from inputs
Otherwise we seem to lose the split_gs_inputs and try and
pull from an uninitialised register.

fixes 9 texelFetch geom shader tests.

Reviewed-by: Glenn Kennard <glenn.kennard@gmail.com>
Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Signed-off-by: Dave Airlie <airlied@redhat.com>
(cherry picked from commit d4c342f67e)
2014-11-19 00:53:23 +00:00
Marek Olšák
8751abf752 radeonsi: support per-sample gl_FragCoord
Cc: 10.4 <mesa-stable@lists.freedesktop.org>
Reviewed-by: Michel Dänzer <michel.daenzer@amd.com>
(cherry picked from commit da2dea3843)
2014-11-19 00:53:14 +00:00
Ilia Mirkin
da7475f35f st/mesa: add a fallback for clear_with_quad when no vs_layer
Not all drivers can set gl_Layer from VS. Add a fallback that passes the
instance id from VS to GS, and then uses the GS to set the layer.

Tested by adding

  quad_buffers |= clear_buffers;
  clear_buffers = 0;

to the st_Clear logic, and forcing set_vertex_shader_layered in all
cases. No piglit regressions (on piglits with 'clear' in the name).

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Marek Olšák <marek.olsak@amd.com>
Cc: "10.4 10.3" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 68db29c434)
2014-11-19 00:53:08 +00:00
Dave Airlie
7b62f0eb50 r600g/cayman: handle empty vertex shaders
Some of the geom shader tests produce an empty vertex shader,
on cayman we'd crash in the finaliser because last_cf was NULL.

cayman doesn't need the NOP workaround, so if the code arrives
here with no last_cf, just emit an END.

fixes crashes in a bunch of piglit geom shader tests.

Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Glenn Kennard <glenn.kennard@gmail.com>
Signed-off-by: Dave Airlie <airlied@redhat.com>
(cherry picked from commit 4e520101e6)
2014-11-19 00:53:00 +00:00
Dave Airlie
fa62619da5 r600g/cayman: fix texture gather tests
It appears on cayman the TG4 outputs were reordered.

This fixes a lot of piglit tests.

Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Glenn Kennard <glenn.kennard@gmail.com>
Signed-off-by: Dave Airlie <airlied@redhat.com>
(cherry picked from commit 27e1e0e710)
2014-11-19 00:52:52 +00:00
Dave Airlie
2e3d2035cf r600g/cayman: fix integer multiplication output overwrite (v2)
This fixes tests/spec/glsl-1.10/execution/fs-op-assign-mult-ivec2-ivec2-overwrite.shader_test.

hopeful fix for fd.o bug 85376

Reported-by: ghallberg
Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Glenn Kennard <glenn.kennard@gmail.com>
Signed-off-by: Dave Airlie <airlied@redhat.com>
(cherry picked from commit 4a128d5a16)
2014-11-19 00:52:44 +00:00
Brian Paul
edb2186671 st/mesa: copy sampler_array_size field when copying instructions
The sampler_array_size field was added by "mesa/st: add support for
dynamic sampler offsets".  But the field wasn't getting copied in
the get_pixel_transfer_visitor() or get_bitmap_visitor() functions.

The count_resources() function then didn't properly compute the
glsl_to_tgsi_visitor::samplers_used bitmask.  Then, we didn't declare
all the sampler registers in st_translate_program().  Finally, we
asserted when we tried to emit a tgsi ureg src register with File =
TGSI_FILE_UNDEFINED.

Add the missing assignments and some new assertions to catch the
invalid register sooner.

Cc: "10.3, 10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
(cherry picked from commit 11abd7b2bc)
2014-11-19 00:52:36 +00:00
Michel Dänzer
5a2ff2002b radeonsi: Disable asynchronous DMA except for PIPE_BUFFER
Using the asynchronous DMA engine for multi-dimensional operations seems
to cause random GPU lockups for various people. While the root cause for
this might need to be fixed in the kernel, let's disable it for now.

Before re-enabling this, please make sure you can hit all newly enabled
paths in your testing, preferably with both piglit and real world apps,
and get in touch with people on the bug reports below for stability
testing.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=85647
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=83500
Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: Marek Olšák <marek.olsak@amd.com>
Reviewed-by: Grigori Goronzy <greg@chown.ath.cx>
(cherry picked from commit ae4536b4f7)
2014-11-19 00:51:57 +00:00
Vinson Lee
0a3c146723 scons: Require glproto >= 1.4.13 for X11.
GLXBadProfileARB and X_GLXCreateContextAtrribsARB require glproto >=
1.4.13. These symbols were added in commit
d5d41112cb "st/xlib: Generate errors as
specified."

Signed-off-by: Vinson Lee <vlee@freedesktop.org>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
Reviewed-by: José Fonseca <jfonseca@vmware.com>
(cherry picked from commit 876c53375e)
2014-11-19 00:51:50 +00:00
Emil Velikov
6452e24ebc configure.ac: roll up a program for the sse4.1 check
So when checking/building sse code we have three possibilities:
 1 Old compiler, throws an error when using -msse*
 2 New compiler, user disables sse* (-mno-sse*)
 3 New compiler, user doesn't disable sse

The original code, added code for #1 but not #2. Later on we patched
around the lack of handling #2 by wrapping the code in __SSE4_1__.
Yet it lead to a missing/undefined symbol in case of #1 or #2, which
might cause an issue for #2 when using the i965 driver.

A bit later we "fixed" the undefined symbol by using #1, rather than
updating it to handle #2. With this commit we set things straight :)

To top it all up, conventions state that in case of conflicting
(-enable-foo -disable-foo) options, the latter one takes precedence.
Thus we need to make sure to prepend -msse4.1 to CFLAGS in our test.

v2: Clean the #includes. Suggested by Ilia, Matt & Siavash.

Cc: "10.3 10.4" <mesa-stable@lists.freedesktop.org>
Tested-by: David Heidelberg <david@ixit.cz>
Tested-by: Siavash Eliasi <siavashserver@gmail.com>
Reviewed-by: Matt Turner <mattst88@gmail.com>
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
(cherry picked from commit 1a6ae84041)
2014-11-19 00:51:44 +00:00
Ilia Mirkin
4186c1c7b1 nv50,nvc0: use clip_halfz setting when creating rasterizer state
This enables the ARB_clip_control extension.

Signed-off-by: Ilia Mirkin <imirkin@alum.mit.edu>
Cc: "10.4" <mesa-stable@lists.freedesktop.org>
(cherry picked from commit 3bc42a09e2)
2014-11-19 00:51:38 +00:00
Emil Velikov
d133096d26 Increment version to 10.4.0-rc1
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2014-11-18 02:30:18 +00:00
Axel Davy
01c9bf999e nine: Implement threadpool
DRI_PRIME setups have different issues due the lack of dma-buf fences
support in the drivers. For DRI3 DRI_PRIME, a race can appear, making
tearings visible, or worse showing older content than expected. Until
dma-buf fences are well supported (and by all drivers), an alternative
is to send the buffers to the server only when rendering has finished.
Since waiting the rendering has finished in the main thread has a
performance impact, this patch uses an additional thread to offload the
wait and the sending of the buffers to the server.

Acked-by: Jose Fonseca <jfonseca@vmware.com>
Reviewed-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit 7f565845a1)
2014-11-18 02:30:18 +00:00
Axel Davy
df63e76c2c nine: Add drirc options (v2)
Implements vblank_mode and throttling, which  allows us change default ratio
between framerate and input lag.

Acked-by: Jose Fonseca <jfonseca@vmware.com>
Signed-off-by: David Heidelberg <david@ixit.cz>
Signed-off-by: Axel Davy <axel.davy@ens.fr>
(cherry picked from commit 948e6c5228)
2014-11-18 02:30:18 +00:00
Joakim Sindholt
b46e80ae60 nine: Add state tracker nine for Direct3D9 (v3)
Work of Joakim Sindholt (zhasha) and Christoph Bumiller (chrisbmr).
DRI3 port done by Axel Davy (mannerov).

v2: - nine_debug.c: klass extended from 32 chars to 96 (for sure) by glennk
    - Nine improvements by Axel Davy (which also fixed some wine tests)
    - by Emil Velikov:
     - convert to static/shared drivers
     - Sort and cleanup the includes
     - Use AM_CPPFLAGS for the defines
     - Add the linker garbage collector
     - Restrict the exported symbols (think llvm)

v3: - small nine fixes
    - build system improvements by Emil Velikov

v4: [Emil Velikov]
   - Do no link against libudev. No longer needed.

Acked-by: Jose Fonseca <jfonseca@vmware.com>
Reviewed-by: Marek Olšák <marek.olsak@amd.com>
Reviewed-by: Axel Davy <axel.davy@ens.fr>
Signed-off-by: David Heidelberg <david@ixit.cz>
(cherry picked from commit fdd96578ef)
[Emil Velikov: use correct ureg_property* functions]
Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>
2014-11-18 02:29:26 +00:00
Christoph Bumiller
ff97fbd9e9 gallium/auxiliary: add contained and rect checks (v6)
v3: thanks to Brian, improved coding style, also glennk helped spot few
things (unsigned -> int, two constify)
v4: thanks Ilia improved function, dropped u_box_clip_3d
v5: incorporated rest of Gregor proposed changes,clean ups
v6: u_box_clip_2d simplify proposed by Ilia Mirkin

Acked-by: Jose Fonseca <jfonseca@vmware.com>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Reviewed-by: Marek Olšák <marek.olsak@amd.com>
Signed-off-by: David Heidelberg <david@ixit.cz>
(cherry picked from commit 7d2573b537)
2014-11-18 02:23:12 +00:00
Christoph Bumiller
504d73f342 gallium/auxiliary: add inc and dec alternative with return (v4)
At this moment we use only zero or positive values.

v2: Implement it for also for Solaris, MSVC assembly
    and enable for other combinations.

v3: Replace MSVC assembly by assert + warning during compilation

v4: remove inc and dec with return for MSVC assembly

Acked-by: Jose Fonseca <jfonseca@vmware.com>
Reviewed-by: Ilia Mirkin <imirkin@alum.mit.edu>
Signed-off-by: David Heidelberg <david@ixit.cz>
(cherry picked from commit cb49132166)
2014-11-18 02:23:11 +00:00
Christoph Bumiller
7bbf0836c8 gallium/auxiliary: implement sw_probe_wrapped (v2)
Implement pipe_loader_sw_probe_wrapped which allows to use the wrapped
software renderer backend when using the pipe loader.

v2: - remove unneeded ifdef
    - use GALLIUM_PIPE_LOADER_WINSYS_LIBS
    - check for CALLOC_STRUCT
    thanks to Emil Velikov

Acked-by: Jose Fonseca <jfonseca@vmware.com>
Signed-off-by: David Heidelberg <david@ixit.cz>
(cherry picked from commit e23d63cffd)
2014-11-18 02:23:10 +00:00
Christoph Bumiller
8d6963f005 winsys/sw/wrapper: implement is_displaytarget_format_supported for swrast
Acked-by: Jose Fonseca <jfonseca@vmware.com>
Signed-off-by: David Heidelberg <david@ixit.cz>
(cherry picked from commit 8314315dff)
2014-11-18 02:23:08 +00:00
Christoph Bumiller
50e6b471c5 tgsi/ureg: add ureg_UARL shortcut (v2)
v2: moved in in same order as in p_shader_tokens (thanks Brian)

Acked-by: Jose Fonseca <jfonseca@vmware.com>
Reviewed-by: Marek Olšák <marek.olsak@amd.com>
Signed-off-by: David Heidelberg <david@ixit.cz>
(cherry picked from commit 259ec77db9)
2014-11-18 02:23:05 +00:00
3550 changed files with 195685 additions and 418171 deletions

View File

@@ -1,11 +1,10 @@
((prog-mode
((nil
(indent-tabs-mode . nil)
(tab-width . 8)
(c-basic-offset . 3)
(c-file-style . "stroustrup")
(fill-column . 78)
(eval . (progn
(c-set-offset 'case-label '0)
(c-set-offset 'innamespace '0)
(c-set-offset 'inline-open '0)))
)

2
.gitignore vendored
View File

@@ -18,7 +18,6 @@
*.tar
*.tar.bz2
*.tar.gz
*.tar.xz
*.trs
*.zip
*~
@@ -45,4 +44,3 @@ manifest.txt
.libs/
Makefile
Makefile.in
.install-mesa-links

View File

@@ -1,101 +0,0 @@
language: c
sudo: false
cache:
directories:
- $HOME/.ccache
addons:
apt:
packages:
- libdrm-dev
- libudev-dev
- x11proto-xf86vidmode-dev
- libexpat1-dev
- libxcb-dri2-0-dev
- libx11-xcb-dev
- llvm-3.4-dev
- scons
env:
global:
- XORG_RELEASES=http://xorg.freedesktop.org/releases/individual
- XCB_RELEASES=http://xcb.freedesktop.org/dist
- XORGMACROS_VERSION=util-macros-1.19.0
- GLPROTO_VERSION=glproto-1.4.17
- DRI2PROTO_VERSION=dri2proto-2.8
- DRI3PROTO_VERSION=dri3proto-1.0
- PRESENTPROTO_VERSION=presentproto-1.0
- LIBPCIACCESS_VERSION=libpciaccess-0.13.4
- LIBDRM_VERSION=libdrm-2.4.65
- XCBPROTO_VERSION=xcb-proto-1.11
- LIBXCB_VERSION=libxcb-1.11
- LIBXSHMFENCE_VERSION=libxshmfence-1.2
- PKG_CONFIG_PATH=$HOME/prefix/lib/pkgconfig
matrix:
- BUILD=make
- BUILD=scons
install:
- export PATH="/usr/lib/ccache:$PATH"
- pip install --user mako
# Install dependencies where we require specific versions (or where
# disallowed by Travis CI's package whitelisting).
- wget $XORG_RELEASES/util/$XORGMACROS_VERSION.tar.bz2
- tar -jxvf $XORGMACROS_VERSION.tar.bz2
- (cd $XORGMACROS_VERSION && ./configure --prefix=$HOME/prefix && make install)
- wget $XORG_RELEASES/proto/$GLPROTO_VERSION.tar.bz2
- tar -jxvf $GLPROTO_VERSION.tar.bz2
- (cd $GLPROTO_VERSION && ./configure --prefix=$HOME/prefix && make install)
- wget $XORG_RELEASES/proto/$DRI2PROTO_VERSION.tar.bz2
- tar -jxvf $DRI2PROTO_VERSION.tar.bz2
- (cd $DRI2PROTO_VERSION && ./configure --prefix=$HOME/prefix && make install)
- wget $XORG_RELEASES/proto/$DRI3PROTO_VERSION.tar.bz2
- tar -jxvf $DRI3PROTO_VERSION.tar.bz2
- (cd $DRI3PROTO_VERSION && ./configure --prefix=$HOME/prefix && make install)
- wget $XORG_RELEASES/proto/$PRESENTPROTO_VERSION.tar.bz2
- tar -jxvf $PRESENTPROTO_VERSION.tar.bz2
- (cd $PRESENTPROTO_VERSION && ./configure --prefix=$HOME/prefix && make install)
- wget $XCB_RELEASES/$XCBPROTO_VERSION.tar.bz2
- tar -jxvf $XCBPROTO_VERSION.tar.bz2
- (cd $XCBPROTO_VERSION && ./configure --prefix=$HOME/prefix && make install)
- wget $XCB_RELEASES/$LIBXCB_VERSION.tar.bz2
- tar -jxvf $LIBXCB_VERSION.tar.bz2
- (cd $LIBXCB_VERSION && ./configure --prefix=$HOME/prefix && make install)
- wget $XORG_RELEASES/lib/$LIBPCIACCESS_VERSION.tar.bz2
- tar -jxvf $LIBPCIACCESS_VERSION.tar.bz2
- (cd $LIBPCIACCESS_VERSION && ./configure --prefix=$HOME/prefix && make install)
- wget http://dri.freedesktop.org/libdrm/$LIBDRM_VERSION.tar.bz2
- tar -jxvf $LIBDRM_VERSION.tar.bz2
- (cd $LIBDRM_VERSION && ./configure --prefix=$HOME/prefix && make install)
- wget $XORG_RELEASES/lib/$LIBXSHMFENCE_VERSION.tar.bz2
- tar -jxvf $LIBXSHMFENCE_VERSION.tar.bz2
- (cd $LIBXSHMFENCE_VERSION && ./configure --prefix=$HOME/prefix && make install)
# Disabled LLVM (and therefore r300 and r600) because the build fails
# with "undefined reference to `clock_gettime'" and "undefined
# reference to `setupterm'" in llvmpipe.
script:
- if test "x$BUILD" = xmake; then
./autogen.sh --enable-debug
--disable-gallium-llvm
--with-egl-platforms=x11,drm
--with-dri-drivers=i915,i965,radeon,r200,swrast,nouveau
--with-gallium-drivers=svga,swrast,vc4,virgl
;
make && make check;
elif test x$BUILD = xscons; then
scons;
fi

View File

@@ -21,46 +21,30 @@
# FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER
# DEALINGS IN THE SOFTWARE.
# use c99 compiler by default
ifeq ($(LOCAL_CC),)
ifeq ($(LOCAL_IS_HOST_MODULE),true)
LOCAL_CFLAGS += -D_GNU_SOURCE
LOCAL_CC := $(HOST_CC) -std=c99
else
LOCAL_CC := $(TARGET_CC) -std=c99
endif
endif
LOCAL_C_INCLUDES += \
$(MESA_TOP)/src \
$(MESA_TOP)/include
MESA_VERSION := $(shell cat $(MESA_TOP)/VERSION)
MESA_VERSION=$(shell cat $(MESA_TOP)/VERSION)
# define ANDROID_VERSION (e.g., 4.0.x => 0x0400)
LOCAL_CFLAGS += \
-Wno-unused-parameter \
-Wno-date-time \
-DPACKAGE_VERSION=\"$(MESA_VERSION)\" \
-DPACKAGE_BUGREPORT=\"https://bugs.freedesktop.org/enter_bug.cgi?product=Mesa\" \
-DANDROID_VERSION=0x0$(MESA_ANDROID_MAJOR_VERSION)0$(MESA_ANDROID_MINOR_VERSION)
LOCAL_CFLAGS += \
-D__STDC_LIMIT_MACROS \
-DHAVE___BUILTIN_EXPECT \
-DHAVE___BUILTIN_FFS \
-DHAVE___BUILTIN_FFSLL \
-DHAVE_FUNC_ATTRIBUTE_FLATTEN \
-DHAVE_FUNC_ATTRIBUTE_UNUSED \
-DHAVE_FUNC_ATTRIBUTE_FORMAT \
-DHAVE_FUNC_ATTRIBUTE_PACKED \
-DHAVE___BUILTIN_CTZ \
-DHAVE___BUILTIN_POPCOUNT \
-DHAVE___BUILTIN_POPCOUNTLL \
-DHAVE___BUILTIN_CLZ \
-DHAVE___BUILTIN_CLZLL \
-DHAVE___BUILTIN_UNREACHABLE \
-DHAVE_PTHREAD=1 \
-fvisibility=hidden \
-Wno-sign-compare
# mesa requires at least c99 compiler
LOCAL_CONLYFLAGS += \
-std=c99
ifeq ($(strip $(MESA_ENABLE_ASM)),true)
ifeq ($(TARGET_ARCH),x86)
LOCAL_CFLAGS += \
@@ -70,16 +54,7 @@ LOCAL_CFLAGS += \
endif
endif
ifeq ($(MESA_ENABLE_LLVM),true)
LOCAL_CFLAGS += \
-DHAVE_LLVM=0x0305 -DMESA_LLVM_VERSION_PATCH=2 \
-D__STDC_CONSTANT_MACROS \
-D__STDC_FORMAT_MACROS \
-D__STDC_LIMIT_MACROS
endif
LOCAL_CPPFLAGS += \
$(if $(filter true,$(MESA_LOLLIPOP_BUILD)),-D_USING_LIBCXX) \
-Wno-error=non-virtual-dtor \
-Wno-non-virtual-dtor
@@ -89,6 +64,3 @@ LOCAL_CPPFLAGS += \
ifeq ($(strip $(LOCAL_MODULE_TAGS)),)
LOCAL_MODULE_TAGS := optional
endif
# Quiet down the build system and remove any .h files from the sources
LOCAL_SRC_FILES := $(patsubst %.h, , $(LOCAL_SRC_FILES))

View File

@@ -24,7 +24,7 @@
# BOARD_GPU_DRIVERS should be defined. The valid values are
#
# classic drivers: i915 i965
# gallium drivers: swrast freedreno i915g ilo nouveau r300g r600g radeonsi vc4 virgl vmwgfx
# gallium drivers: swrast freedreno i915g ilo nouveau r300g r600g radeonsi vmwgfx
#
# The main target is libGLES_mesa. For each classic driver enabled, a DRI
# module will also be built. DRI modules will be loaded by libGLES_mesa.
@@ -34,23 +34,14 @@ MESA_TOP := $(call my-dir)
MESA_ANDROID_MAJOR_VERSION := $(word 1, $(subst ., , $(PLATFORM_VERSION)))
MESA_ANDROID_MINOR_VERSION := $(word 2, $(subst ., , $(PLATFORM_VERSION)))
MESA_ANDROID_VERSION := $(MESA_ANDROID_MAJOR_VERSION).$(MESA_ANDROID_MINOR_VERSION)
ifeq ($(filter 1 2 3 4,$(MESA_ANDROID_MAJOR_VERSION)),)
MESA_LOLLIPOP_BUILD := true
else
define local-generated-sources-dir
$(call local-intermediates-dir)
endef
endif
MESA_DRI_MODULE_REL_PATH := dri
MESA_DRI_MODULE_PATH := $(TARGET_OUT_SHARED_LIBRARIES)/$(MESA_DRI_MODULE_REL_PATH)
MESA_DRI_MODULE_UNSTRIPPED_PATH := $(TARGET_OUT_SHARED_LIBRARIES_UNSTRIPPED)/$(MESA_DRI_MODULE_REL_PATH)
MESA_COMMON_MK := $(MESA_TOP)/Android.common.mk
MESA_PYTHON2 := python
DRM_GRALLOC_TOP := hardware/drm_gralloc
classic_drivers := i915 i965
gallium_drivers := swrast freedreno i915g ilo nouveau r300g r600g radeonsi vmwgfx vc4 virgl
gallium_drivers := swrast freedreno i915g ilo nouveau r300g r600g radeonsi vmwgfx
MESA_GPU_DRIVERS := $(strip $(BOARD_GPU_DRIVERS))
@@ -82,25 +73,28 @@ else
MESA_BUILD_GALLIUM := false
endif
MESA_ENABLE_LLVM := $(if $(filter radeonsi,$(MESA_GPU_DRIVERS)),true,false)
# add subdirectories
ifneq ($(strip $(MESA_GPU_DRIVERS)),)
SUBDIRS := \
src/loader \
src/mapi \
src/compiler \
src/compiler/glsl \
src/glsl \
src/mesa \
src/util \
src/egl \
src/egl/main
ifeq ($(strip $(MESA_BUILD_CLASSIC)),true)
SUBDIRS += \
src/egl/drivers/dri2 \
src/mesa/drivers/dri
endif
ifeq ($(strip $(MESA_BUILD_GALLIUM)),true)
SUBDIRS += src/gallium
endif
include $(call all-named-subdir-makefiles,$(SUBDIRS))
mkfiles := $(patsubst %,$(MESA_TOP)/%/Android.mk,$(SUBDIRS))
include $(mkfiles)
endif

View File

@@ -5,12 +5,3 @@ $(call add-clean-step, rm -rf $(PRODUCT_OUT)/obj/SHARED_LIBRARIES/libGLES_mesa_i
$(call add-clean-step, rm -rf $(OUT_DIR)/host/$(HOST_OS)-$(HOST_ARCH)/obj/EXECUTABLES/mesa_*_intermediates)
$(call add-clean-step, rm -rf $(OUT_DIR)/host/$(HOST_OS)-$(HOST_ARCH)/obj/EXECUTABLES/glsl_compiler_intermediates)
$(call add-clean-step, rm -rf $(OUT_DIR)/host/$(HOST_OS)-$(HOST_ARCH)/obj/STATIC_LIBRARIES/libmesa_glsl_utils_intermediates)
$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/STATIC_LIBRARIES/libmesa_*_intermediates)
$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/SHARED_LIBRARIES/i9?5_dri_intermediates)
$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/SHARED_LIBRARIES/libglapi_intermediates)
$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/SHARED_LIBRARIES/libGLES_mesa_intermediates)
$(call add-clean-step, rm -rf $(HOST_OUT_release)/*/EXECUTABLES/mesa_*_intermediates)
$(call add-clean-step, rm -rf $(HOST_OUT_release)/*/EXECUTABLES/glsl_compiler_intermediates)
$(call add-clean-step, rm -rf $(HOST_OUT_release)/*/STATIC_LIBRARIES/libmesa_*_intermediates)
$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/SHARED_LIBRARIES/*_dri_intermediates)

View File

@@ -21,46 +21,85 @@
SUBDIRS = src
AM_DISTCHECK_CONFIGURE_FLAGS = \
--enable-dri3 \
--enable-gallium-tests \
--enable-gallium-osmesa \
--enable-gbm \
--enable-gles1 \
--enable-gles2 \
--enable-glx-tls \
--enable-nine \
--enable-opencl \
--enable-va \
--enable-vdpau \
--enable-xa \
--enable-xvmc \
--disable-llvm-shared-libs \
--with-egl-platforms=x11,wayland,drm,surfaceless \
--with-dri-drivers=i915,i965,nouveau,radeon,r200,swrast \
--with-gallium-drivers=i915,ilo,nouveau,r300,r600,radeonsi,freedreno,svga,swrast,vc4,virgl
ACLOCAL_AMFLAGS = -I m4
EXTRA_DIST = \
autogen.sh \
common.py \
docs \
doxygen \
scons \
SConstruct
doxygen:
cd doxygen && $(MAKE)
noinst_HEADERS = \
include/c99_alloca.h \
include/c99_compat.h \
include/c99_math.h \
include/c11 \
include/D3D9 \
include/HaikuGL \
include/no_extern_c.h \
include/pci_ids
.PHONY: doxygen
# We list some directories in EXTRA_DIST, but don't actually want to include
# the .gitignore files in the tarball.
dist-hook:
find $(distdir) -name .gitignore -exec $(RM) {} +
# Rules for making release tarballs
PACKAGE_DIR = Mesa-$(PACKAGE_VERSION)
PACKAGE_NAME = MesaLib-$(PACKAGE_VERSION)
EXTRA_FILES = \
aclocal.m4 \
configure \
bin/ar-lib \
bin/compile \
bin/config.sub \
bin/config.guess \
bin/depcomp \
bin/install-sh \
bin/ltmain.sh \
bin/missing \
bin/ylwrap \
bin/test-driver \
src/glsl/glsl_parser.cpp \
src/glsl/glsl_parser.h \
src/glsl/glsl_lexer.cpp \
src/glsl/glcpp/glcpp-lex.c \
src/glsl/glcpp/glcpp-parse.c \
src/glsl/glcpp/glcpp-parse.h \
src/mesa/program/lex.yy.c \
src/mesa/program/program_parse.tab.c \
src/mesa/program/program_parse.tab.h \
`git ls-files | grep "Makefile.am" | sed -e "s/Makefile.am/Makefile.in/"`
IGNORE_FILES = \
-x autogen.sh
parsers: configure
$(MAKE) -C src/glsl glsl_parser.cpp glsl_parser.h glsl_lexer.cpp glcpp/glcpp-lex.c glcpp/glcpp-parse.c glcpp/glcpp-parse.h
# Everything for new a Mesa release:
ARCHIVES = $(PACKAGE_NAME).tar.gz \
$(PACKAGE_NAME).tar.bz2 \
$(PACKAGE_NAME).zip
tarballs: checksums
rm -f ../$(PACKAGE_DIR) $(PACKAGE_NAME).tar
manifest.txt: .git
( \
ls -1 $(EXTRA_FILES) ; \
git ls-files $(IGNORE_FILES) \
) | sed -e '/^\(.*\/\)\?\./d' -e "s@^@$(PACKAGE_DIR)/@" > $@
../$(PACKAGE_DIR):
ln -s $(PWD) $@
$(PACKAGE_NAME).tar: parsers ../$(PACKAGE_DIR) manifest.txt
cd .. ; tar -cf $(PACKAGE_DIR)/$(PACKAGE_NAME).tar -T $(PACKAGE_DIR)/manifest.txt
$(PACKAGE_NAME).tar.gz: $(PACKAGE_NAME).tar ../$(PACKAGE_DIR)
gzip --stdout --best $(PACKAGE_NAME).tar > $(PACKAGE_NAME).tar.gz
$(PACKAGE_NAME).tar.bz2: $(PACKAGE_NAME).tar
bzip2 --stdout --best $(PACKAGE_NAME).tar > $(PACKAGE_NAME).tar.bz2
$(PACKAGE_NAME).zip: parsers ../$(PACKAGE_DIR) manifest.txt
rm -f $(PACKAGE_NAME).zip ; \
cd .. ; \
zip -q -@ $(PACKAGE_NAME).zip < $(PACKAGE_DIR)/manifest.txt ; \
mv $(PACKAGE_NAME).zip $(PACKAGE_DIR)
checksums: $(ARCHIVES)
@-sha256sum $(PACKAGE_NAME).tar.gz
@-sha256sum $(PACKAGE_NAME).tar.bz2
@-sha256sum $(PACKAGE_NAME).zip
.PHONY: tarballs checksums

View File

@@ -1 +1 @@
11.2.0-rc4
10.4.7

View File

@@ -1,73 +0,0 @@
# http://www.appveyor.com/docs/appveyor-yml
#
# To setup AppVeyor for your own personal repositories do the following:
# - Sign up
# - Add a new project
# - Select Git and fill in the Git clone URL
# - Setup a Git hook as explained in
# https://github.com/appveyor/webhooks#installing-git-hook
# - Check 'Settings > General > Skip branches without appveyor.yml'
# - Check 'Settings > General > Rolling builds'
# - Setup the global or project notifications to your liking
#
# Note that kicking (or restarting) a build via the web UI will not work, as it
# will fail to find appveyor.yml . The Git hook is the most practical way to
# kick a build.
#
# See also:
# - http://help.appveyor.com/discussions/problems/2209-node-grunt-build-specify-a-project-or-solution-file-the-directory-does-not-contain-a-project-or-solution-file
# - http://help.appveyor.com/discussions/questions/1184-build-config-vs-appveyoryaml
version: '{build}'
branches:
except:
- /^travis.*$/
# Don't download the full Mesa history to speed up cloning. However the clone
# depth must not be too small, otherwise builds might fail when lots of patches
# are committed in succession, because the desired commit is not found on the
# truncated history.
#
# See also:
# - https://www.appveyor.com/blog/2014/06/04/shallow-clone-for-git-repositories
clone_depth: 100
cache:
- win_flex_bison-2.4.5.zip
- llvm-3.3.1-msvc2013-mtd.7z
environment:
WINFLEXBISON_ARCHIVE: win_flex_bison-2.4.5.zip
LLVM_ARCHIVE: llvm-3.3.1-msvc2013-mtd.7z
install:
# Check pip
- python --version
- python -m pip --version
# Install Mako
- python -m pip install --egg Mako
# Install SCons
- python -m pip install --egg scons==2.4.1
- scons --version
# Install flex/bison
- if not exist "%WINFLEXBISON_ARCHIVE%" appveyor DownloadFile "http://downloads.sourceforge.net/project/winflexbison/%WINFLEXBISON_ARCHIVE%"
- 7z x -y -owinflexbison\ "%WINFLEXBISON_ARCHIVE%" > nul
- set Path=%CD%\winflexbison;%Path%
- win_flex --version
- win_bison --version
# Download and extract LLVM
- if not exist "%LLVM_ARCHIVE%" appveyor DownloadFile "https://people.freedesktop.org/~jrfonseca/llvm/%LLVM_ARCHIVE%"
- 7z x -y "%LLVM_ARCHIVE%" > nul
- mkdir llvm\bin
- set LLVM=%CD%\llvm
build_script:
- scons -j%NUMBER_OF_PROCESSORS% MSVC_VERSION=12.0 llvm=1
# It's possible to setup notification here, as described in
# http://www.appveyor.com/docs/notifications#appveyor-yml-configuration , but
# doing so would cause the notification settings to be replicated across all
# repos, which is most likely undesired. So it's better to rely on the
# Appveyor global/project notification settings.

View File

@@ -6,8 +6,8 @@ test -z "$srcdir" && srcdir=.
ORIGDIR=`pwd`
cd "$srcdir"
autoreconf --force --verbose --install || exit 1
cd "$ORIGDIR" || exit $?
autoreconf -v --install || exit 1
cd $ORIGDIR || exit $?
if test -z "$NOCONFIGURE"; then
"$srcdir"/configure "$@"

18
bin/.cherry-ignore Normal file
View File

@@ -0,0 +1,18 @@
# No whitespace commits in stable.
a10bf5c10caf27232d4df8da74d5c35c23eb883d
# The following patches address code which is missing in 10.4
# http://lists.freedesktop.org/archives/mesa-dev/2015-March/078515.html
06084652fefe49c3d6bf1b476ff74ff602fdc22a common: Correct texture init for meta pbo uploads and downloads.
# http://lists.freedesktop.org/archives/mesa-dev/2015-March/078547.html
ccc5ce6f72c1ec86be4dfcef96c0b51fba0faa6d common: Correct PBO 2D_ARRAY handling.
# http://lists.freedesktop.org/archives/mesa-dev/2015-March/078549.html
546aba143d13ba3f993ead4cc30b2404abfc0202 common: Fix PBOs for 1D_ARRAY.
# http://lists.freedesktop.org/archives/mesa-dev/2015-March/078501.html
2b2fa1865248c6e3b7baec81c4f92774759b201f mesa: Indent break statements and add a missing one.
# http://lists.freedesktop.org/archives/mesa-dev/2015-March/078502.html
87109acbed9c9b52f33d58ca06d9048d0ac7a215 mesa: Free memory allocated for luminance in readpixels.

View File

@@ -15,14 +15,17 @@
# $ DRYRUN=yes bin/bugzilla_mesa.sh mesa-9.0.2..mesa-9.0.3 | wc -l
# regex pattern: trim before bug number
trim_before='s/.*show_bug.cgi?id=\([0-9]*\).*/\1/'
# regex pattern: trim before url
trim_before='s/.*\(http\)/\1/'
# regex pattern: reconstruct the url
use_after='s,^,https://bugs.freedesktop.org/show_bug.cgi?id=,'
# regex pattern: trim after url
trim_after='s/\(show_bug.cgi?id=[0-9]*\).*/\1/'
# regex pattern: always use https
use_https='s/http:/https:/'
# extract fdo urls from commit log
urls=$(git log $* | grep 'bugs.freedesktop.org/show_bug' | sed -e $trim_before | sort -n -u | sed -e $use_after)
urls=$(git log $* | grep 'bugs.freedesktop.org/show_bug' | sed -e $trim_before -e $trim_after -e $use_https | sort | uniq)
# if DRYRUN is set to "yes", simply print the URLs and don't fetch the
# details from fdo bugzilla.

View File

@@ -1,35 +0,0 @@
#!/bin/sh
# Script for generating a list of candidates which fix commits that have been
# previously cherry-picked to a stable branch.
#
# Usage examples:
#
# $ bin/get-extra-pick-list.sh
# $ bin/get-extra-pick-list.sh > picklist
# $ bin/get-extra-pick-list.sh | tee picklist
# Use the last branchpoint as our limit for the search
# XXX: there should be a better way for this
latest_branchpoint=`git branch | grep \* | cut -c 3-`-branchpoint
# Grep for commits with "cherry picked from commit" in the commit message.
git log --reverse --grep="cherry picked from commit" $latest_branchpoint..HEAD |\
grep "cherry picked from commit" |\
sed -e 's/^[[:space:]]*(cherry picked from commit[[:space:]]*//' -e 's/)//' |\
cut -c -8 |\
while read sha
do
# Check if the original commit is referenced in master
git log -n1 --pretty=oneline --grep=$sha $latest_branchpoint..origin/master |\
cut -c -8 |\
while read candidate
do
# Check if the potential fix, hasn't landed in branch yet.
found=`git log -n1 --pretty=oneline --reverse --grep=$candidate $latest_branchpoint..HEAD |wc -l`
if test $found = 0
then
echo Commit $candidate might need to be picked, as it references $sha
fi
done
done

View File

@@ -14,7 +14,7 @@ git log --reverse --grep="cherry picked from commit" origin/master..HEAD |\
sed -e 's/^[[:space:]]*(cherry picked from commit[[:space:]]*//' -e 's/)//' > already_picked
# Grep for commits that were marked as a candidate for the stable tree.
git log --reverse --pretty=%H -i --grep='^\([[:space:]]*NOTE: .*[Cc]andidate\|CC:.*mesa-stable\)' HEAD..origin/master |\
git log --reverse --pretty=%H -i --grep='^\([[:space:]]*NOTE: .*[Cc]andidate\|CC:.*10\.4.*mesa-stable\)' HEAD..origin/master |\
while read sha
do
# Check to see whether the patch is on the ignore list.

View File

@@ -26,28 +26,28 @@ else:
target_platform = host_platform
_machine_map = {
'x86': 'x86',
'i386': 'x86',
'i486': 'x86',
'i586': 'x86',
'i686': 'x86',
'BePC': 'x86',
'Intel': 'x86',
'ppc': 'ppc',
'BeBox': 'ppc',
'BeMac': 'ppc',
'AMD64': 'x86_64',
'x86_64': 'x86_64',
'sparc': 'sparc',
'sun4u': 'sparc',
'x86': 'x86',
'i386': 'x86',
'i486': 'x86',
'i586': 'x86',
'i686': 'x86',
'BePC': 'x86',
'Intel': 'x86',
'ppc' : 'ppc',
'BeBox': 'ppc',
'BeMac': 'ppc',
'AMD64': 'x86_64',
'x86_64': 'x86_64',
'sparc': 'sparc',
'sun4u': 'sparc',
}
# find host_machine value
if 'PROCESSOR_ARCHITECTURE' in os.environ:
host_machine = os.environ['PROCESSOR_ARCHITECTURE']
host_machine = os.environ['PROCESSOR_ARCHITECTURE']
else:
host_machine = _platform.machine()
host_machine = _platform.machine()
host_machine = _machine_map.get(host_machine, 'generic')
default_machine = host_machine
@@ -65,8 +65,7 @@ else:
default_llvm = 'no'
try:
if target_platform != 'windows' and \
subprocess.call(['llvm-config', '--version'],
stdout=subprocess.PIPE) == 0:
subprocess.call(['llvm-config', '--version'], stdout=subprocess.PIPE) == 0:
default_llvm = 'yes'
except:
pass
@@ -76,38 +75,30 @@ else:
# Common options
def AddOptions(opts):
try:
from SCons.Variables.BoolVariable import BoolVariable as BoolOption
except ImportError:
from SCons.Options.BoolOption import BoolOption
try:
from SCons.Variables.EnumVariable import EnumVariable as EnumOption
except ImportError:
from SCons.Options.EnumOption import EnumOption
opts.Add(EnumOption('build', 'build type', 'debug',
allowed_values=('debug', 'checked', 'profile',
'release')))
opts.Add(BoolOption('verbose', 'verbose output', 'no'))
opts.Add(EnumOption('machine', 'use machine-specific assembly code',
default_machine,
allowed_values=('generic', 'ppc', 'x86', 'x86_64')))
opts.Add(EnumOption('platform', 'target platform', host_platform,
allowed_values=('cygwin', 'darwin', 'freebsd', 'haiku',
'linux', 'sunos', 'windows')))
opts.Add(BoolOption('embedded', 'embedded build', 'no'))
opts.Add(BoolOption('analyze',
'enable static code analysis where available', 'no'))
opts.Add('toolchain', 'compiler toolchain', default_toolchain)
opts.Add(BoolOption('gles', 'EXPERIMENTAL: enable OpenGL ES support',
'no'))
opts.Add(BoolOption('llvm', 'use LLVM', default_llvm))
opts.Add(BoolOption('openmp', 'EXPERIMENTAL: compile with openmp (swrast)',
'no'))
opts.Add(BoolOption('debug', 'DEPRECATED: debug build', 'yes'))
opts.Add(BoolOption('profile', 'DEPRECATED: profile build', 'no'))
opts.Add(BoolOption('quiet', 'DEPRECATED: profile build', 'yes'))
opts.Add(BoolOption('texture_float',
'enable floating-point textures and renderbuffers',
'no'))
if host_platform == 'windows':
opts.Add('MSVC_VERSION', 'Microsoft Visual C/C++ version')
try:
from SCons.Variables.BoolVariable import BoolVariable as BoolOption
except ImportError:
from SCons.Options.BoolOption import BoolOption
try:
from SCons.Variables.EnumVariable import EnumVariable as EnumOption
except ImportError:
from SCons.Options.EnumOption import EnumOption
opts.Add(EnumOption('build', 'build type', 'debug',
allowed_values=('debug', 'checked', 'profile', 'release')))
opts.Add(BoolOption('verbose', 'verbose output', 'no'))
opts.Add(EnumOption('machine', 'use machine-specific assembly code', default_machine,
allowed_values=('generic', 'ppc', 'x86', 'x86_64')))
opts.Add(EnumOption('platform', 'target platform', host_platform,
allowed_values=('cygwin', 'darwin', 'freebsd', 'haiku', 'linux', 'sunos', 'windows')))
opts.Add(BoolOption('embedded', 'embedded build', 'no'))
opts.Add(BoolOption('analyze', 'enable static code analysis where available', 'no'))
opts.Add('toolchain', 'compiler toolchain', default_toolchain)
opts.Add(BoolOption('gles', 'EXPERIMENTAL: enable OpenGL ES support', 'no'))
opts.Add(BoolOption('llvm', 'use LLVM', default_llvm))
opts.Add(BoolOption('openmp', 'EXPERIMENTAL: compile with openmp (swrast)', 'no'))
opts.Add(BoolOption('debug', 'DEPRECATED: debug build', 'yes'))
opts.Add(BoolOption('profile', 'DEPRECATED: profile build', 'no'))
opts.Add(BoolOption('quiet', 'DEPRECATED: profile build', 'yes'))
opts.Add(BoolOption('texture_float', 'enable floating-point textures and renderbuffers', 'no'))
if host_platform == 'windows':
opts.Add('MSVC_VERSION', 'Microsoft Visual C/C++ version')

File diff suppressed because it is too large Load Diff

View File

@@ -18,26 +18,26 @@ are exposed in the 3.0 context as extensions.
Feature Status
----------------------------------------------------- ------------------------
GL 3.0, GLSL 1.30 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe
GL 3.0, GLSL 1.30 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe (*), softpipe (*)
glBindFragDataLocation, glGetFragDataLocation DONE
Conditional rendering (GL_NV_conditional_render) DONE ()
Map buffer subranges (GL_ARB_map_buffer_range) DONE ()
Clamping controls (GL_ARB_color_buffer_float) DONE ()
Float textures, renderbuffers (GL_ARB_texture_float) DONE ()
Conditional rendering (GL_NV_conditional_render) DONE (r300, swrast)
Map buffer subranges (GL_ARB_map_buffer_range) DONE (r300, swrast)
Clamping controls (GL_ARB_color_buffer_float) DONE (r300)
Float textures, renderbuffers (GL_ARB_texture_float) DONE (r300)
GL_EXT_packed_float DONE ()
GL_EXT_texture_shared_exponent DONE ()
GL_EXT_texture_shared_exponent DONE (swrast)
Float depth buffers (GL_ARB_depth_buffer_float) DONE ()
Framebuffer objects (GL_ARB_framebuffer_object) DONE ()
Framebuffer objects (GL_ARB_framebuffer_object) DONE (r300, swrast)
GL_ARB_half_float_pixel DONE (all drivers)
GL_ARB_half_float_vertex DONE ()
GL_ARB_half_float_vertex DONE (r300, swrast)
GL_EXT_texture_integer DONE ()
GL_EXT_texture_array DONE ()
Per-buffer blend and masks (GL_EXT_draw_buffers2) DONE ()
GL_EXT_texture_compression_rgtc DONE ()
GL_ARB_texture_rg DONE ()
Per-buffer blend and masks (GL_EXT_draw_buffers2) DONE (swrast)
GL_EXT_texture_compression_rgtc DONE (r300, swrast)
GL_ARB_texture_rg DONE (r300, swrast)
Transform feedback (GL_EXT_transform_feedback) DONE ()
Vertex array objects (GL_ARB_vertex_array_object) DONE ()
Vertex array objects (GL_ARB_vertex_array_object) DONE (all drivers)
sRGB framebuffer format (GL_EXT_framebuffer_sRGB) DONE ()
glClearBuffer commands DONE
glGetStringi command DONE
@@ -45,7 +45,7 @@ GL 3.0, GLSL 1.30 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, soft
glVertexAttribI commands DONE
Depth format cube textures DONE ()
GLX_ARB_create_context (GLX 1.4 is required) DONE
Multisample anti-aliasing DONE (llvmpipe (*), softpipe (*))
Multisample anti-aliasing DONE (r300)
(*) llvmpipe and softpipe have fake Multisample anti-aliasing support
@@ -53,28 +53,28 @@ GL 3.0, GLSL 1.30 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, soft
GL 3.1, GLSL 1.40 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe
Forward compatible context support/deprecations DONE ()
Instanced drawing (GL_ARB_draw_instanced) DONE ()
Buffer copying (GL_ARB_copy_buffer) DONE ()
Primitive restart (GL_NV_primitive_restart) DONE ()
Instanced drawing (GL_ARB_draw_instanced) DONE (swrast)
Buffer copying (GL_ARB_copy_buffer) DONE (r300, swrast)
Primitive restart (GL_NV_primitive_restart) DONE (r300)
16 vertex texture image units DONE ()
Texture buffer objs (GL_ARB_texture_buffer_object) DONE for OpenGL 3.1 contexts ()
Rectangular textures (GL_ARB_texture_rectangle) DONE ()
Uniform buffer objs (GL_ARB_uniform_buffer_object) DONE ()
Signed normalized textures (GL_EXT_texture_snorm) DONE ()
Rectangular textures (GL_ARB_texture_rectangle) DONE (r300, swrast)
Uniform buffer objs (GL_ARB_uniform_buffer_object) DONE (swrast)
Signed normalized textures (GL_EXT_texture_snorm) DONE (r300)
GL 3.2, GLSL 1.50 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe
Core/compatibility profiles DONE
Geometry shaders DONE ()
BGRA vertex order (GL_ARB_vertex_array_bgra) DONE ()
Base vertex offset(GL_ARB_draw_elements_base_vertex) DONE ()
Frag shader coord (GL_ARB_fragment_coord_conventions) DONE ()
Provoking vertex (GL_ARB_provoking_vertex) DONE ()
BGRA vertex order (GL_ARB_vertex_array_bgra) DONE (r300, swrast)
Base vertex offset(GL_ARB_draw_elements_base_vertex) DONE (r300, swrast)
Frag shader coord (GL_ARB_fragment_coord_conventions) DONE (r300, swrast)
Provoking vertex (GL_ARB_provoking_vertex) DONE (r300, swrast)
Seamless cubemaps (GL_ARB_seamless_cube_map) DONE ()
Multisample textures (GL_ARB_texture_multisample) DONE ()
Frag depth clamp (GL_ARB_depth_clamp) DONE ()
Fence objects (GL_ARB_sync) DONE ()
Frag depth clamp (GL_ARB_depth_clamp) DONE (swrast)
Fence objects (GL_ARB_sync) DONE (r300, swrast)
GLX_ARB_create_context_profile DONE
@@ -82,182 +82,140 @@ GL 3.3, GLSL 3.30 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, soft
GL_ARB_blend_func_extended DONE ()
GL_ARB_explicit_attrib_location DONE (all drivers that support GLSL)
GL_ARB_occlusion_query2 DONE ()
GL_ARB_occlusion_query2 DONE (r300, swrast)
GL_ARB_sampler_objects DONE (all drivers)
GL_ARB_shader_bit_encoding DONE ()
GL_ARB_texture_rgb10_a2ui DONE ()
GL_ARB_texture_swizzle DONE ()
GL_ARB_texture_swizzle DONE (r300, swrast)
GL_ARB_timer_query DONE ()
GL_ARB_instanced_arrays DONE ()
GL_ARB_instanced_arrays DONE (r300)
GL_ARB_vertex_type_2_10_10_10_rev DONE ()
GL 4.0, GLSL 4.00 --- all DONE: nvc0, r600, radeonsi
GL 4.0, GLSL 4.00:
GL_ARB_draw_buffers_blend DONE (i965, nv50, llvmpipe, softpipe)
GL_ARB_draw_indirect DONE (i965, llvmpipe, softpipe)
GL_ARB_gpu_shader5 DONE (i965)
GL_ARB_draw_buffers_blend DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_draw_indirect DONE (i965, nvc0, radeonsi, llvmpipe, softpipe)
GL_ARB_gpu_shader5 DONE (i965, nvc0)
- 'precise' qualifier DONE
- Dynamically uniform sampler array indices DONE (softpipe)
- Dynamically uniform UBO array indices DONE ()
- Dynamically uniform sampler array indices DONE (r600)
- Dynamically uniform UBO array indices DONE (r600)
- Implicit signed -> unsigned conversions DONE
- Fused multiply-add DONE ()
- Packing/bitfield/conversion functions DONE (softpipe)
- Enhanced textureGather DONE (softpipe)
- Geometry shader instancing DONE (llvmpipe, softpipe)
- Packing/bitfield/conversion functions DONE (r600)
- Enhanced textureGather DONE (r600, radeonsi)
- Geometry shader instancing DONE (r600)
- Geometry shader multiple streams DONE ()
- Enhanced per-sample shading DONE ()
- Interpolation functions DONE ()
- Enhanced per-sample shading DONE (r600)
- Interpolation functions DONE (r600)
- New overload resolution rules DONE
GL_ARB_gpu_shader_fp64 DONE (llvmpipe, softpipe)
GL_ARB_sample_shading DONE (i965, nv50)
GL_ARB_shader_subroutine DONE (i965, nv50, llvmpipe, softpipe)
GL_ARB_tessellation_shader DONE (i965)
GL_ARB_texture_buffer_object_rgb32 DONE (i965, llvmpipe, softpipe)
GL_ARB_texture_cube_map_array DONE (i965, nv50, llvmpipe, softpipe)
GL_ARB_texture_gather DONE (i965, nv50, llvmpipe, softpipe)
GL_ARB_texture_query_lod DONE (i965, nv50, softpipe)
GL_ARB_transform_feedback2 DONE (i965, nv50, llvmpipe, softpipe)
GL_ARB_transform_feedback3 DONE (i965, nv50, llvmpipe, softpipe)
GL_ARB_gpu_shader_fp64 started (Dave)
GL_ARB_sample_shading DONE (i965, nv50, nvc0, r600, radeonsi)
GL_ARB_shader_subroutine not started
GL_ARB_tessellation_shader started (Chris, Ilia)
GL_ARB_texture_buffer_object_rgb32 DONE (i965, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_texture_cube_map_array DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_texture_gather DONE (i965, nv50, nvc0, r600, radeonsi)
GL_ARB_texture_query_lod DONE (i965, nv50, nvc0, r600, radeonsi)
GL_ARB_transform_feedback2 DONE (i965, nv50, nvc0, r600, radeonsi)
GL_ARB_transform_feedback3 DONE (i965, nv50, nvc0, r600, radeonsi)
GL 4.1, GLSL 4.10 --- all DONE: nvc0, r600, radeonsi
GL 4.1, GLSL 4.10:
GL_ARB_ES2_compatibility DONE (i965, nv50, llvmpipe, softpipe)
GL_ARB_ES2_compatibility DONE (i965, nv50, nvc0, r300, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_get_program_binary DONE (0 binary formats)
GL_ARB_separate_shader_objects DONE (all drivers)
GL_ARB_shader_precision DONE (all drivers that support GLSL 4.10)
GL_ARB_vertex_attrib_64bit DONE (llvmpipe, softpipe)
GL_ARB_viewport_array DONE (i965, nv50, llvmpipe, softpipe)
GL_ARB_shader_precision started (Micah)
GL_ARB_vertex_attrib_64bit started (Dave)
GL_ARB_viewport_array DONE (i965, nv50, nvc0, r600, llvmpipe)
GL 4.2, GLSL 4.20:
GL_ARB_texture_compression_bptc DONE (i965, nvc0, r600, radeonsi)
GL_ARB_compressed_texture_pixel_storage DONE (all drivers)
GL_ARB_shader_atomic_counters DONE (i965, nvc0)
GL_ARB_shader_atomic_counters DONE (i965)
GL_ARB_texture_storage DONE (all drivers)
GL_ARB_transform_feedback_instanced DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_transform_feedback_instanced DONE (i965, nv50, nvc0, r600, radeonsi)
GL_ARB_base_instance DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_shader_image_load_store DONE (i965)
GL_ARB_shader_image_load_store in progress (curro)
GL_ARB_conservative_depth DONE (all drivers that support GLSL 1.30)
GL_ARB_shading_language_420pack DONE (all drivers that support GLSL 1.30)
GL_ARB_shading_language_packing DONE (all drivers)
GL_ARB_internalformat_query DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_internalformat_query DONE (i965, nv50, nvc0, r300, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_map_buffer_alignment DONE (all drivers)
GL 4.3, GLSL 4.30:
GL_ARB_arrays_of_arrays DONE (all drivers that support GLSL 1.30)
GL_ARB_arrays_of_arrays started (Timothy)
GL_ARB_ES3_compatibility DONE (all drivers that support GLSL 3.30)
GL_ARB_clear_buffer_object DONE (all drivers)
GL_ARB_compute_shader DONE (i965)
GL_ARB_copy_image DONE (i965, nv50, nvc0, r600, radeonsi)
GL_ARB_compute_shader in progress (jljusten)
GL_ARB_copy_image DONE (i965)
GL_KHR_debug DONE (all drivers)
GL_ARB_explicit_uniform_location DONE (all drivers that support GLSL)
GL_ARB_fragment_layer_viewport DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe)
GL_ARB_framebuffer_no_attachments DONE (i965)
GL_ARB_internalformat_query2 in progress (elima)
GL_ARB_fragment_layer_viewport DONE (nv50, nvc0, r600, llvmpipe)
GL_ARB_framebuffer_no_attachments not started
GL_ARB_internalformat_query2 not started
GL_ARB_invalidate_subdata DONE (all drivers)
GL_ARB_multi_draw_indirect DONE (i965, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_program_interface_query DONE (all drivers)
GL_ARB_multi_draw_indirect DONE (i965, nvc0, radeonsi, llvmpipe, softpipe)
GL_ARB_program_interface_query not started
GL_ARB_robust_buffer_access_behavior not started
GL_ARB_shader_image_size DONE (i965)
GL_ARB_shader_storage_buffer_object DONE (i965, nvc0)
GL_ARB_shader_image_size not started
GL_ARB_shader_storage_buffer_object not started
GL_ARB_stencil_texturing DONE (i965/gen8+, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_texture_buffer_range DONE (nv50, nvc0, i965, r600, radeonsi, llvmpipe)
GL_ARB_texture_query_levels DONE (all drivers that support GLSL 1.30)
GL_ARB_texture_storage_multisample DONE (all drivers that support GL_ARB_texture_multisample)
GL_ARB_texture_view DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_texture_view DONE (i965, nv50, nvc0)
GL_ARB_vertex_attrib_binding DONE (all drivers)
GL 4.4, GLSL 4.40:
GL_MAX_VERTEX_ATTRIB_STRIDE DONE (all drivers)
GL_ARB_buffer_storage DONE (i965, nv50, nvc0, r600, radeonsi)
GL_ARB_clear_texture DONE (i965, nv50, nvc0)
GL_ARB_enhanced_layouts in progress (Timothy)
- compile-time constant expressions DONE
- explicit byte offsets for blocks in progress
- forced alignment within blocks in progress
- specified vec4-slot component numbers in progress
- specified transform/feedback layout in progress
- input/output block locations DONE
GL_ARB_buffer_storage DONE (i965, nv30, nv50, nvc0, r300, r600, radeonsi)
GL_ARB_clear_texture DONE (i965)
GL_ARB_enhanced_layouts not started
GL_ARB_multi_bind DONE (all drivers)
GL_ARB_query_buffer_object DONE (nvc0)
GL_ARB_texture_mirror_clamp_to_edge DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_texture_stencil8 DONE (nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_query_buffer_object not started
GL_ARB_texture_mirror_clamp_to_edge DONE (i965, nv30, nv50, nvc0, r300, r600, radeonsi, swrast, llvmpipe, softpipe)
GL_ARB_texture_stencil8 not started
GL_ARB_vertex_type_10f_11f_11f_rev DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL 4.5, GLSL 4.50:
GL_ARB_ES3_1_compatibility not started
GL_ARB_clip_control DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_conditional_render_inverted DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_cull_distance in progress (Tobias)
GL_ARB_derivative_control DONE (i965, nv50, nvc0, r600, radeonsi)
GL_ARB_direct_state_access DONE (all drivers)
GL_ARB_get_texture_sub_image DONE (all drivers)
GL_ARB_shader_texture_image_samples DONE (i965, nv50, nvc0, r600, radeonsi)
GL_ARB_texture_barrier DONE (i965, nv50, nvc0, r600, radeonsi)
GL_KHR_context_flush_control DONE (all - but needs GLX/EGL extension to be useful)
GL_ARB_clip_control DONE (nv50, nvc0, r300, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_conditional_render_inverted DONE (i965, nv50, nvc0, llvmpipe, softpipe)
GL_ARB_cull_distance not started
GL_ARB_derivative_control DONE (i965, nv50, nvc0, r600)
GL_ARB_direct_state_access not started
GL_ARB_get_texture_sub_image started (Brian Paul)
GL_ARB_shader_texture_image_samples not started
GL_ARB_texture_barrier DONE (nv50, nvc0, r300, r600, radeonsi)
GL_KHR_context_flush_control DONE (all - but needs GLX/EXT extension to be useful)
GL_KHR_robust_buffer_access_behavior not started
GL_KHR_robustness 90% done (the ARB variant)
GL_EXT_shader_integer_mix DONE (all drivers that support GLSL)
These are the extensions cherry-picked to make GLES 3.1
GLES3.1, GLSL ES 3.1
GL_ARB_arrays_of_arrays DONE (all drivers that support GLSL 1.30)
GL_ARB_compute_shader DONE (i965)
GL_ARB_draw_indirect DONE (i965, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_arrays_of_arrays started (Timothy)
GL_ARB_compute_shader in progress (jljusten)
GL_ARB_explicit_uniform_location DONE (all drivers that support GLSL)
GL_ARB_framebuffer_no_attachments DONE (i965)
GL_ARB_program_interface_query DONE (all drivers)
GL_ARB_shader_atomic_counters DONE (i965, nvc0)
GL_ARB_shader_image_load_store DONE (i965)
GL_ARB_shader_image_size DONE (i965)
GL_ARB_shader_storage_buffer_object DONE (i965, nvc0)
GL_ARB_shading_language_packing DONE (all drivers)
GL_ARB_framebuffer_no_attachments not started
GL_ARB_program_interface_query not started
GL_ARB_shader_atomic_counters DONE (i965)
GL_ARB_shader_image_load_store in progress (curro)
GL_ARB_shader_storage_buffer_object not started
GL_ARB_separate_shader_objects DONE (all drivers)
GL_ARB_stencil_texturing DONE (i965/gen8+, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
Multisample textures (GL_ARB_texture_multisample) DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
GL_ARB_texture_storage_multisample DONE (all drivers that support GL_ARB_texture_multisample)
GL_ARB_vertex_attrib_binding DONE (all drivers)
GS5 Enhanced textureGather DONE (i965, nvc0, r600, radeonsi)
GS5 Packing/bitfield/conversion functions DONE (i965, nvc0, r600, radeonsi)
GS5 Packing/bitfield/conversion functions DONE (i965, nvc0, r600)
GL_EXT_shader_integer_mix DONE (all drivers that support GLSL)
Additional functionality not covered above:
glMemoryBarrierByRegion DONE
glGetTexLevelParameter[fi]v - needs updates DONE
glGetBooleani_v - restrict to GLES enums
gl_HelperInvocation support DONE (i965, nvc0, r600)
GLES3.2, GLSL ES 3.2
GL_EXT_color_buffer_float DONE (all drivers)
GL_KHR_blend_equation_advanced not started
GL_KHR_debug DONE (all drivers)
GL_KHR_robustness 90% done (the ARB variant)
GL_KHR_texture_compression_astc_ldr DONE (i965/gen9+)
GL_OES_copy_image not started (based on GL_ARB_copy_image, which is done for some drivers)
GL_OES_draw_buffers_indexed not started
GL_OES_draw_elements_base_vertex DONE (all drivers)
GL_OES_geometry_shader started (Marta)
GL_OES_gpu_shader5 not started (based on parts of GL_ARB_gpu_shader5, which is done for some drivers)
GL_OES_primitive_bounding box not started
GL_OES_sample_shading not started (based on parts of GL_ARB_sample_shading, which is done for some drivers)
GL_OES_sample_variables not started (based on parts of GL_ARB_sample_shading, which is done for some drivers)
GL_OES_shader_image_atomic not started (based on parts of GL_ARB_shader_image_load_store, which is done for some drivers)
GL_OES_shader_io_blocks not started (based on parts of GLSL 1.50, which is done)
GL_OES_shader_multisample_interpolation not started (based on parts of GL_ARB_gpu_shader5, which is done)
GL_OES_tessellation_shader not started (based on GL_ARB_tessellation_shader, which is done for some drivers)
GL_OES_texture_border_clamp not started (based on GL_ARB_texture_border_clamp, which is done)
GL_OES_texture_buffer not started (based on GL_ARB_texture_buffer_object, GL_ARB_texture_buffer_range, and GL_ARB_texture_buffer_object_rgb32 that are all done)
GL_OES_texture_cube_map_array not started (based on GL_ARB_texture_cube_map_array, which is done for all drivers)
GL_OES_texture_stencil8 DONE (all drivers that support GL_ARB_texture_stencil8)
GL_OES_texture_storage_multisample_2d_array DONE (all drivers that support GL_ARB_texture_multisample)
More info about these features and the work involved can be found at
http://dri.freedesktop.org/wiki/MissingFunctionality

View File

@@ -2,8 +2,8 @@ The software may implement third party technologies (e.g. third party
libraries) that are not licensed to you by AMD and for which you may need
to obtain licenses from other parties. Unless explicitly stated otherwise,
these third party technologies are not licensed hereunder. Such third
party technologies include, but are not limited, to H.264, H.265, HEVC, MPEG-2,
MPEG-4, AVC, and VC-1.
party technologies include, but are not limited, to H.264, MPEG-2, MPEG-4,
AVC, and VC-1.
For MPEG-2 Encoding Products ANY USE OF THIS PRODUCT IN ANY MANNER OTHER
THAN PERSONAL USE THAT COMPLIES WITH THE MPEG-2 STANDARD FOR ENCODING VIDEO

View File

@@ -11,6 +11,10 @@ no longer shipped or supported.
Run
scons osmesa mesagdi
to build classic mesa Windows GDI drivers; or
scons libgl-gdi
to build gallium based GDI driver.

View File

@@ -103,7 +103,7 @@ Mesa Version History
- Stencil-related functions now work in display lists
Changes:
- renamed aux.h as glaux.h (MS-DOS names can't start with aux)
- most filenames are in 8.3 format to accommodate MS-DOS
- most filenames are in 8.3 format to accomodate MS-DOS
- use GLubytes to store arrays of colors instead of GLints
1.2.2 August 2, 1995
@@ -1007,7 +1007,7 @@ Mesa Version History
- glGetTexImage was using pixel unpacking instead of packing params
- auto-mipmap generation for cube maps was incorrect
Changes:
- max texture units reduced to six to accommodate texture rectangles
- max texture units reduced to six to accomodate texture rectangles
- removed unfinished GL_MESA_sprite_point extension code

View File

@@ -87,13 +87,6 @@ created in a <code>lib64</code> directory at the top of the Mesa source
tree.</p>
</dd>
<dt><code>--sysconfdir=DIR</code></dt>
<dd><p>This option specifies the directory where the configuration
files will be installed. The default is <code>${prefix}/etc</code>.
Currently there's only one config file provided when dri drivers are
enabled - it's <code>drirc</code>.</p>
</dd>
<dt><code>--enable-static, --disable-shared</code></dt>
<dd><p>By default, Mesa
will build shared libraries. Either of these options will force static
@@ -224,7 +217,7 @@ GLX.
<dt><code>--with-expat=DIR</code>
<dd><p><strong>DEPRECATED</strong>, use <code>PKG_CONFIG_PATH</code> instead.</p>
<p>The DRI-enabled libGL uses expat to
parse the DRI configuration files in <code>${sysconfdir}/drirc</code> and
parse the DRI configuration files in <code>/etc/drirc</code> and
<code>~/.drirc</code>. This option allows a specific expat installation
to be used. For example, <code>--with-expat=/usr/local</code> will
search for expat headers and libraries in <code>/usr/local/include</code>

View File

@@ -61,6 +61,7 @@
<li><a href="shading.html" target="_parent">Shading Language</a>
<li><a href="egl.html" target="_parent">EGL</a>
<li><a href="opengles.html" target="_parent">OpenGL ES</a>
<li><a href="openvg.html" target="_parent">OpenVG / Vega</a>
<li><a href="envvars.html" target="_parent">Environment Variables</a>
<li><a href="osmesa.html" target="_parent">Off-Screen Rendering</a>
<li><a href="debugging.html" target="_parent">Debugging Tips</a>
@@ -90,14 +91,14 @@
<li><a href="http://www.opengl.org" target="_parent">OpenGL website</a>
<li><a href="http://dri.freedesktop.org" target="_parent">DRI website</a>
<li><a href="http://www.freedesktop.org" target="_parent">freedesktop.org</a>
<li><a href="http://planet.freedesktop.org" target="_parent">Developer blogs</a>
</ul>
<b>Hosted by:</b>
<br>
<blockquote>
<a href="http://sourceforge.net"
target="_parent">sourceforge.net</a>
target="_parent"><img src="http://sourceforge.net/sflogo.php?group_id=3&amp;type=1"
width="88" height="31" align="bottom" alt="Sourceforge.net" border="0"></a>
</blockquote>
</body>

View File

@@ -17,240 +17,158 @@
<h1>Development Notes</h1>
<h2>Adding Extensions</h2>
<p>
To add a new GL extension to Mesa you have to do at least the following.
<ul>
<li><a href="#style">Coding Style</a>
<li><a href="#submitting">Submitting Patches</a>
<li><a href="#release">Making a New Mesa Release</a>
<li><a href="#extensions">Adding Extensions</a>
<li>
If glext.h doesn't define the extension, edit include/GL/gl.h and add
code like this:
<pre>
#ifndef GL_EXT_the_extension_name
#define GL_EXT_the_extension_name 1
/* declare the new enum tokens */
/* prototype the new functions */
/* TYPEDEFS for the new functions */
#endif
</pre>
</li>
<li>
In the src/mapi/glapi/gen/ directory, add the new extension functions and
enums to the gl_API.xml file.
Then, a bunch of source files must be regenerated by executing the
corresponding Python scripts.
</li>
<li>
Add a new entry to the <code>gl_extensions</code> struct in mtypes.h
</li>
<li>
Update the <code>extensions.c</code> file.
</li>
<li>
From this point, the best way to proceed is to find another extension,
similar to the new one, that's already implemented in Mesa and use it
as an example.
</li>
<li>
If the new extension adds new GL state, the functions in get.c, enable.c
and attrib.c will most likely require new code.
</li>
<li>
The dispatch tests check_table.cpp and dispatch_sanity.cpp
should be updated with details about the new extensions functions. These
tests are run using 'make check'
</li>
</ul>
<h2 id="style">Coding Style</h2>
<h2>Coding Style</h2>
<p>
Mesa is over 20 years old and the coding style has evolved over time.
Some old parts use a style that's a bit out of date.
If the guidelines below don't cover something, try following the format of
existing, neighboring code.
Mesa's code style has changed over the years. Here's the latest.
</p>
<p>
Basic formatting guidelines
Comment your code! It's extremely important that open-source code be
well documented. Also, strive to write clean, easily understandable code.
</p>
<ul>
<li>3-space indentation, no tabs.
<li>Limit lines to 78 or fewer characters. The idea is to prevent line
wrapping in 80-column editors and terminals. There are exceptions, such
as if you're defining a large, static table of information.
<li>Opening braces go on the same line as the if/for/while statement.
For example:
<p>
3-space indentation
</p>
<p>
If you use tabs, set them to 8 columns
</p>
<p>
Line width: the preferred width to fill comments and code in Mesa is 78
columns. Exceptions are sometimes made for clarity (e.g. tabular data is
sometimes filled to a much larger width so that extraneous carriage returns
don't obscure the table).
</p>
<p>
Brace example:
</p>
<pre>
if (condition) {
foo;
} else {
bar;
}
if (condition) {
foo;
}
else {
bar;
}
switch (condition) {
case 0:
foo();
break;
case 1: {
...
break;
}
default:
...
break;
}
</pre>
<li>Put a space before/after operators. For example, <tt>a = b + c;</tt>
and not <tt>a=b+c;</tt>
<li>This GNU indent command generally does the right thing for formatting:
<p>
Here's the GNU indent command which will best approximate my preferred style:
(Note that it won't format switch statements in the preferred way)
</p>
<pre>
indent -br -i3 -npcs --no-tabs infile.c -o outfile.c
indent -br -i3 -npcs --no-tabs infile.c -o outfile.c
</pre>
<li>Use comments wherever you think it would be helpful for other developers.
Several specific cases and style examples follow. Note that we roughly
follow <a href="http://www.stack.nl/~dimitri/doxygen/">Doxygen</a> conventions.
<br>
<br>
Single-line comments:
<p>
Local variable name example: localVarName (no underscores)
</p>
<p>
Constants and macros are ALL_UPPERCASE, with _ between words
</p>
<p>
Global variables are not allowed.
</p>
<p>
Function name examples:
</p>
<pre>
/* null-out pointer to prevent dangling reference below */
bufferObj = NULL;
</pre>
Or,
<pre>
bufferObj = NULL; /* prevent dangling reference below */
</pre>
Multi-line comment:
<pre>
/* If this is a new buffer object id, or one which was generated but
* never used before, allocate a buffer object now.
*/
</pre>
We try to quote the OpenGL specification where prudent:
<pre>
/* Page 38 of the PDF of the OpenGL ES 3.0 spec says:
*
* "An INVALID_OPERATION error is generated for any of the following
* conditions:
*
* * <length> is zero."
*
* Additionally, page 94 of the PDF of the OpenGL 4.5 core spec
* (30.10.2014) also says this, so it's no longer allowed for desktop GL,
* either.
*/
</pre>
Function comment example:
<pre>
/**
* Create and initialize a new buffer object. Called via the
* ctx->Driver.CreateObject() driver callback function.
* \param name integer name of the object
* \param type one of GL_FOO, GL_BAR, etc.
* \return pointer to new object or NULL if error
*/
struct gl_object *
_mesa_create_object(GLuint name, GLenum type)
{
/* function body */
}
glFooBar() - a public GL entry point (in glapi_dispatch.c)
_mesa_FooBar() - the internal immediate mode function
save_FooBar() - retained mode (display list) function in dlist.c
foo_bar() - a static (private) function
_mesa_foo_bar() - an internal non-static Mesa function
</pre>
<li>Put the function return type and qualifiers on one line and the function
name and parameters on the next, as seen above. This makes it easy to use
<code>grep ^function_name dir/*</code> to find function definitions. Also,
the opening brace goes on the next line by itself (see above.)
<li>Function names follow various conventions depending on the type of function:
<pre>
glFooBar() - a public GL entry point (in glapi_dispatch.c)
_mesa_FooBar() - the internal immediate mode function
save_FooBar() - retained mode (display list) function in dlist.c
foo_bar() - a static (private) function
_mesa_foo_bar() - an internal non-static Mesa function
</pre>
<li>Constants, macros and enumerant names are ALL_UPPERCASE, with _ between
words.
<li>Mesa usually uses camel case for local variables (Ex: "localVarname")
while gallium typically uses underscores (Ex: "local_var_name").
<li>Global variables are almost never used because Mesa should be thread-safe.
<li>Booleans. Places that are not directly visible to the GL API
should prefer the use of <tt>bool</tt>, <tt>true</tt>, and
<p>
Places that are not directly visible to the GL API should prefer the use
of <tt>bool</tt>, <tt>true</tt>, and
<tt>false</tt> over <tt>GLboolean</tt>, <tt>GL_TRUE</tt>, and
<tt>GL_FALSE</tt>. In C code, this may mean that
<tt>#include &lt;stdbool.h&gt;</tt> needs to be added. The
<tt>try_emit_</tt>* methods in src/mesa/program/ir_to_mesa.cpp and
src/mesa/state_tracker/st_glsl_to_tgsi.cpp can serve as examples.
</ul>
<h2 id="submitting">Submitting patches</h2>
<p>
The basic guidelines for submitting patches are:
</p>
<ul>
<li>Patches should be sufficiently tested before submitting.
<li>Code patches should follow Mesa coding conventions.
<li>Whenever possible, patches should only effect individual Mesa/Gallium
components.
<li>Patches should never introduce build breaks and should be bisectable (see
<code>git bisect</code>.)
<li>Patches should be properly formatted (see below).
<li>Patches should be submitted to mesa-dev for review using
<code>git send-email</code>.
<li>Patches should not mix code changes with code formatting changes (except,
perhaps, in very trivial cases.)
</ul>
<h3>Patch formatting</h3>
<h2>Submitting patches</h2>
<p>
The basic rules for patch formatting are:
</p>
<ul>
<li>Lines should be limited to 75 characters or less so that git logs
displayed in 80-column terminals avoid line wrapping. Note that git
log uses 4 spaces of indentation (4 + 75 &lt; 80).
<li>The first line should be a short, concise summary of the change prefixed
with a module name. Examples:
<pre>
mesa: Add support for querying GL_VERTEX_ATTRIB_ARRAY_LONG
gallium: add PIPE_CAP_DEVICE_RESET_STATUS_QUERY
i965: Fix missing type in local variable declaration.
</pre>
<li>Subsequent patch comments should describe the change in more detail,
if needed. For example:
<pre>
i965: Remove end-of-thread SEND alignment code.
This was present in Eric's initial implementation of the compaction code
for Sandybridge (commit 077d01b6). There is no documentation saying this
is necessary, and removing it causes no regressions in piglit on any
platform.
</pre>
<li>A "Signed-off-by:" line is not required, but not discouraged either.
<li>If a patch address a bugzilla issue, that should be noted in the
patch comment. For example:
<pre>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=89689
</pre>
<li>If there have been several revisions to a patch during the review
process, they should be noted such as in this example:
<pre>
st/mesa: add ARB_texture_stencil8 support (v4)
if we support stencil texturing, enable texture_stencil8
there is no requirement to support native S8 for this,
the texture can be converted to x24s8 fine.
v2: fold fixes from Marek in:
a) put S8 last in the list
b) fix renderable to always test for d/s renderable
fixup the texture case to use a stencil only format
for picking the format for the texture view.
v3: hit fallback for getteximage
v4: put s8 back in front, it shouldn't get picked now (Ilia)
</pre>
<li>If someone tested your patch, document it with a line like this:
<pre>
Tested-by: Joe Hacker &lt;jhacker@foo.com&gt;
</pre>
<li>If the patch was reviewed (usually the case) or acked by someone,
that should be documented with:
<pre>
Reviewed-by: Joe Hacker &lt;jhacker@foo.com&gt;
Acked-by: Joe Hacker &lt;jhacker@foo.com&gt;
</pre>
</ul>
<h3>Testing Patches</h3>
<p>
It should go without saying that patches must be tested. In general,
do whatever testing is prudent.
</p>
<p>
You should always run the Mesa test suite before submitting patches.
The test suite can be run using the 'make check' command. All tests
You should always run the Mesa Testsuite before submitting patches.
The Testsuite can be run using the 'make check' command. All tests
must pass before patches will be accepted, this may mean you have
to update the tests themselves.
</p>
<p>
Whenever possible and applicable, test the patch with
<a href="http://piglit.freedesktop.org">Piglit</a> to
check for regressions.
</p>
<h3>Mailing Patches</h3>
<p>
Patches should be sent to the Mesa mailing list for review.
When submitting a patch make sure to use git send-email rather than attaching
@@ -266,38 +184,7 @@ re-sending the whole series). Using --in-reply-to makes
it harder for reviewers to accidentally review old patches.
</p>
<p>
When submitting follow-up patches you should also login to
<a href="https://patchwork.freedesktop.org">patchwork</a> and change the
state of your old patches to Superseded.
</p>
<h3>Reviewing Patches</h3>
<p>
When you've reviewed a patch on the mailing list, please be unambiguous
about your review. That is, state either
<pre>
Reviewed-by: Joe Hacker &lt;jhacker@foo.com&gt;
</pre>
or
<pre>
Acked-by: Joe Hacker &lt;jhacker@foo.com&gt;
</pre>
Rather than saying just "LGTM" or "Seems OK".
</p>
<p>
If small changes are suggested, it's OK to say something like:
<pre>
With the above fixes, Reviewed-by: Joe Hacker &lt;jhacker@foo.com&gt;
</pre>
which tells the patch author that the patch can be committed, as long
as the issues are resolved first.
</p>
<h3>Marking a commit as a candidate for a stable branch</h3>
<h2>Marking a commit as a candidate for a stable branch</h2>
<p>
If you want a commit to be applied to a stable branch,
@@ -334,7 +221,7 @@ the upcoming stable release can always be seen on the
<a href="http://cworth.org/~cworth/mesa-stable-queue/">Mesa Stable Queue</a>
page.
<h3>Criteria for accepting patches to the stable branch</h3>
<h2>Criteria for accepting patches to the stable branch</h2>
Mesa has a designated release manager for each stable branch, and the release
manager is the only developer that should be pushing changes to these
@@ -419,8 +306,7 @@ be rejected:
regression that is unaacceptable for the stable branch.</li>
</ul>
<h2 id="release">Making a New Mesa Release</h2>
<h2>Making a New Mesa Release</h2>
<p>
These are the instructions for making a new Mesa release.
@@ -570,7 +456,7 @@ Edit docs/relnotes/X.Y.Z.html to add the sha256sums printed as part of "make
tarballs" in the previous step. Commit this change.
</p>
<h3>Push all commits and the tag created above</h3>
<h3>Push all commits and the tag creates above</h3>
<p>
This is the first step that cannot easily be undone. The release is going
@@ -597,7 +483,7 @@ signatures to the freedesktop.org server:
mv ~/MesaLib-X.Y.Z* .
</pre>
<h3>Back on mesa master, add the new release notes into the tree</h3>
<h3>Back on mesa master, andd the new release notes into the tree</h3>
<p>
Something like the following steps will do the trick:
@@ -657,56 +543,6 @@ release announcement:
</pre>
</p>
<h2 id="extensions">Adding Extensions</h2>
<p>
To add a new GL extension to Mesa you have to do at least the following.
<ul>
<li>
If glext.h doesn't define the extension, edit include/GL/gl.h and add
code like this:
<pre>
#ifndef GL_EXT_the_extension_name
#define GL_EXT_the_extension_name 1
/* declare the new enum tokens */
/* prototype the new functions */
/* TYPEDEFS for the new functions */
#endif
</pre>
</li>
<li>
In the src/mapi/glapi/gen/ directory, add the new extension functions and
enums to the gl_API.xml file.
Then, a bunch of source files must be regenerated by executing the
corresponding Python scripts.
</li>
<li>
Add a new entry to the <code>gl_extensions</code> struct in mtypes.h
</li>
<li>
Update the <code>extensions.c</code> file.
</li>
<li>
From this point, the best way to proceed is to find another extension,
similar to the new one, that's already implemented in Mesa and use it
as an example.
</li>
<li>
If the new extension adds new GL state, the functions in get.c, enable.c
and attrib.c will most likely require new code.
</li>
<li>
The dispatch tests check_table.cpp and dispatch_sanity.cpp
should be updated with details about the new extensions functions. These
tests are run using 'make check'
</li>
</ul>
</div>
</body>
</html>

View File

@@ -204,8 +204,9 @@ terribly relevant.</p>
few preprocessor defines.</p>
<ul>
<li>If <tt>GLX_USE_TLS</tt> is defined, method #3 is used.</li>
<li>If <tt>HAVE_PTHREAD</tt> is defined, method #2 is used.</li>
<li>If <tt>GLX_USE_TLS</tt> is defined, method #4 is used.</li>
<li>If <tt>HAVE_PTHREAD</tt> is defined, method #3 is used.</li>
<li>If <tt>WIN32_THREADS</tt> is defined, method #2 is used.</li>
<li>If none of the preceding are defined, method #1 is used.</li>
</ul>

View File

@@ -88,11 +88,8 @@ types such as <code>EGLNativeDisplayType</code> or
<code>EGLNativeWindowType</code> defined for.</p>
<p>The available platforms are <code>x11</code>, <code>drm</code>,
<code>wayland</code>, <code>surfaceless</code>, <code>android</code>,
and <code>haiku</code>. The <code>android</code> platform
can only be built as a system component, part of AOSP, while the
<code>haiku</code> platform can only be built with SCons.
Unless for special needs, the build system should
<code>fbdev</code>, and <code>gdi</code>. The <code>gdi</code> platform can
only be built with SCons. Unless for special needs, the build system should
select the right platforms automatically.</p>
</dd>
@@ -115,6 +112,13 @@ is required if applications mix OpenGL and OpenGL ES.</p>
</dd>
<dt><code>--enable-openvg</code></dt>
<dd>
<p>OpenVG must be explicitly enabled by this option.</p>
</dd>
</dl>
<h2>Use EGL</h2>
@@ -183,6 +187,14 @@ probably required only for some of the demos found in mesa/demo repository.</p>
values are: <code>debug</code>, <code>info</code>, <code>warning</code>, and
<code>fatal</code>.</p>
</dd>
<dt><code>EGL_SOFTWARE</code></dt>
<dd>
<p>For drivers that support both hardware and software rendering, setting this
variable to true forces the use of software rendering.</p>
</dd>
</dl>
@@ -200,15 +212,38 @@ the X server directly using (XCB-)DRI2 protocol.</p>
</dd>
<dt><code>egl_gallium</code></dt>
<dd>
<p>This driver is based on Gallium3D. It supports all rendering APIs and
hardware supported by Gallium3D. It is the only driver that supports OpenVG.
The supported platforms are X11, DRM, FBDEV, and GDI.</p>
<p>This driver comes with its own hardware drivers
(<code>pipe_&lt;hw&gt;</code>) and client API modules
(<code>st_&lt;api&gt;</code>).</p>
</dd>
<h2>Packaging</h2>
<p>The ABI between the main library and its drivers are not stable. Nor is
there a plan to stabilize it at the moment.</p>
there a plan to stabilize it at the moment. Of the EGL drivers,
<code>egl_gallium</code> has its own hardware drivers and client API modules.
They are considered internal to <code>egl_gallium</code> and there is also no
stable ABI between them. These should be kept in mind when packaging for
distribution.</p>
<p>Generally, <code>egl_dri2</code> is preferred over <code>egl_gallium</code>
when the system already has DRI drivers. As <code>egl_gallium</code> is loaded
before <code>egl_dri2</code> when both are available, <code>egl_gallium</code>
is disabled by default.</p>
<h2>Developers</h2>
<p>The sources of the main library and drivers can be found at
<code>src/egl/</code>.</p>
<p>The sources of the main library and the classic drivers can be found at
<code>src/egl/</code>. The sources of the <code>egl</code> state tracker can
be found at <code>src/gallium/state_trackers/egl/</code>.</p>
<h3>Lifetime of Display Resources</h3>

View File

@@ -34,7 +34,6 @@ sometimes be useful for debugging end-user issues.
<li>LIBGL_NO_DRAWARRAYS - if set do not use DrawArrays GLX protocol (for debugging)
<li>LIBGL_SHOW_FPS - print framerate to stdout based on the number of glXSwapBuffers
calls per second.
<li>LIBGL_DRI3_DISABLE - disable DRI3 if set (the value does not matter)
</ul>
@@ -91,20 +90,11 @@ This is only valid for versions &gt;= 3.0.
<li> Mesa may not really implement all the features of the given version.
(for developers only)
</ul>
<li>MESA_GLES_VERSION_OVERRIDE - changes the value returned by
glGetString(GL_VERSION) for OpenGL ES.
<ul>
<li> The format should be MAJOR.MINOR
<li> Examples: 2.0, 3.0, 3.1
<li> Mesa may not really implement all the features of the given version.
(for developers only)
</ul>
<li>MESA_GLSL_VERSION_OVERRIDE - changes the value returned by
glGetString(GL_SHADING_LANGUAGE_VERSION). Valid values are integers, such as
"130". Mesa will not really implement all the features of the given language version
if it's higher than what's normally reported. (for developers only)
<li>MESA_GLSL - <a href="shading.html#envvars">shading language compiler options</a>
<li>MESA_NO_MINMAX_CACHE - when set, the minmax index cache is globally disabled.
</ul>
@@ -162,7 +152,6 @@ See the <a href="xlibdriver.html">Xlib software driver page</a> for details.
<li>no16 - suppress generation of 16-wide fragment shaders. useful for debugging broken shaders</li>
<li>blorp - emit messages about the blorp operations (blits &amp; clears)</li>
<li>nodualobj - suppress generation of dual-object geometry shader code</li>
<li>optimizer - dump shader assembly to files at each optimization pass and iteration that make progress</li>
</ul>
</ul>
@@ -188,14 +177,6 @@ Mesa EGL supports different sets of environment variables. See the
<li>GALLIUM_HUD - draws various information on the screen, like framerate,
cpu load, driver statistics, performance counters, etc.
Set GALLIUM_HUD=help and run e.g. glxgears for more info.
<li>GALLIUM_HUD_PERIOD - sets the hud update rate in seconds (float). Use zero
to update every frame. The default period is 1/2 second.
<li>GALLIUM_HUD_VISIBLE - control default visibility, defaults to true.
<li>GALLIUM_HUD_TOGGLE_SIGNAL - toggle visibility via user specified signal.
Especially useful to toggle hud at specific points of application and
disable for unencumbered viewing the rest of the time. For example, set
GALLIUM_HUD_VISIBLE to false and GALLIUM_HUD_SIGNAL_TOGGLE to 10 (SIGUSR1).
Use kill -10 <pid> to toggle the hud as desired.
<li>GALLIUM_LOG_FILE - specifies a file for logging all errors, warnings, etc.
rather than stderr.
<li>GALLIUM_PRINT_OPTIONS - if non-zero, print all the Gallium environment
@@ -232,7 +213,7 @@ See src/mesa/state_tracker/st_debug.c for other options.
<li>LP_PERF - a comma-separated list of options to selectively no-op various
parts of the driver. See the source code for details.
<li>LP_NUM_THREADS - an integer indicating how many threads to use for rendering.
Zero turns off threading completely. The default value is the number of CPU
Zero turns of threading completely. The default value is the number of CPU
cores present.
</ul>
@@ -247,31 +228,6 @@ for details.
</ul>
<h3>VA-API state tracker environment variables</h3>
<ul>
<li>VAAPI_MPEG4_ENABLED - enable MPEG4 for VA-API, disabled by default.
</ul>
<h3>VC4 driver environment variables</h3>
<ul>
<li>VC4_DEBUG - a comma-separated list of named flags, which do various things:
<ul>
<li>cl - dump command list during creation</li>
<li>qpu - dump generated QPU instructions</li>
<li>qir - dump QPU IR during program compile</li>
<li>nir - dump NIR during program compile</li>
<li>tgsi - dump TGSI during program compile</li>
<li>shaderdb - dump program compile information for shader-db analysis</li>
<li>perf - print during performance-related events</li>
<li>norast - skip actual hardware execution of commands</li>
<li>always_flush - flush after each draw call</li>
<li>always_sync - wait for finish after each flush</li>
<li>dump - write a GPU command stream trace file (VC4 simulator only)</li>
</ul>
</ul>
<p>
Other Gallium drivers have their own environment variables. These may change
frequently so the source code should be consulted for details.

View File

@@ -327,6 +327,19 @@ Basically, applying a translation of (0.375, 0.375, 0.0) to your coordinates
will fix the problem.
</p>
<h2>3.6 How can I change the maximum framebuffer size in Mesa's
<tt>swrast</tt> backend?</h2>
<p>
These can be overridden by using the <tt>--with-max-width</tt> and
<tt>--with-max-height</tt> options. The two need not be equal.
</p><p>
Do note that Mesa uses these values to size some internal buffers,
so increasing these sizes will cause Mesa to require additional
memory. Furthermore, increasing these limits beyond <tt>4096</tt>
may introduce rasterization artifacts; see the leading comments in
<tt>src/mesa/swrast/s_tritemp.h</tt>.
</p>
<br>
<br>

View File

@@ -16,275 +16,6 @@
<h1>News</h1>
<h2>February 10, 2016</h2>
<p>
<a href="relnotes/11.1.2.html">Mesa 11.1.2</a> is released.
This is a bug-fix release.
</p>
<h2>January 22, 2016</h2>
<p>
<a href="relnotes/11.0.9.html">Mesa 11.0.9</a> is released.
This is a bug-fix release.
<br>
NOTE: It is anticipated that 11.0.9 will be the final release in the 11.0
series. Users of 11.0 are encouraged to migrate to the 11.1 series in order
to obtain future fixes.
</p>
<h2>January 13, 2016</h2>
<p>
<a href="relnotes/11.1.1.html">Mesa 11.1.1</a> is released.
This is a bug-fix release.
</p>
<h2>December 21, 2015</h2>
<p>
<a href="relnotes/11.0.8.html">Mesa 11.0.8</a> is released.
This is a bug-fix release.
</p>
<h2>December 15, 2015</h2>
<p>
<a href="relnotes/11.1.0.html">Mesa 11.1.0</a> is released. This is a new
development release. See the release notes for more information about
the release.
</p>
<h2>December 9, 2015</h2>
<p>
<a href="relnotes/11.0.7.html">Mesa 11.0.7</a> is released.
This is a bug-fix release.
</p>
<p>
Mesa demos 8.3.0 is also released.
See the <a href="http://lists.freedesktop.org/archives/mesa-announce/2015-December/000191.html">announcement</a> for more information about the release.
You can download it from <a href="ftp://ftp.freedesktop.org/pub/mesa/demos/8.3.0/">ftp.freedesktop.org/pub/mesa/demos/8.3.0/</a>.
</p>
<h2>November 21, 2015</h2>
<p>
<a href="relnotes/11.0.6.html">Mesa 11.0.6</a> is released.
This is a bug-fix release.
</p>
<h2>November 11, 2015</h2>
<p>
<a href="relnotes/11.0.5.html">Mesa 11.0.5</a> is released.
This is a bug-fix release.
</p>
<h2>October 24, 2015</h2>
<p>
<a href="relnotes/11.0.4.html">Mesa 11.0.4</a> is released.
This is a bug-fix release.
</p>
<h2>October 10, 2015</h2>
<p>
<a href="relnotes/11.0.3.html">Mesa 11.0.3</a> is released.
This is a bug-fix release.
</p>
<h2>October 3, 2015</h2>
<p>
<a href="relnotes/10.6.9.html">Mesa 10.6.9</a> is released.
This is a bug-fix release.
<br>
NOTE: It is anticipated that 10.6.9 will be the final release in the 10.6
series. Users of 10.6 are encouraged to migrate to the 11.0 series in order
to obtain future fixes.
</p>
<h2>September 28, 2015</h2>
<p>
<a href="relnotes/11.0.2.html">Mesa 11.0.2</a> is released.
This is a bug-fix release.
</p>
<h2>September 26, 2015</h2>
<p>
<a href="relnotes/11.0.1.html">Mesa 11.0.1</a> is released.
This is a bug-fix release.
</p>
<h2>September 20, 2015</h2>
<p>
<a href="relnotes/10.6.8.html">Mesa 10.6.8</a> is released.
This is a bug-fix release.
</p>
<h2>September 12, 2015</h2>
<p>
<a href="relnotes/11.0.0.html">Mesa 11.0.0</a> is released. This is a new
development release. See the release notes for more information about
the release.
</p>
<h2>September 10, 2015</h2>
<p>
<a href="relnotes/10.6.7.html">Mesa 10.6.7</a> is released.
This is a bug-fix release.
</p>
<h2>September 4, 2015</h2>
<p>
<a href="relnotes/10.6.6.html">Mesa 10.6.6</a> is released.
This is a bug-fix release.
</p>
<h2>August 22, 2015</h2>
<p>
<a href="relnotes/10.6.5.html">Mesa 10.6.5</a> is released.
This is a bug-fix release.
</p>
<h2>August 11, 2015</h2>
<p>
<a href="relnotes/10.6.4.html">Mesa 10.6.4</a> is released.
This is a bug-fix release.
</p>
<h2>July 26, 2015</h2>
<p>
<a href="relnotes/10.6.3.html">Mesa 10.6.3</a> is released.
This is a bug-fix release.
</p>
<h2>July 11, 2015</h2>
<p>
<a href="relnotes/10.6.2.html">Mesa 10.6.2</a> is released.
This is a bug-fix release.
</p>
<h2>July 04, 2015</h2>
<p>
<a href="relnotes/10.5.9.html">Mesa 10.5.9</a> is released.
This is a bug-fix release.
<br>
NOTE: It is anticipated that 10.5.9 will be the final release in the 10.5
series. Users of 10.5 are encouraged to migrate to the 10.6 series in order
to obtain future fixes.
</p>
<h2>June 29, 2015</h2>
<p>
<a href="relnotes/10.6.1.html">Mesa 10.6.1</a> is released.
This is a bug-fix release.
</p>
<h2>June 20, 2015</h2>
<p>
<a href="relnotes/10.5.8.html">Mesa 10.5.8</a> is released.
This is a bug-fix release.
</p>
<h2>June 14, 2015</h2>
<p>
<a href="relnotes/10.6.0.html">Mesa 10.6.0</a> is released. This is a new
development release. See the release notes for more information about
the release.
</p>
<h2>June 07, 2015</h2>
<p>
<a href="relnotes/10.5.7.html">Mesa 10.5.7</a> is released.
This is a bug-fix release.
</p>
<h2>May 23, 2015</h2>
<p>
<a href="relnotes/10.5.6.html">Mesa 10.5.6</a> is released.
This is a bug-fix release.
</p>
<h2>May 11, 2015</h2>
<p>
<a href="relnotes/10.5.5.html">Mesa 10.5.5</a> is released.
This is a bug-fix release.
</p>
<h2>April 24, 2015</h2>
<p>
<a href="relnotes/10.5.4.html">Mesa 10.5.4</a> is released.
This is a bug-fix release.
</p>
<h2>April 12, 2015</h2>
<p>
<a href="relnotes/10.5.3.html">Mesa 10.5.3</a> is released.
This is a bug-fix release.
</p>
<h2>March 28, 2015</h2>
<p>
<a href="relnotes/10.5.2.html">Mesa 10.5.2</a> is released.
This is a bug-fix release.
</p>
<h2>March 20, 2015</h2>
<p>
<a href="relnotes/10.4.7.html">Mesa 10.4.7</a> is released.
This is a bug-fix release.
</p>
<h2>March 13, 2015</h2>
<p>
<a href="relnotes/10.5.1.html">Mesa 10.5.1</a> is released.
This is a bug-fix release.
</p>
<h2>March 06, 2015</h2>
<p>
<a href="relnotes/10.5.0.html">Mesa 10.5.0</a> is released. This is a new
development release. See the release notes for more information about
the release.
</p>
<h2>March 06, 2015</h2>
<p>
<a href="relnotes/10.4.6.html">Mesa 10.4.6</a> is released.
This is a bug-fix release.
</p>
<h2>February 21, 2015</h2>
<p>
<a href="relnotes/10.4.5.html">Mesa 10.4.5</a> is released.
This is a bug-fix release.
</p>
<h2>February 06, 2015</h2>
<p>
<a href="relnotes/10.4.4.html">Mesa 10.4.4</a> is released.
This is a bug-fix release.
</p>
<h2>January 24, 2015</h2>
<p>
<a href="relnotes/10.4.3.html">Mesa 10.4.3</a> is released.
This is a bug-fix release.
</p>
<h2>January 12, 2015</h2>
<p>
<a href="relnotes/10.3.7.html">Mesa 10.3.7</a>
and <a href="relnotes/10.4.2.html">Mesa 10.4.2</a> are released.
These are bug-fix releases from the 10.3 and 10.4 branches, respectively.
<br>
NOTE: It is anticipated that 10.3.7 will be the final release in the 10.3
series. Users of 10.3 are encouraged to migrate to the 10.4 series in order
to obtain future fixes.
</p>
<h2>December 29, 2014</h2>
<p>
<a href="relnotes/10.3.6.html">Mesa 10.3.6</a>
and <a href="relnotes/10.4.1.html">Mesa 10.4.1</a> are released.
These are bug-fix releases from the 10.3 and 10.4 branches, respectively.
</p>
<h2>December 14, 2014</h2>
<p>
<a href="relnotes/10.4.html">Mesa 10.4</a> is released. This is a new
@@ -292,18 +23,6 @@ development release. See the release notes for more information about
the release.
</p>
<h2>December 5, 2014</h2>
<p>
<a href="relnotes/10.3.5.html">Mesa 10.3.5</a> is released.
This is a bug-fix release.
</p>
<h2>November 21, 2014</h2>
<p>
<a href="relnotes/10.3.4.html">Mesa 10.3.4</a> is released.
This is a bug-fix release.
</p>
<h2>November 8, 2014</h2>
<p>
<a href="relnotes/10.3.3.html">Mesa 10.3.3</a> is released.
@@ -1554,7 +1273,7 @@ The <a href="faq.html">Mesa FAQ</a> has been rewritten.
- glGetTexImage was using pixel unpacking instead of packing params
- auto-mipmap generation for cube maps was incorrect
Changes:
- max texture units reduced to six to accommodate texture rectangles
- max texture units reduced to six to accomodate texture rectangles
- removed unfinished GL_MESA_sprite_point extension code
</pre>

View File

@@ -38,10 +38,6 @@
Version 2.6.4 or later should work.
</li>
<br>
<li><a href="http://www.makotemplates.org/">Python Mako module</a> -
Python Mako module is required. Version 0.3.4 or later should work.
</li>
</br>
<li><a href="http://www.scons.org/">SCons</a> is required for building on
Windows and optional for Linux (it's an alternative to autoconf/automake.)
</li>
@@ -55,11 +51,8 @@ Versions 2.5.35 and 2.4.1, respectively, (or later) should work.
<br>
On Windows with MinGW, install flex and bison with:
<pre>mingw-get install msys-flex msys-bison</pre>
For MSVC on Windows, install
<a href="http://winflexbison.sourceforge.net/">Win flex-bison</a>.
</li>
<br>
<li>For building on Windows, Microsoft Visual Studio 2013 or later is required.
For MSVC on Windows, you can find flex/bison programs on the
<a href="ftp://ftp.freedesktop.org/pub/mesa/windows-utils/">Mesa ftp site</a>.
</li>
</ul>
@@ -85,7 +78,7 @@ the needed dependencies:
<pre>
sudo yum install flex bison imake libtool xorg-x11-proto-devel libdrm-devel \
gcc-c++ xorg-x11-server-devel libXi-devel libXmu-devel libXdamage-devel git \
expat-devel llvm-devel python-mako
expat-devel llvm-devel
</pre>
@@ -130,13 +123,14 @@ by -debug for debug builds.
To build Mesa with SCons for Windows on Linux using the MinGW crosscompiler toolchain do
</p>
<pre>
scons platform=windows toolchain=crossmingw machine=x86 libgl-gdi
scons platform=windows toolchain=crossmingw machine=x86 mesagdi libgl-gdi
</pre>
<p>
This will create:
</p>
<ul>
<li>build/windows-x86-debug/gallium/targets/libgl-gdi/opengl32.dll &mdash; Mesa + Gallium + softpipe (or llvmpipe), binary compatible with Windows's opengl32.dll
<li>build/windows-x86-debug/mesa/drivers/windows/gdi/opengl32.dll &mdash; Mesa + swrast, binary compatible with Windows's opengl32.dll
<li>build/windows-x86-debug/gallium/targets/libgl-gdi/opengl32.dll &mdash; Mesa + Gallium + softpipe, binary compatible with Windows's opengl32.dll
</ul>
<p>
Put them all in the same directory to test them.

View File

@@ -49,7 +49,7 @@ stderr if the LIBGL_DEBUG environment variable is defined.
libGL.so is thread safe. The overhead of thread safety for common,
single-thread clients is negligible. However, the overhead of thread
safety for multi-threaded clients is significant. Each GL API call
requires two calls to pthread_get_specific() which can noticeably
requires two calls to pthread_get_specific() which can noticably
impact performance. Warning: libGL.so is thread safe but individual
DRI drivers may not be. Please consult the documentation for a driver
to learn if it is thread safe.

View File

@@ -58,37 +58,15 @@ It's the fastest software rasterizer for Mesa.
</pre>
<p>
For Windows you will need to build LLVM from source with MSVC or MINGW
(either natively or through cross compilers) and CMake, and set the LLVM
environment variable to the directory you installed it to.
For Windows you will need to build LLVM from source with MSVC or MINGW
(either natively or through cross compilers) and CMake, and set the LLVM
environment variable to the directory you installed it to.
LLVM will be statically linked, so when building on MSVC it needs to be
built with a matching CRT as Mesa, and you'll need to pass
<code>-DLLVM_USE_CRT_xxx=yyy</code> as described below.
</p>
-DLLVM_USE_CRT_RELEASE=MTd for debug and checked builds,
-DLLVM_USE_CRT_RELEASE=MTd for profile and release builds.
<table border="1">
<tr>
<th rowspan="2">LLVM build-type</th>
<th colspan="2" align="center">Mesa build-type</th>
</tr>
<tr>
<th>debug,checked</th>
<th>release,profile</th>
</tr>
<tr>
<th>Debug</th>
<td><code>-DLLVM_USE_CRT_DEBUG=MTd</code></td>
<td><code>-DLLVM_USE_CRT_DEBUG=MT</code></td>
</tr>
<tr>
<th>Release</th>
<td><code>-DLLVM_USE_CRT_RELEASE=MTd</code></td>
<td><code>-DLLVM_USE_CRT_RELEASE=MT</code></td>
</tr>
</table>
<p>
You can build only the x86 target by passing -DLLVM_TARGETS_TO_BUILD=X86
to cmake.
</p>

59
docs/openvg.html Normal file
View File

@@ -0,0 +1,59 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>OpenVG State Tracker</title>
<link rel="stylesheet" type="text/css" href="mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="contents.html"></iframe>
<div class="content">
<h1>OpenVG State Tracker</h1>
<p>
The current version of the OpenVG state tracker implements OpenVG 1.1.
</p>
<p>
More information about OpenVG can be found at
<a href="http://www.khronos.org/openvg/">
http://www.khronos.org/openvg/</a> .
</p>
<p>
The OpenVG state tracker depends on the Gallium architecture and a working EGL implementation.
Please refer to <a href="egl.html">Mesa EGL</a> for more information about EGL.
</p>
<h2>Building the library</h2>
<ol>
<li>Run <code>configure</code> with <code>--enable-openvg</code> and
<code>--enable-gallium-egl</code>. If you do not need OpenGL, you can add
<code>--disable-opengl</code> to save the compilation time.</li>
<li>Build and install Mesa as usual.</li>
</ol>
<h3>Sample build</h3>
A sample build looks as follows:
<pre>
$ ./configure --disable-opengl --enable-openvg --enable-gallium-egl
$ make
$ make install
</pre>
<p>It will install <code>libOpenVG.so</code>, <code>libEGL.so</code>, and one
or more EGL drivers.</p>
<h2>OpenVG Demos</h2>
<p>OpenVG demos can be found in mesa/demos repository.</p>
</div>
</body>
</html>

View File

@@ -21,51 +21,7 @@ The release notes summarize what's new or changed in each Mesa release.
</p>
<ul>
<li><a href="relnotes/11.1.2.html">11.1.2 release notes</a>
<li><a href="relnotes/11.0.9.html">11.0.9 release notes</a>
<li><a href="relnotes/11.1.1.html">11.1.1 release notes</a>
<li><a href="relnotes/11.0.8.html">11.0.8 release notes</a>
<li><a href="relnotes/11.1.0.html">11.1.0 release notes</a>
<li><a href="relnotes/11.0.7.html">11.0.7 release notes</a>
<li><a href="relnotes/11.0.6.html">11.0.6 release notes</a>
<li><a href="relnotes/11.0.5.html">11.0.5 release notes</a>
<li><a href="relnotes/11.0.4.html">11.0.4 release notes</a>
<li><a href="relnotes/11.0.3.html">11.0.3 release notes</a>
<li><a href="relnotes/10.6.9.html">10.6.9 release notes</a>
<li><a href="relnotes/11.0.2.html">11.0.2 release notes</a>
<li><a href="relnotes/11.0.1.html">11.0.1 release notes</a>
<li><a href="relnotes/10.6.8.html">10.6.8 release notes</a>
<li><a href="relnotes/11.0.0.html">11.0.0 release notes</a>
<li><a href="relnotes/10.6.7.html">10.6.7 release notes</a>
<li><a href="relnotes/10.6.6.html">10.6.6 release notes</a>
<li><a href="relnotes/10.6.5.html">10.6.5 release notes</a>
<li><a href="relnotes/10.6.4.html">10.6.4 release notes</a>
<li><a href="relnotes/10.6.3.html">10.6.3 release notes</a>
<li><a href="relnotes/10.6.2.html">10.6.2 release notes</a>
<li><a href="relnotes/10.5.9.html">10.5.9 release notes</a>
<li><a href="relnotes/10.6.1.html">10.6.1 release notes</a>
<li><a href="relnotes/10.5.8.html">10.5.8 release notes</a>
<li><a href="relnotes/10.6.0.html">10.6.0 release notes</a>
<li><a href="relnotes/10.5.7.html">10.5.7 release notes</a>
<li><a href="relnotes/10.5.6.html">10.5.6 release notes</a>
<li><a href="relnotes/10.5.5.html">10.5.5 release notes</a>
<li><a href="relnotes/10.5.4.html">10.5.4 release notes</a>
<li><a href="relnotes/10.5.3.html">10.5.3 release notes</a>
<li><a href="relnotes/10.5.2.html">10.5.2 release notes</a>
<li><a href="relnotes/10.4.7.html">10.4.7 release notes</a>
<li><a href="relnotes/10.5.1.html">10.5.1 release notes</a>
<li><a href="relnotes/10.5.0.html">10.5.0 release notes</a>
<li><a href="relnotes/10.4.6.html">10.4.6 release notes</a>
<li><a href="relnotes/10.4.5.html">10.4.5 release notes</a>
<li><a href="relnotes/10.4.4.html">10.4.4 release notes</a>
<li><a href="relnotes/10.4.3.html">10.4.3 release notes</a>
<li><a href="relnotes/10.4.2.html">10.4.2 release notes</a>
<li><a href="relnotes/10.3.7.html">10.3.7 release notes</a>
<li><a href="relnotes/10.4.1.html">10.4.1 release notes</a>
<li><a href="relnotes/10.3.6.html">10.3.6 release notes</a>
<li><a href="relnotes/10.4.html">10.4 release notes</a>
<li><a href="relnotes/10.3.5.html">10.3.5 release notes</a>
<li><a href="relnotes/10.3.4.html">10.3.4 release notes</a>
<li><a href="relnotes/10.3.3.html">10.3.3 release notes</a>
<li><a href="relnotes/10.3.2.html">10.3.2 release notes</a>
<li><a href="relnotes/10.3.1.html">10.3.1 release notes</a>

View File

@@ -104,7 +104,7 @@ a07b4b6b9eb449b88a6cb5061e51c331 MesaLib-10.0.3.zip
<li>Add md5sums for 10.0.2. release.</li>
<li>cherry-ignore: Ignore several patches not yet ready for the stable branch</li>
<li>Drop another couple of patches.</li>
<li>cherry-ignore: Ignore 4 patches at the request of the author, (Anuj).</li>
<li>cherry-ignore: Ignore 4 patches at teh request of the author, (Anuj).</li>
<li>Update version to 10.0.3</li>
</ul>

View File

@@ -1,106 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.3.4 Release Notes / November 21, 2014</h1>
<p>
Mesa 10.3.4 is a bug fix release which fixes bugs found since the 10.3.3 release.
</p>
<p>
Mesa 10.3.4 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
26482495ef6177f889dbd87c7edcccfedd995598785bbbd7e3e066352574c8e0 MesaLib-10.3.4.tar.gz
e6373913142338d10515daf619d659433bfd2989988198930c13b0945a15e98a MesaLib-10.3.4.tar.bz2
8c3ebbb6535daf3414305860ebca6ac67dbb6e3d35058c7a6ce18b84b5945b7f MesaLib-10.3.4.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76252">Bug 76252</a> - Dynamic loading/unloading of opengl32.dll results in a deadlock</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78770">Bug 78770</a> - [SNB bisected]Webglc conformance/textures/texture-size-limit.html fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83500">Bug 83500</a> - si_dma_copy_tile causes GPU hangs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85647">Bug 85647</a> - Random radeonsi crashes with mesa 10.3.x</li>
</ul>
<h2>Changes</h2>
<p>Brian Paul (1):</p>
<ul>
<li>st/mesa: copy sampler_array_size field when copying instructions</li>
</ul>
<p>Chad Versace (1):</p>
<ul>
<li>i965: Fix segfault in WebGL Conformance on Ivybridge</li>
</ul>
<p>Dave Airlie (5):</p>
<ul>
<li>r600g/cayman: fix integer multiplication output overwrite (v2)</li>
<li>r600g/cayman: fix texture gather tests</li>
<li>r600g/cayman: handle empty vertex shaders</li>
<li>r600g: geom shaders: always load texture src regs from inputs</li>
<li>r600g: limit texture offset application to specific types (v2)</li>
</ul>
<p>Emil Velikov (3):</p>
<ul>
<li>docs: Add sha256 sums for the 10.3.3 release</li>
<li>configure.ac: roll up a program for the sse4.1 check</li>
<li>get-pick-list.sh: Require explicit "10.3" for nominating stable patches</li>
</ul>
<p>Ilia Mirkin (1):</p>
<ul>
<li>st/mesa: add a fallback for clear_with_quad when no vs_layer</li>
</ul>
<p>José Fonseca (1):</p>
<ul>
<li>llvmpipe: Avoid deadlock when unloading opengl32.dll</li>
</ul>
<p>Kenneth Graunke (1):</p>
<ul>
<li>i915g: we also have more than 0 viewports!</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>radeonsi: Disable asynchronous DMA except for PIPE_BUFFER</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,88 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.3.5 Release Notes / December 5, 2014</h1>
<p>
Mesa 10.3.5 is a bug fix release which fixes bugs found since the 10.3.4 release.
</p>
<p>
Mesa 10.3.5 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
7ea71c3cce89114df3dc050376afa1c6f6bf235d77a68f9703273603d6a90621 MesaLib-10.3.5.tar.gz
eb75d2790f1606d59d50a6acaa637b6c75f2155b3e0eca3d5099165c0d9556ae MesaLib-10.3.5.tar.bz2
164bc64ba63fb07ff255ff8de6ed3c95ff545dfe8f864c44c33abe94788da910 MesaLib-10.3.5.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86618">Bug 86618</a> - [NV96] neg modifiers not working in MIN and MAX operations</li>
</ul>
<h2>Changes</h2>
<p>Brian Paul (2):</p>
<ul>
<li>mesa: fix arithmetic error in _mesa_compute_compressed_pixelstore()</li>
<li>mesa: fix height error check for 1D array textures</li>
</ul>
<p>Chris Forbes (2):</p>
<ul>
<li>i965: Handle nested uniform array indexing</li>
<li>mesa: Fix Get(GL_TRANSPOSE_CURRENT_MATRIX_ARB) to transpose</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: Add sha256 sums for the 10.3.5 release</li>
<li>Update version to 10.3.5</li>
</ul>
<p>Ilia Mirkin (6):</p>
<ul>
<li>nv50/ir: set neg modifiers on min/max args</li>
<li>nv50,nvc0: actually check constbufs for invalidation</li>
<li>nv50,nvc0: buffer resources can be bound as other things down the line</li>
<li>freedreno/ir3: don't pass consts to madsh.m16 in MOD logic</li>
<li>freedreno/a3xx: only enable blend clamp for non-float formats</li>
<li>freedreno/ir3: fix UMAD</li>
</ul>
<p>Rob Clark (1):</p>
<ul>
<li>configure.ac: bump libdrm_freedreno requirement</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,124 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.3.6 Release Notes / December 29, 2014</h1>
<p>
Mesa 10.3.6 is a bug fix release which fixes bugs found since the 10.3.5 release.
</p>
<p>
Mesa 10.3.6 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
c4d053d6bc6604cb5c93c99e0ef2e815c539f26dc5a03737eb3809bc1767d12f MesaLib-10.3.6.tar.gz
8d43673c6788fbf85f9c36c3a95c61ccf46f8835fc9c0d85d34474490d80572b MesaLib-10.3.6.tar.bz2
6b5b1e9a13949cfdb76fe51e8dcc3ea71e464a5ca73d11fdc29c20c4ba3f411a MesaLib-10.3.6.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=60879">Bug 60879</a> - [radeonsi] X11 can't start with acceleration enabled</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82585">Bug 82585</a> - geometry shader with optional out variable segfaults</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82991">Bug 82991</a> - Inverted bumpmap in webgl applications</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84777">Bug 84777</a> - [BSW]Piglit spec_glsl-1.50_execution_geometry-basic fails</li>
</ul>
<h2>Changes</h2>
<p>Andres Gomez (1):</p>
<ul>
<li>i965/brw_reg: struct constructor now needs explicit negate and abs values.</li>
</ul>
<p>Ben Widawsky (1):</p>
<ul>
<li>i965/gs: Avoid DW * DW mul</li>
</ul>
<p>Dave Airlie (1):</p>
<ul>
<li>r600g: only init GS_VERT_ITEMSIZE on r600</li>
</ul>
<p>Emil Velikov (3):</p>
<ul>
<li>docs: Add sha256 sums for the 10.3.5 release</li>
<li>Revert "glx/dri3: Request non-vsynced Present for swapinterval zero. (v3)"</li>
<li>Update version to 10.3.6</li>
</ul>
<p>Ian Romanick (2):</p>
<ul>
<li>linker: Wrap access of producer_var with a NULL check</li>
<li>linker: Assign varying locations geometry shader inputs for SSO</li>
</ul>
<p>Ilia Mirkin (3):</p>
<ul>
<li>util/primconvert: pass index bias through</li>
<li>util/primconvert: support instanced rendering</li>
<li>util/primconvert: take ib offset into account</li>
</ul>
<p>José Fonseca (1):</p>
<ul>
<li>util/primconvert: Avoid point arithmetic; apply offset on all cases.</li>
</ul>
<p>Marek Olšák (1):</p>
<ul>
<li>docs/relnotes: document the removal of GALLIUM_MSAA</li>
</ul>
<p>Mario Kleiner (4):</p>
<ul>
<li>glx/dri3: Fix glXWaitForSbcOML() to handle targetSBC==0 correctly. (v2)</li>
<li>glx/dri3: Track separate (ust, msc) for PresentPixmap vs. PresentNotifyMsc (v2)</li>
<li>glx/dri3: Request non-vsynced Present for swapinterval zero. (v3)</li>
<li>glx/dri3: Don't fail on glXSwapBuffersMscOML(dpy, window, 0, 0, 0) (v2)</li>
</ul>
<p>Maxence Le Doré (1):</p>
<ul>
<li>glsl: Add gl_MaxViewports to available builtin constants</li>
</ul>
<p>Tom Stellard (1):</p>
<ul>
<li>radeonsi: Program RASTER_CONFIG for harvested GPUs v5</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,93 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.3.7 Release Notes / January 12, 2015</h1>
<p>
Mesa 10.3.7 is a bug fix release which fixes bugs found since the 10.3.6 release.
</p>
<p>
Mesa 10.3.7 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
bc13f33c19bc9f44a0565fdd51a8f9d1c0153a3365c429ceaf4ef43b7022b052 MesaLib-10.3.7.tar.gz
43c6ced15e237cbb21b3082d7c0b42777c50c1f731d0d4b5efb5231063fb6a5b MesaLib-10.3.7.tar.bz2
d821fd46baf804fecfcf403e901800a4b996c7dd1c83f20a354b46566a49026f MesaLib-10.3.7.zip
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85529">Bug 85529</a> - Surfaces not drawn in Unvanquished</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87619">Bug 87619</a> - Changes to state such as render targets change fragment shader without marking it dirty.</li>
</ul>
<h2>Changes</h2>
<p>Chad Versace (2):</p>
<ul>
<li>i965: Use safer pointer arithmetic in intel_texsubimage_tiled_memcpy()</li>
<li>i965: Use safer pointer arithmetic in gather_oa_results()</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: Add sha256 sums for the 10.3.6 release</li>
<li>Update version to 10.3.7</li>
</ul>
<p>Ilia Mirkin (2):</p>
<ul>
<li>nv50,nvc0: set vertex id base to index_bias</li>
<li>nv50/ir: fix texture offsets in release builds</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>i965: Add missing BRW_NEW_*_PROG_DATA to texture/renderbuffer atoms.</li>
<li>i965: Fix start/base_vertex_location for &gt;1 prims but !BRW_NEW_VERTICES.</li>
</ul>
<p>Marek Olšák (3):</p>
<ul>
<li>glsl_to_tgsi: fix a bug in copy propagation</li>
<li>vbo: ignore primitive restart if FixedIndex is enabled in DrawArrays</li>
<li>st/mesa: fix GL_PRIMITIVE_RESTART_FIXED_INDEX</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>radeonsi: Don't modify PA_SC_RASTER_CONFIG register value if rb_mask == 0</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,212 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.0 Release Notes / March 06, 2015</h1>
<p>
Mesa 10.5.0 is a new development release.
People who are concerned with stability and reliability should stick
with a previous release or wait for Mesa 10.5.1.
</p>
<p>
Mesa 10.5.0 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
2bb6e2e982ee4d8264d52d638c2a4e3f8a164190336d72d4e34ae1304d87ed91 mesa-10.5.0.tar.gz
d7ca9f9044bbdd674377e3eebceef1fae339c8817b9aa435c2053e4fea44e5d3 mesa-10.5.0.tar.xz
</pre>
<h2>New features</h2>
<p>
Note: some of the new features are only available with certain drivers.
</p>
<ul>
<li>GL_ARB_framebuffer_sRGB on freedreno</li>
<li>GL_ARB_texture_rg on freedreno</li>
<li>GL_EXT_packed_float on freedreno</li>
<li>GL_EXT_polygon_offset_clamp on i965, nv50, nvc0, r600, radeonsi, llvmpipe</li>
<li>GL_EXT_texture_shared_exponent on freedreno</li>
<li>GL_EXT_texture_snorm on freedreno</li>
</ul>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=10370">Bug 10370</a> - Incorrect pixels read back if draw bitmap texture through Display list</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=45348">Bug 45348</a> - [swrast] piglit fbo-drawbuffers-arbfp regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=60879">Bug 60879</a> - [radeonsi] X11 can't start with acceleration enabled</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=67672">Bug 67672</a> - [llvmpipe] lp_test_arit fails on old CPUs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77544">Bug 77544</a> - i965: Try to use LINE instructions to perform MAD with immediate arguments</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78770">Bug 78770</a> - [SNB bisected]Webglc conformance/textures/texture-size-limit.html fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80568">Bug 80568</a> - [gen4] GPU Crash During Google Chrome Operation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82477">Bug 82477</a> - [softpipe] piglit fp-long-alu regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82585">Bug 82585</a> - geometry shader with optional out variable segfaults</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82991">Bug 82991</a> - Inverted bumpmap in webgl applications</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83463">Bug 83463</a> - [swrast] piglit glsl-vs-clamp-1 regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83500">Bug 83500</a> - si_dma_copy_tile causes GPU hangs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83510">Bug 83510</a> - Graphical glitches in Unreal Engine 4</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83908">Bug 83908</a> - [i965] Incorrect icon colors in Steam Big Picture</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84212">Bug 84212</a> - [BSW]ES3-CTS.shaders.loops.do_while_dynamic_iterations.vector_counter_vertex fails and causes GPU hang</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84651">Bug 84651</a> - Distorted graphics or black window when running Battle.net app on Intel hardware via wine</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84777">Bug 84777</a> - [BSW]Piglit spec_glsl-1.50_execution_geometry-basic fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85367">Bug 85367</a> - [gen4] GPU hang in glmark-es2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85467">Bug 85467</a> - [llvmpipe] piglit gl-1.0-dlist-beginend failure with llvm-3.6.0svn</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85529">Bug 85529</a> - Surfaces not drawn in Unvanquished</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85647">Bug 85647</a> - Random radeonsi crashes with mesa 10.3.x</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85696">Bug 85696</a> - r600g+nine: Bioshock shader failure after 7b1c0cbc90d456384b0950ad21faa3c61a6b43ff</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86089">Bug 86089</a> - [r600g][mesa 10.4.0-dev] shader failure - r600_sb::bc_finalizer::cf_peephole() when starting Second Life</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86618">Bug 86618</a> - [NV96] neg modifiers not working in MIN and MAX operations</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86760">Bug 86760</a> - mesa doesn't build: recipe for target 'r600_llvm.lo' failed</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86764">Bug 86764</a> - [SNB+ Bisected]Piglit glean/pointSprite fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86788">Bug 86788</a> - (bisected) 32bit UrbanTerror 4.1 timedemo sse4.1 segfault...</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86811">Bug 86811</a> - [BDW/BSW Bisected]Piglit spec_arb_shading_language_packing_execution_built-in-functions_vs-unpackSnorm4x8 fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86837">Bug 86837</a> - kodi segfault since auxiliary/vl: rework the build of the VL code</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86939">Bug 86939</a> - test_vf_float_conversions.cpp:63:12: error: expected primary-expression before union</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86944">Bug 86944</a> - glsl_parser_extras.cpp&quot;, line 1455: Error: Badly formed expression. (Oracle Studio)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86958">Bug 86958</a> - lp_bld_misc.cpp:503:40: error: no matching function for call to llvm::EngineBuilder::setMCJITMemoryManager(ShaderMemoryManager*&amp;)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86969">Bug 86969</a> - _drm_intel_gem_bo_references() function takes half the CPU with Witcher2 game</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87076">Bug 87076</a> - Dead Island needs allow_glsl_extension_directive_midshader</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87516">Bug 87516</a> - glProgramBinary violates spec</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87619">Bug 87619</a> - Changes to state such as render targets change fragment shader without marking it dirty.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87658">Bug 87658</a> - [llvmpipe] SEGV in sse2_has_daz on ancient Pentium4-M</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87694">Bug 87694</a> - [SNB] Crash in brw_begin_transform_feedback</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87886">Bug 87886</a> - constant fps drops with Intel and Radeon</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87887">Bug 87887</a> - [i965 Bisected]ES2-CTS.gtf.GL.cos.cos_float_vert_xvary fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87913">Bug 87913</a> - CPU cacheline size of 0 can be returned by CPUID leaf 0x80000006 in some virtual machines</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88079">Bug 88079</a> - dEQP-GLES3.functional.fbo.completeness.renderable.renderbuffer.color0 tests fail due to enabling of GL_RGB and GL_RGBA</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88170">Bug 88170</a> - 32 bits opengl apps crash with latest llvm 3.6 git / mesa git / radeonsi</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88219">Bug 88219</a> - include/c11/threads_posix.h:197: undefined reference to `pthread_mutex_lock'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88227">Bug 88227</a> - Radeonsi: High GTT usage in Prison Architect large map</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88248">Bug 88248</a> - Calling glClear while there is an occlusion query in progress messes up the results</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88335">Bug 88335</a> - format_pack.c:9567:22: error: expected ')'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88385">Bug 88385</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.gtf.GL3Tests.packed_pixels.packed_pixels core dumped</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88467">Bug 88467</a> - nir.c:140: error: nir_src has no member named ssa</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88478">Bug 88478</a> - #error &quot;&lt;malloc.h&gt; has been replaced by &lt;stdlib.h&gt;&quot;</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88519">Bug 88519</a> - sha1.c:210:22: error: 'grcy_md_hd_t' undeclared (first use in this function)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88523">Bug 88523</a> - sha1.c:37: error: 'SHA1_CTX' undeclared (first use in this function)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88561">Bug 88561</a> - [radeonsi][regression,bisected] Depth test/buffer issues in Portal</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88658">Bug 88658</a> - (bisected) Slow video playback on Kabini</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88662">Bug 88662</a> - unaligned access to gl_dlist_node</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88783">Bug 88783</a> - FTBFS: Clover: src/gallium/state_trackers/clover/llvm/invocation.cpp:335:49: error: no matching function for call to 'llvm::TargetLibraryInfo::TargetLibraryInfo(llvm::Triple)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88792">Bug 88792</a> - [BDW/BSW Bisected]Piglit spec_ARB_pixel_buffer_object_pbo-read-argb8888 fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88806">Bug 88806</a> - nir/nir_constant_expressions.c:2754:15: error: controlling expression type 'unsigned int' not compatible with any generic association type</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88841">Bug 88841</a> - [SNB/IVB/HSW/BDW Bisected]Piglit spec_EGL_NOK_texture_from_pixmap_basic fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88852">Bug 88852</a> - macros.h(181) : error C2143: syntax error : missing '{' before 'enum [tag]'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88905">Bug 88905</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.gtf.GL3Tests.packed_pixels.packed_pixels fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88930">Bug 88930</a> - [osmesa] osbuffer-&gt;textures should be indexed by attachment type</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88962">Bug 88962</a> - [osmesa] Crash on postprocessing if z buffer is NULL</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89032">Bug 89032</a> - [BDW/BSW/SKL Bisected]Piglit spec_OpenGL_1.1_infinite-spot-light fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89037">Bug 89037</a> - [SKL]Piglit spec_EXT_texture_array_copyteximage_1D_ARRAY_samples=2 sporadically causes GPU hang</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89068">Bug 89068</a> - glTexImage2D regression by texstore_rgba switch to _mesa_format_convert</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89069">Bug 89069</a> - Lack of grass in The Talos Principle on radeonsi (native\wine\nine)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89180">Bug 89180</a> - [IVB regression] Rendering issues in Mass Effect through VMware Workstation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86330">Bug 86330</a> - lp_bld_debug.cpp:112: multiple definition of `raw_debug_ostream::write_impl(char const*, unsigned long)'</li>
</ul>
<h2>Changes</h2>
<ul>
<li>Removed support for GCC versions earlier than 4.2.0.</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,217 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.1 Release Notes / March 13, 2015</h1>
<p>
Mesa 10.5.1 is a bug fix release which fixes bugs found since the 10.5.0 release.
</p>
<p>
Mesa 10.5.1 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
b5b6256a6d46023e16a675257fd11a0f94d7b3e60a76cf112952da3d0fef8e9b mesa-10.5.1.tar.gz
ffc51943d15c6812ee7611d053d8980a683fbd6a4986cff567b12cc66637d679 mesa-10.5.1.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79202">Bug 79202</a> - valgrind errors in glsl-fs-uniform-array-loop-unroll.shader_test; random code generation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84613">Bug 84613</a> - [G965, bisected] piglit regressions : glslparsertest.glsl2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86747">Bug 86747</a> - Noise in Football Manager 2014 textures</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86974">Bug 86974</a> - INTEL_DEBUG=shader_time always asserts in fs_generator::generate_code() when Mesa is built with --enable-debug (= with asserts)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88246">Bug 88246</a> - Commit 2881b12 causes 43 DrawElements test regressions</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88793">Bug 88793</a> - [BDW/BSW Bisected]Piglit/shaders_glsl-max-varyings fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88883">Bug 88883</a> - ir-a2xx.c: variable changed in assert statement</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88885">Bug 88885</a> - Transform feedback uses incorrect interleaving if a previous draw did not write gl_Position</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89095">Bug 89095</a> - [SNB/IVB/BYT Bisected]Webglc conformance/glsl/functions/glsl-function-mix-float.html fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89156">Bug 89156</a> - r300g: GL_COMPRESSED_RED_RGTC1 / ATI1N support broken</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89224">Bug 89224</a> - Incorrect rendering of Unigine Valley running in VM on VMware Workstation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89292">Bug 89292</a> - [regression,bisected] incomplete screenshots in some cases</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89311">Bug 89311</a> - [regression, bisected] dEQP: Added entry points for glCompressedTextureSubImage*D.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89312">Bug 89312</a> - [regression, bisected] main: Added entry points for CopyTextureSubImage*D. (d6b7c40cecfe01)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89315">Bug 89315</a> - [HSW, regression, bisected] i965/fs: Emit MAD instructions when possible.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89317">Bug 89317</a> - [HSW, regression, bisected] i965: Add LINTERP/CINTERP to can_do_cmod() (d91390634)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89416">Bug 89416</a> - UE4Editor crash after load project</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89430">Bug 89430</a> - [g965][bisected] arb_copy_image-targets gl_texture* tests fail</li>
</ul>
<h2>Changes</h2>
<p>Andrey Sudnik (1):</p>
<ul>
<li>i965/vec4: Don't lose the saturate modifier in copy propagation.</li>
</ul>
<p>Chris Forbes (1):</p>
<ul>
<li>i965/gs: Check newly-generated GS-out VUE map against correct stage</li>
</ul>
<p>Daniel Stone (1):</p>
<ul>
<li>egl: Take alpha bits into account when selecting GBM formats</li>
</ul>
<p>Emil Velikov (5):</p>
<ul>
<li>docs: Add sha256 sums for the 10.5.0 release</li>
<li>egl/main: no longer export internal function</li>
<li>cherry-ignore: ignore a few more commits picked without -x</li>
<li>mapi: fix commit 90411b56f6bc817e229d8801ac0adad6d4e3fb7a</li>
<li>Update version to 10.5.1</li>
</ul>
<p>Frank Henigman (1):</p>
<ul>
<li>intel: fix EGLImage renderbuffer _BaseFormat</li>
</ul>
<p>Iago Toral Quiroga (1):</p>
<ul>
<li>i965: Fix out-of-bounds accesses into pull_constant_loc array</li>
</ul>
<p>Ian Romanick (1):</p>
<ul>
<li>i965/fs/nir: Use emit_math for nir_op_fpow</li>
</ul>
<p>Ilia Mirkin (3):</p>
<ul>
<li>freedreno: move fb state copy after checking for size change</li>
<li>freedreno/ir3: fix array count returned by TXQ</li>
<li>freedreno/ir3: get the # of miplevels from getinfo</li>
</ul>
<p>Jason Ekstrand (2):</p>
<ul>
<li>meta/TexSubImage: Stash everything other than PIXEL_TRANSFER/store in meta_begin</li>
<li>main/base_tex_format: Properly handle STENCIL_INDEX1/4/16</li>
</ul>
<p>Kenneth Graunke (8):</p>
<ul>
<li>i965: Split Gen4-5 BlitFramebuffer code; prefer BLT over Meta.</li>
<li>glsl: Mark array access when copying to a temporary for the ?: operator.</li>
<li>i965/fs: Set force_writemask_all on shader_time instructions.</li>
<li>i965/fs: Set smear on shader_time diff register.</li>
<li>i965/fs: Make emit_shader_time_write return rather than emit.</li>
<li>i965/fs: Make get_timestamp() pass back the MOV rather than emitting it.</li>
<li>i965/fs: Make emit_shader_time_end() insert before EOT.</li>
<li>i965/fs: Don't issue FB writes for bound but unwritten color targets.</li>
</ul>
<p>Laura Ekstrand (2):</p>
<ul>
<li>main: Fix target checking for CompressedTexSubImage*D.</li>
<li>main: Fix target checking for CopyTexSubImage*D.</li>
</ul>
<p>Marc-Andre Lureau (1):</p>
<ul>
<li>gallium/auxiliary/indices: fix start param</li>
</ul>
<p>Marek Olšák (3):</p>
<ul>
<li>r300g: fix RGTC1 and LATC1 SNORM formats</li>
<li>r300g: fix a crash when resolving into an sRGB texture</li>
<li>r300g: fix sRGB-&gt;sRGB blits</li>
</ul>
<p>Matt Turner (12):</p>
<ul>
<li>i965/vec4: Fix implementation of i2b.</li>
<li>mesa: Indent break statements and add a missing one.</li>
<li>mesa: Free memory allocated for luminance in readpixels.</li>
<li>mesa: Correct backwards NULL check.</li>
<li>i965: Consider scratch writes to have side effects.</li>
<li>i965/fs: Don't use backend_visitor::instructions after creating the CFG.</li>
<li>r300g: Use PATH_MAX instead of limiting ourselves to 100 chars.</li>
<li>r300g: Check return value of snprintf().</li>
<li>i965/fs: Don't propagate cmod to inst with different type.</li>
<li>i965: Tell intel_get_memcpy() which direction the memcpy() is going.</li>
<li>Revert SHA1 additions.</li>
<li>i965: Avoid applying negate to wrong MAD source.</li>
</ul>
<p>Neil Roberts (4):</p>
<ul>
<li>meta: In pbo_{Get,}TexSubImage don't repeatedly rebind the source tex</li>
<li>Revert "common: Fix PBOs for 1D_ARRAY."</li>
<li>meta: Allow GL_UN/PACK_IMAGE_HEIGHT in _mesa_meta_pbo_Get/TexSubImage</li>
<li>meta: Fix the y offset for 1D_ARRAY in _mesa_meta_pbo_TexSubImage</li>
</ul>
<p>Rob Clark (11):</p>
<ul>
<li>freedreno/ir3: fix silly typo for binning pass shaders</li>
<li>freedreno/a2xx: fix increment in assert</li>
<li>freedreno/a4xx: bit of cleanup</li>
<li>freedreno: update generated headers</li>
<li>freedreno/a4xx: set PC_PRIM_VTX_CNTL.VAROUT properly</li>
<li>freedreno: update generated headers</li>
<li>freedreno/a4xx: aniso filtering</li>
<li>freedreno/ir3: fix up cat6 instruction encodings</li>
<li>freedreno/ir3: add support for memory (cat6) instructions</li>
<li>freedreno/ir3: handle flat bypass for a4xx</li>
<li>freedreno/ir3: fix failed assert in grouping</li>
</ul>
<p>Stefan Dösinger (1):</p>
<ul>
<li>r300g: Fix the ATI1N swizzle (RGTC1 and LATC1)</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,130 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.2 Release Notes / March 28, 2015</h1>
<p>
Mesa 10.5.2 is a bug fix release which fixes bugs found since the 10.5.1 release.
</p>
<p>
Mesa 10.5.2 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
755220e160a9f22fda0dffd47746f997b6e196d03f8edc390df7793aecaaa541 mesa-10.5.2.tar.gz
2f4b6fb77c3e7d6f861558d0884a3073f575e1e673dad8d1b0624e78e9c4dd44 mesa-10.5.2.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88534">Bug 88534</a> - include/c11/threads_posix.h PTHREAD_MUTEX_RECURSIVE_NP not defined</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89328">Bug 89328</a> - python required to build Mesa release tarballs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89530">Bug 89530</a> - FTBFS in loader: missing fstat</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89590">Bug 89590</a> - Crash in glLinkProgram with shaders with multiple constant arrays</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89680">Bug 89680</a> - Hard link exist in Mesa 10.5.1 sources</li>
</ul>
<h2>Changes</h2>
<p>Anuj Phogat (1):</p>
<ul>
<li>glsl: Generate link error for non-matching gl_FragCoord redeclarations</li>
</ul>
<p>Emil Velikov (7):</p>
<ul>
<li>docs: Add sha256 sums for the 10.5.1 release</li>
<li>automake: add missing egl files to the tarball</li>
<li>st/egl: don't ship the dri2.c link at the tarball</li>
<li>loader: include &lt;sys/stat.h&gt; for non-sysfs builds</li>
<li>auxiliary/os: fix the android build - s/drm_munmap/os_munmap/</li>
<li>cherry-ignore: add commit non applicable for 10.5</li>
<li>Update version to 10.5.2</li>
</ul>
<p>Felix Janda (1):</p>
<ul>
<li>c11/threads: Use PTHREAD_MUTEX_RECURSIVE by default</li>
</ul>
<p>Francisco Jerez (1):</p>
<ul>
<li>i965: Set nr_params to the number of uniform components in the VS/GS path.</li>
</ul>
<p>Ilia Mirkin (2):</p>
<ul>
<li>freedreno/a3xx: use the same layer size for all slices</li>
<li>freedreno: fix slice pitch calculations</li>
</ul>
<p>Marek Olšák (1):</p>
<ul>
<li>radeonsi: increase coords array size for radeon_llvm_emit_prepare_cube_coords</li>
</ul>
<p>Mario Kleiner (2):</p>
<ul>
<li>glx: Handle out-of-sequence swap completion events correctly. (v2)</li>
<li>mapi: Make private copies of name strings provided by client.</li>
</ul>
<p>Rob Clark (1):</p>
<ul>
<li>freedreno: update generated headers</li>
</ul>
<p>Samuel Iglesias Gonsalvez (2):</p>
<ul>
<li>glsl: optimize (0 cmp x + y) into (-x cmp y).</li>
<li>configure: Introduce new output variable to ax_check_python_mako_module.m4</li>
</ul>
<p>Tapani Pälli (1):</p>
<ul>
<li>glsl: fix names in lower_constant_arrays_to_uniforms</li>
</ul>
<p>Tom Stellard (1):</p>
<ul>
<li>clover: Return 0 as storage size for local kernel args that are not set v2</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,125 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.3 Release Notes / April 12, 2015</h1>
<p>
Mesa 10.5.3 is a bug fix release which fixes bugs found since the 10.5.2 release.
</p>
<p>
Mesa 10.5.3 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
2371b8e210ccd19f61dd94b6664d612e5a479ba7d431a074512d87633bd6aeb4 mesa-10.5.3.tar.gz
8701ee1be4f5c03238f5e63c1a9bd4cc03a2f6c0155ed42a1ae7d58f18912ba2 mesa-10.5.3.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83962">Bug 83962</a> - [HSW/BYT]Piglit spec_ARB_gpu_shader5_arb_gpu_shader5-emitstreamvertex_nodraw fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89679">Bug 89679</a> - [NV50] Portal/Half-Life 2 will not start (native Steam)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89746">Bug 89746</a> - Mesa and LLVM 3.6+ break opengl for genymotion</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89754">Bug 89754</a> - vertexAttrib fails WebGL Conformance test with mesa drivers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89758">Bug 89758</a> - pow WebGL Conformance test with mesa drivers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89759">Bug 89759</a> - WebGL OGL ES GLSL conformance test with mesa drivers fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89905">Bug 89905</a> - scons build broken on 10.5.2 due to activated vega st</li>
</ul>
<h2>Changes</h2>
<p>Dave Airlie (1):</p>
<ul>
<li>st_glsl_to_tgsi: only do mov copy propagation on temps (v2)</li>
</ul>
<p>Emil Velikov (5):</p>
<ul>
<li>docs: Add sha256 sums for the 10.5.2 release</li>
<li>xmlpool: don't forget to ship the MOS</li>
<li>configure.ac: error out if python/mako is not found when required</li>
<li>dist: add the VG depedencies into the tarball</li>
<li>Update version to 10.5.3</li>
</ul>
<p>Iago Toral Quiroga (1):</p>
<ul>
<li>i965: Do not render primitives in non-zero streams then TF is disabled</li>
</ul>
<p>Ilia Mirkin (7):</p>
<ul>
<li>st/mesa: update arrays when the current attrib has been updated</li>
<li>nv50/ir: take postFactor into account when doing peephole optimizations</li>
<li>nv50/ir/gk110: fix offset flag position for TXD opcode</li>
<li>freedreno/a3xx: fix 3d texture layout</li>
<li>freedreno/a3xx: point size should not be divided by 2</li>
<li>nv50: allocate more offset space for occlusion queries</li>
<li>nv50,nvc0: limit the y-tiling of 3d textures to the first level's tiling</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>i965: Fix instanced geometry shaders on Gen8+.</li>
<li>i965: Add forgotten multi-stream code to Gen8 SOL state.</li>
</ul>
<p>Marcin Ślusarz (1):</p>
<ul>
<li>nouveau: synchronize "scratch runout" destruction with the command stream</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>radeonsi: Cache LLVMTargetMachineRef in context instead of in screen</li>
</ul>
<p>Tom Stellard (1):</p>
<ul>
<li>clover: Return CL_BUILD_ERROR for CL_PROGRAM_BUILD_STATUS when compilation fails v2</li>
</ul>
<p>Ville Syrjälä (1):</p>
<ul>
<li>i965: Fix URB size for CHV</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,125 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.4 Release Notes / April 24, 2015</h1>
<p>
Mesa 10.5.4 is a bug fix release which fixes bugs found since the 10.5.3 release.
</p>
<p>
Mesa 10.5.4 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
e1089567fc7bf8d9b2d8badcc9f2fc3b758701c8c0ccfe7af1805549fea53f11 mesa-10.5.4.tar.gz
b51e723f3a20d842c88a92d809435b229fc4744ca0dbec0317d9d4a3ac4c6803 mesa-10.5.4.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=69226">Bug 69226</a> - Cannot enable basic shaders with Second Life aborts attempt</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=71591">Bug 71591</a> - Second Life shaders fail to compile (extension declared in middle of shader)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81025">Bug 81025</a> - [IVB/BYT Bisected]Piglit spec_ARB_draw_indirect_arb_draw_indirect-draw-elements-prim-restart-ugly fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89457">Bug 89457</a> - [BSW Bisected]ogles3conform ES3-CTS.gtf.GL3Tests.shadow.shadow_execution_vert fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89957">Bug 89957</a> - vm protection faults in piglit lest: texsubimage cube_map_array pbo</li>
</ul>
<h2>Changes</h2>
<p>Brian Paul (1):</p>
<ul>
<li>glsl: rewrite glsl_type::record_key_hash() to avoid buffer overflow</li>
</ul>
<p>Dave Airlie (2):</p>
<ul>
<li>st/mesa: convert sub image for cube map arrays to 2d arrays for upload</li>
<li>st/mesa: align cube map arrays layers</li>
</ul>
<p>Emil Velikov (11):</p>
<ul>
<li>docs: Add 256 sums for the 10.5.3 release</li>
<li>radeonsi: remove unused si_dump_key()</li>
<li>android: use LOCAL_SHARED_LIBRARIES over TARGET_OUT_HEADERS</li>
<li>android: add $(mesa_top)/src include to the whole of mesa</li>
<li>android: egl: add libsync_cflags to the build</li>
<li>android: dri/common: conditionally include drm_cflags/set __NOT_HAVE_DRM_H</li>
<li>android: add HAVE__BUILTIN_* and HAVE_FUNC_ATTRIBUTE_* defines</li>
<li>android: add $(mesa_top)/src/mesa/main to the includes list</li>
<li>android: dri: link against libmesa_util</li>
<li>android: mesa: fix the path of the SSE4_1 optimisations</li>
<li>Update version to 10.5.4</li>
</ul>
<p>Ian Romanick (1):</p>
<ul>
<li>nir: Fix typo in "ushr by 0" algebraic replacement</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>i965: Fix software primitive restart with indirect draws.</li>
<li>drirc: Add "Second Life" quirk (allow_glsl_extension_directive_midshader).</li>
</ul>
<p>Kristian Høgsberg (1):</p>
<ul>
<li>i965: Rewrite ir_tex to ir_txl with lod 0 for vertex shaders</li>
</ul>
<p>Marek Olšák (2):</p>
<ul>
<li>glsl_to_tgsi: fix out-of-bounds constant access and crash for uniforms</li>
<li>glsl_to_tgsi: don't use a potentially-undefined immediate for ir_query_levels</li>
</ul>
<p>Mathias Froehlich (1):</p>
<ul>
<li>i965: Flush batchbuffer containing the query on glQueryCounter.</li>
</ul>
<p>Mauro Rossi (2):</p>
<ul>
<li>android: mesa: generate the format_{un,}pack.[ch] sources</li>
<li>android: add inital NIR build</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,95 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.5 Release Notes / May 11, 2015</h1>
<p>
Mesa 10.5.5 is a bug fix release which fixes bugs found since the 10.5.4 release.
</p>
<p>
Mesa 10.5.5 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
c10f00fd792b8290dd51ebcc48a9016c4cafab19ec205423c6fcadfd7f3a59f2 mesa-10.5.5.tar.gz
4ac4e4ea3414f1cadb1467f2f173f9e56170d31e8674f7953a46f0549d319f28 mesa-10.5.5.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88521">Bug 88521</a> - GLBenchmark 2.7 TRex renders with artifacts on Gen8 with !UXA</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89455">Bug 89455</a> - [NVC0/Gallium] Unigine Heaven black and white boxes</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89689">Bug 89689</a> - [Regression] Weston on DRM backend won't start with new version of mesa</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90130">Bug 90130</a> - gl_PrimitiveId seems to reset at 340</li>
</ul>
<h2>Changes</h2>
<p>Boyan Ding (1):</p>
<ul>
<li>i965: Add XRGB8888 format to intel_screen_make_configs</li>
</ul>
<p>Emil Velikov (3):</p>
<ul>
<li>docs: Add sha256 sums for the 10.5.4 release</li>
<li>r300: do not link against libdrm_intel</li>
<li>Update version to 10.5.5</li>
</ul>
<p>Ilia Mirkin (4):</p>
<ul>
<li>nvc0/ir: flush denorms to zero in non-compute shaders</li>
<li>gk110/ir: fix set with a register dest to not auto-set the abs flag</li>
<li>nvc0/ir: fix predicated PFETCH emission</li>
<li>nv50/ir: fix asFlow() const helper for OP_JOIN</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>i965: Make intel_emit_linear_blit handle Gen8+ alignment restrictions.</li>
<li>i965: Disallow linear blits that are not cacheline aligned.</li>
</ul>
<p>Roland Scheidegger (1):</p>
<ul>
<li>draw: fix prim ids when there's no gs</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,147 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.6 Release Notes / May 23, 2015</h1>
<p>
Mesa 10.5.6 is a bug fix release which fixes bugs found since the 10.5.5 release.
</p>
<p>
Mesa 10.5.6 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
89ff9cb08d0f6e3f34154864c3071253057cd21020759457c8ae27e0f70985d3 mesa-10.5.6.tar.gz
66017853bde5f7a6647db3eede30512a091a3491daa1708e0ad8027c328ba595 mesa-10.5.6.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86792">Bug 86792</a> - [NVC0] Portal 2 Crashes in Wine</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90147">Bug 90147</a> - swrast: build error undeclared _SC_PHYS_PAGES on osx</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90350">Bug 90350</a> - [G96] Portal's portal are incorrectly rendered</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90363">Bug 90363</a> - [nv50] HW state is not reset correctly when using a new GL context</li>
</ul>
<h2>Changes</h2>
<p>Alex Deucher (1):</p>
<ul>
<li>radeonsi: add new bonaire pci id</li>
</ul>
<p>Axel Davy (2):</p>
<ul>
<li>egl/wayland: properly destroy wayland objects</li>
<li>glx/dri3: Add additional check for gpu offloading case</li>
</ul>
<p>Emil Velikov (4):</p>
<ul>
<li>docs: Add sha256 sums for the 10.5.5 release</li>
<li>egl/main: fix EGL_KHR_get_all_proc_addresses</li>
<li>targets/osmesa: drop the -module tag from LDFLAGS</li>
<li>Update version to 10.5.6</li>
</ul>
<p>Francisco Jerez (4):</p>
<ul>
<li>clover: Refactor event::trigger and ::abort to prevent deadlock and reentrancy issues.</li>
<li>clover: Wrap event::_status in a method to prevent unlocked access.</li>
<li>clover: Implement locking of the wait_count, _chain and _status members of event.</li>
<li>i965: Fix PBO cache coherency issue after _mesa_meta_pbo_GetTexSubImage().</li>
</ul>
<p>Fredrik Höglund (2):</p>
<ul>
<li>main: Require that the texture exists in framebuffer_texture</li>
<li>mesa: Generate GL_INVALID_VALUE in framebuffer_texture when layer &lt; 0</li>
</ul>
<p>Ilia Mirkin (7):</p>
<ul>
<li>nv50/ir: only propagate saturate up if some actual folding took place</li>
<li>nv50: keep track of PGRAPH state in nv50_screen</li>
<li>nvc0: keep track of PGRAPH state in nvc0_screen</li>
<li>nvc0: reset the instanced elements state when doing blit using 3d engine</li>
<li>nv50/ir: only enable mul saturate on G200+</li>
<li>st/mesa: make sure to create a "clean" bool when doing i2b</li>
<li>nvc0: switch mechanism for shader eviction to be a while loop</li>
</ul>
<p>Jeremy Huddleston Sequoia (2):</p>
<ul>
<li>swrast: Build fix for darwin</li>
<li>darwin: Fix install name of libOSMesa</li>
</ul>
<p>Laura Ekstrand (2):</p>
<ul>
<li>main: Fix an error generated by FramebufferTexture</li>
<li>main: Complete error conditions for glInvalidate*Framebuffer.</li>
</ul>
<p>Marta Lofstedt (1):</p>
<ul>
<li>main: glGetIntegeri_v fails for GL_VERTEX_BINDING_STRIDE</li>
</ul>
<p>Rob Clark (2):</p>
<ul>
<li>freedreno: enable a306</li>
<li>freedreno: fix bug in tile/slot calculation</li>
</ul>
<p>Roland Scheidegger (1):</p>
<ul>
<li>draw: (trivial) fix out-of-bounds vector initialization</li>
</ul>
<p>Tim Rowley (1):</p>
<ul>
<li>mesa: fix shininess check for ffvertex_prog v2</li>
</ul>
<p>Tom Stellard (2):</p>
<ul>
<li>clover: Add a mutex to guard queue::queued_events</li>
<li>clover: Fix a bug with multi-threaded events v2</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,103 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.7 Release Notes / June 07, 2015</h1>
<p>
Mesa 10.5.7 is a bug fix release which fixes bugs found since the 10.5.6 release.
</p>
<p>
Mesa 10.5.7 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
8f865ce497435fdf25d4e35f3b5551b2bcd5f9bc6570561183be82af20d18b82 mesa-10.5.7.tar.gz
04d06890cd69af8089d6ca76f40e46dcf9cacfe4a9788b32be620574d4638818 mesa-10.5.7.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89131">Bug 89131</a> - [Bisected] Graphical corruption in Weston, shows old framebuffer pieces</li>
</ul>
<h2>Changes</h2>
<p>Ben Widawsky (1):</p>
<ul>
<li>i965: Emit 3DSTATE_MULTISAMPLE before WM_HZ_OP (gen8+)</li>
</ul>
<p>Emil Velikov (4):</p>
<ul>
<li>docs: Add sha256sums for the 10.5.6 release</li>
<li>get-pick-list.sh: Require explicit "10.5" for nominating stable patches</li>
<li>cherry-ignore: add clover build fix not applicable for 10.5</li>
<li>Update version to 10.5.7</li>
</ul>
<p>Ilia Mirkin (18):</p>
<ul>
<li>nvc0/ir: set ftz when sources are floats, not just destinations</li>
<li>nv50/ir: guess that the constant offset is the starting slot of array</li>
<li>nvc0/ir: LOAD's can't be used for shader inputs</li>
<li>nvc0: a geometry shader can have up to 1024 vertices output</li>
<li>nv50/ir: avoid messing up arg1 of PFETCH</li>
<li>nv30: don't leak fragprog consts</li>
<li>nv30: avoid leaking render state and draw shaders</li>
<li>nv30: fix clip plane uploads and enable changes</li>
<li>nv30/draw: avoid leaving stale pointers in draw state</li>
<li>nv30/draw: draw expects constbuf size in bytes, not vec4 units</li>
<li>st/mesa: don't leak glsl_to_tgsi object on link failure</li>
<li>glsl: avoid leaking linked gl_shader when there's a late linker error</li>
<li>nv30/draw: fix indexed draws with swtnl path and a resource index buffer</li>
<li>nv30/draw: only use the DMA1 object (GART) if the bo is not in VRAM</li>
<li>nv30/draw: allocate vertex buffers in gart</li>
<li>nv30/draw: switch varying hookup logic to know about texcoords</li>
<li>nv30: falling back to draw path for edgeflag does no good</li>
<li>nv30: avoid doing extra work on clear and hitting unexpected states</li>
</ul>
<p>Jason Ekstrand (1):</p>
<ul>
<li>i965/fs: Fix implied_mrf_writes for scratch writes</li>
</ul>
<p>Marek Olšák (1):</p>
<ul>
<li>st/dri: fix postprocessing crash when there's no depth buffer</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,112 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.8 Release Notes / June 20, 2015</h1>
<p>
Mesa 10.5.8 is a bug fix release which fixes bugs found since the 10.5.7 release.
</p>
<p>
Mesa 10.5.8 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
611ddcfa3c1bf13f7e6ccac785c8749c3b74c9a78452bac70f8372cf6b209aa0 mesa-10.5.8.tar.gz
2866b855c5299a4aed066338c77ff6467c389b2c30ada7647be8758663da2b54 mesa-10.5.8.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90310">Bug 90310</a> - Fails to build gallium_dri.so at linking stage with clang because of multiple redefinitions</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90347">Bug 90347</a> - [NVE0+] Failure to insert texbar under some circumstances (causing bad colors in Terasology)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90520">Bug 90520</a> - Register spilling clobbers registers used elsewhere in the shader</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90905">Bug 90905</a> - mesa: Finish subdir-objects transition</li>
</ul>
<h2>Changes</h2>
<p>Ben Widawsky (1):</p>
<ul>
<li>i965: Disable compaction for EOT send messages</li>
</ul>
<p>Boyan Ding (1):</p>
<ul>
<li>egl/x11: Set version of swrastLoader to 2</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: Add sha256sums for the 10.5.7 release</li>
<li>Update version to 10.5.8</li>
</ul>
<p>Erik Faye-Lund (1):</p>
<ul>
<li>mesa: build xmlconfig to a separate static library</li>
</ul>
<p>Francisco Jerez (1):</p>
<ul>
<li>i965: Don't compact instructions with unmapped bits.</li>
</ul>
<p>Ilia Mirkin (3):</p>
<ul>
<li>nvc0/ir: fix collection of first uses for texture barrier insertion</li>
<li>nv50,nvc0: clamp uniform size to 64k</li>
<li>nvc0/ir: can't have a join on a load with an indirect source</li>
</ul>
<p>Jason Ekstrand (1):</p>
<ul>
<li>i965/fs: Don't let the EOT send message interfere with the MRF hack</li>
</ul>
<p>Marek Olšák (1):</p>
<ul>
<li>egl: fix setting context flags</li>
</ul>
<p>Roland Scheidegger (1):</p>
<ul>
<li>draw: (trivial) fix NULL pointer dereference</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,140 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.5.9 Release Notes / July 04, 2015</h1>
<p>
Mesa 10.5.9 is a bug fix release which fixes bugs found since the 10.5.8 release.
</p>
<p>
Mesa 10.5.9 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
0c081b59572ee9732e7438d34adc3817fe8cc8d4b58abc0e71fd4b4c904945cb mesa-10.5.9.tar.gz
71c69f31d3dbc35cfa79950e58a01d27030378d8c7ef1259a0b31d4d0487f4ec mesa-10.5.9.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84225">Bug 84225</a> - Allow constant-index-expression sampler array indexing with GLSL-ES &lt; 300</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88999">Bug 88999</a> - [SKL] Compiz crashes after opening unity dash</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89118">Bug 89118</a> - [SKL Bisected]many Ogles3conform cases core dumped</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90537">Bug 90537</a> - radeonsi bo/va conflict on RADEON_GEM_VA (rscreen-&gt;ws-&gt;buffer_from_handle returns NULL)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90839">Bug 90839</a> - [10.5.5/10.6 regression, bisected] PBO glDrawPixels no longer using blit fastpath</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90873">Bug 90873</a> - Kernel hang, TearFree On, Mate desktop environment</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91056">Bug 91056</a> - The Bard's Tale (2005, native) has rendering issues</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91117">Bug 91117</a> - Nimbus (running in wine) has rendering issues, objects are semi-transparent</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91124">Bug 91124</a> - Civilization V (in Wine) has rendering issues: text missing, menu bar corrupted</li>
</ul>
<h2>Changes</h2>
<p>Ben Widawsky (2):</p>
<ul>
<li>i965/gen9: Implement Push Constant Buffer workaround</li>
<li>i965/skl: Use 1 register for uniform pull constant payload</li>
</ul>
<p>Boyan Ding (1):</p>
<ul>
<li>egl/x11: Remove duplicate call to dri2_x11_add_configs_for_visuals</li>
</ul>
<p>Chris Wilson (3):</p>
<ul>
<li>i965: Fix HW blitter pitch limits</li>
<li>i915: Blit RGBX&lt;-&gt;RGBA drawpixels</li>
<li>i965: Export format comparison for blitting between miptrees</li>
</ul>
<p>Emil Velikov (6):</p>
<ul>
<li>docs: Add sha256sums for the 10.5.8 release</li>
<li>configure: warn about shared_glapi &amp; xlib-glx only when both are set</li>
<li>configure: error out when building backend-less libEGL</li>
<li>configure: error out when building libEGL without shared-glapi</li>
<li>gbm: do not (over)link against libglapi.so</li>
<li>Update version to 10.5.9</li>
</ul>
<p>Frank Henigman (1):</p>
<ul>
<li>gbm: dlopen libglapi so gbm_create_device works</li>
</ul>
<p>Ilia Mirkin (8):</p>
<ul>
<li>glsl: add version checks to conditionals for builtin variable enablement</li>
<li>mesa: add GL_PROGRAM_PIPELINE support in KHR_debug calls</li>
<li>glsl: binding point is a texture unit, which is a combined space</li>
<li>nvc0: always put all tfb bufs into bufctx</li>
<li>nv50,nvc0: make sure to pushbuf_refn before putting bo into pushbuf_data</li>
<li>nv50/ir: propagate modifier to right arg when const-folding mad</li>
<li>nv50/ir: fix emission of address reg in 3rd source</li>
<li>nv50/ir: copy joinAt when splitting both before and after</li>
</ul>
<p>Mario Kleiner (2):</p>
<ul>
<li>nouveau: Use dup fd as key in drm-winsys hash table to fix ZaphodHeads.</li>
<li>winsys/radeon: Use dup fd as key in drm-winsys hash table to fix ZaphodHeads.</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>winsys/radeon: Unmap GPU VM address range when destroying BO</li>
</ul>
<p>Tapani Pälli (6):</p>
<ul>
<li>glsl: Allow dynamic sampler array indexing with GLSL ES &lt; 3.00</li>
<li>mesa/glsl: new compiler option EmitNoIndirectSampler</li>
<li>i915: use EmitNoIndirectSampler</li>
<li>mesa/st: use EmitNoIndirectSampler if !ARB_gpu_shader5</li>
<li>i965: use EmitNoIndirectSampler for gen &lt; 7</li>
<li>glsl: validate sampler array indexing for 'constant-index-expression'</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,331 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.0 Release Notes / June 14, 2015</h1>
<p>
Mesa 10.6.0 is a new development release.
People who are concerned with stability and reliability should stick
with a previous release or wait for Mesa 10.6.1.
</p>
<p>
Mesa 10.6.0 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
9bc659abdba26202509304f259723aaa4343dba6aac4bd87d5baea11d23c8c63 mesa-10.6.0.tar.gz
f37e2633978deed02ff0522abc36c709586e2b555fd439a82ab71dce2c866c76 mesa-10.6.0.tar.xz
</pre>
<h2>New features</h2>
<p>
Note: some of the new features are only available with certain drivers.
</p>
<ul>
<li>GL_AMD_pinned_memory on r600, radeonsi</li>
<li>GL_ARB_clip_control on i965</li>
<li>GL_ARB_depth_buffer_float on freedreno</li>
<li>GL_ARB_depth_clamp on freedreno</li>
<li>GL_ARB_direct_state_access on all drivers that support GL 2.0+</li>
<li>GL_ARB_draw_indirect, GL_ARB_multi_draw_indirect on r600</li>
<li>GL_ARB_draw_instanced on freedreno</li>
<li>GL_ARB_gpu_shader_fp64 on nvc0, softpipe</li>
<li>GL_ARB_gpu_shader5 on i965/gen8+</li>
<li>GL_ARB_instanced_arrays on freedreno</li>
<li>GL_ARB_pipeline_statistics_query on i965, nv50, nvc0, r600, radeonsi, softpipe</li>
<li>GL_ARB_program_interface_query (all drivers)</li>
<li>GL_ARB_texture_stencil8 on nv50, nvc0, r600, radeonsi, softpipe</li>
<li>GL_ARB_texture_view on llvmpipe, softpipe</li>
<li>GL_ARB_uniform_buffer_object on freedreno</li>
<li>GL_ARB_vertex_attrib_64bit on nvc0, softpipe</li>
<li>GL_ARB_viewport_array, GL_AMD_vertex_shader_viewport_index on i965/gen6</li>
<li>GL_EXT_draw_buffers2 on freedreno</li>
<li>GL_OES_EGL_sync on all drivers</li>
<li>EGL_KHR_fence_sync on i965, freedreno, nv50, nvc0, r600, radeonsi</li>
<li>EGL_KHR_wait_sync on i965, freedreno, nv50, nvc0, r600, radeonsi</li>
<li>EGL_KHR_cl_event2 on freedreno, nv50, nvc0, r600, radeonsi</li>
<li>GL_AMD_performance_monitor on nvc0</li>
</ul>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=15006">Bug 15006</a> - translate &amp; rotate the line cause Aliasing</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=27007">Bug 27007</a> - Lines disappear with GL_LINE_SMOOTH</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28832">Bug 28832</a> - piglit/general/line-aa-width fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=45348">Bug 45348</a> - [swrast] piglit fbo-drawbuffers-arbfp regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=60797">Bug 60797</a> - 1px lines in octave plot aliased to 0</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=67564">Bug 67564</a> - HiZ buffers are much larger than necessary</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=69226">Bug 69226</a> - Cannot enable basic shaders with Second Life aborts attempt</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=71591">Bug 71591</a> - Second Life shaders fail to compile (extension declared in middle of shader)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79202">Bug 79202</a> - valgrind errors in glsl-fs-uniform-array-loop-unroll.shader_test; random code generation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81025">Bug 81025</a> - [IVB/BYT Bisected]Piglit spec_ARB_draw_indirect_arb_draw_indirect-draw-elements-prim-restart-ugly fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82477">Bug 82477</a> - [softpipe] piglit fp-long-alu regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82668">Bug 82668</a> - Can't set int attributes to certain values on 32-bit</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82831">Bug 82831</a> - i965: Support GL_ARB_blend_func_extended in SIMD16</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83962">Bug 83962</a> - [HSW/BYT]Piglit spec_ARB_gpu_shader5_arb_gpu_shader5-emitstreamvertex_nodraw fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84613">Bug 84613</a> - [G965, bisected] piglit regressions : glslparsertest.glsl2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86747">Bug 86747</a> - Noise in Football Manager 2014 textures</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86792">Bug 86792</a> - [NVC0] Portal 2 Crashes in Wine</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86811">Bug 86811</a> - [BDW/BSW Bisected]Piglit spec_arb_shading_language_packing_execution_built-in-functions_vs-unpackSnorm4x8 fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86837">Bug 86837</a> - kodi segfault since auxiliary/vl: rework the build of the VL code</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86944">Bug 86944</a> - glsl_parser_extras.cpp&quot;, line 1455: Error: Badly formed expression. (Oracle Studio)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86974">Bug 86974</a> - INTEL_DEBUG=shader_time always asserts in fs_generator::generate_code() when Mesa is built with --enable-debug (= with asserts)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86980">Bug 86980</a> - [swrast] piglit fp-rfl regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87258">Bug 87258</a> - [BDW/BSW Bisected]Piglit spec_ARB_shader_atomic_counters_array-indexing fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88246">Bug 88246</a> - Commit 2881b12 causes 43 DrawElements test regressions</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88248">Bug 88248</a> - Calling glClear while there is an occlusion query in progress messes up the results</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88521">Bug 88521</a> - GLBenchmark 2.7 TRex renders with artifacts on Gen8 with !UXA</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88534">Bug 88534</a> - include/c11/threads_posix.h PTHREAD_MUTEX_RECURSIVE_NP not defined</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88561">Bug 88561</a> - [radeonsi][regression,bisected] Depth test/buffer issues in Portal</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88793">Bug 88793</a> - [BDW/BSW Bisected]Piglit/shaders_glsl-max-varyings fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88815">Bug 88815</a> - Incorrect handling of GLSL #line directive</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88883">Bug 88883</a> - ir-a2xx.c: variable changed in assert statement</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88885">Bug 88885</a> - Transform feedback uses incorrect interleaving if a previous draw did not write gl_Position</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88905">Bug 88905</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.gtf.GL3Tests.packed_pixels.packed_pixels fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88999">Bug 88999</a> - [SKL] Compiz crashes after opening unity dash</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89014">Bug 89014</a> - PIPE_QUERY_GPU_FINISHED is not acting as expected on SI</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89026">Bug 89026</a> - Renderbuffer layered state used for framebuffer completeness test</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89032">Bug 89032</a> - [BDW/BSW/SKL Bisected]Piglit spec_OpenGL_1.1_infinite-spot-light fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89037">Bug 89037</a> - [SKL]Piglit spec_EXT_texture_array_copyteximage_1D_ARRAY_samples=2 sporadically causes GPU hang</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89039">Bug 89039</a> - [SKL]etqw system hang</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89058">Bug 89058</a> - [SKL]Render error in some games (etqw-demo, nexuiz, portal)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89068">Bug 89068</a> - glTexImage2D regression by texstore_rgba switch to _mesa_format_convert</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89069">Bug 89069</a> - Lack of grass in The Talos Principle on radeonsi (native\wine\nine)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89094">Bug 89094</a> - [SNB/IVB/HSW/BYT Bisected]Ogles3conform ES3-CTS.gtf.GL3Tests.shadow.shadow_execution_vert fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89095">Bug 89095</a> - [SNB/IVB/BYT Bisected]Webglc conformance/glsl/functions/glsl-function-mix-float.html fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89112">Bug 89112</a> - u_atomic_test: u_atomic_test.c:124: test_atomic_8bits_bool: Assertion `r == 65 &amp;&amp; &quot;p_atomic_add&quot;' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89118">Bug 89118</a> - [SKL Bisected]many Ogles3conform cases core dumped</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89131">Bug 89131</a> - [Bisected] Graphical corruption in Weston, shows old framebuffer pieces</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89156">Bug 89156</a> - r300g: GL_COMPRESSED_RED_RGTC1 / ATI1N support broken</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89180">Bug 89180</a> - [IVB regression] Rendering issues in Mass Effect through VMware Workstation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89210">Bug 89210</a> - GS statistics fail on SNB</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89218">Bug 89218</a> - lower_instructions.cpp:648:48: error: invalid suffix 'd' on floating constant</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89224">Bug 89224</a> - Incorrect rendering of Unigine Valley running in VM on VMware Workstation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89260">Bug 89260</a> - macros.h:34:25: fatal error: util/u_math.h: No such file or directory</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89292">Bug 89292</a> - [regression,bisected] incomplete screenshots in some cases</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89311">Bug 89311</a> - [regression, bisected] dEQP: Added entry points for glCompressedTextureSubImage*D.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89312">Bug 89312</a> - [regression, bisected] main: Added entry points for CopyTextureSubImage*D. (d6b7c40cecfe01)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89315">Bug 89315</a> - [HSW, regression, bisected] i965/fs: Emit MAD instructions when possible.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89317">Bug 89317</a> - [HSW, regression, bisected] i965: Add LINTERP/CINTERP to can_do_cmod() (d91390634)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89328">Bug 89328</a> - python required to build Mesa release tarballs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89342">Bug 89342</a> - main/light.c:159:62: error: 'M_PI' undeclared (first use in this function)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89343">Bug 89343</a> - compiler/tests/radeon_compiler_optimize_tests.c:43:3: error: implicit declaration of function fprintf [-Werror=implicit-function-declaration]</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89345">Bug 89345</a> - imports.h:452:58: error: expected declaration specifiers or '...' before 'va_list'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89364">Bug 89364</a> - c99_alloca.h:40:22: fatal error: alloca.h: No such file or directory</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89372">Bug 89372</a> - [softpipe] piglit glsl-1.50 generate-zero-primitives regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89387">Bug 89387</a> - Double delete in lp_bld_misc.cpp</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89416">Bug 89416</a> - UE4Editor crash after load project</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89430">Bug 89430</a> - [g965][bisected] arb_copy_image-targets gl_texture* tests fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89433">Bug 89433</a> - GCC 4.2 does not support -Wvla</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89455">Bug 89455</a> - [NVC0/Gallium] Unigine Heaven black and white boxes</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89457">Bug 89457</a> - [BSW Bisected]ogles3conform ES3-CTS.gtf.GL3Tests.shadow.shadow_execution_vert fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89477">Bug 89477</a> - include/no_extern_c.h:47:1: error: template with C linkage</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89508">Bug 89508</a> - Bad int(floatBitsToInt(vec4))</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89530">Bug 89530</a> - FTBFS in loader: missing fstat</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89569">Bug 89569</a> - Papo &amp; Yo crash on startup [HSW]</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89590">Bug 89590</a> - Crash in glLinkProgram with shaders with multiple constant arrays</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89662">Bug 89662</a> - context.c:943: undefined reference to `_glapi_new_nop_table'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89670">Bug 89670</a> - cmod_propagation_test.andnz_one regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89679">Bug 89679</a> - [NV50] Portal/Half-Life 2 will not start (native Steam)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89689">Bug 89689</a> - [Regression] Weston on DRM backend won't start with new version of mesa</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89722">Bug 89722</a> - [ILK Bisected]Ogles2conform/ES2-CTS.gtf.GL.equal.equal_vec2_frag fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89726">Bug 89726</a> - [Bisected] dEQP-GLES3: uniform linking logic in the presence of structs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89746">Bug 89746</a> - Mesa and LLVM 3.6+ break opengl for genymotion</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89754">Bug 89754</a> - vertexAttrib fails WebGL Conformance test with mesa drivers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89758">Bug 89758</a> - pow WebGL Conformance test with mesa drivers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89759">Bug 89759</a> - WebGL OGL ES GLSL conformance test with mesa drivers fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89831">Bug 89831</a> - [r600] r600_asm.c:310:assign_alu_units: Assertion `0' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89899">Bug 89899</a> - nir/nir_lower_tex_projector.c:112: error: unknown field ssa specified in initializer</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89957">Bug 89957</a> - vm protection faults in piglit lest: texsubimage cube_map_array pbo</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89960">Bug 89960</a> - [softpipe] piglit copy-pixels regreession</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89961">Bug 89961</a> - [BDW/BSW Bisected]Synmark2_v6 OglDrvRes/OglDrvShComp/OglDrvState/OglPSPom Image Validation fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89963">Bug 89963</a> - lp_bld_debug.cpp:100:31: error: no matching function for call to llvm::raw_ostream::raw_ostream()</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90000">Bug 90000</a> - [i965 Bisected NIR] Piglit/gglean_fragprog1-z-write_test fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90109">Bug 90109</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.shaders.uniform_block.random.basic_arrays.3 fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90114">Bug 90114</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.shaders.struct.uniform.sampler_array_fragment fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90130">Bug 90130</a> - gl_PrimitiveId seems to reset at 340</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90147">Bug 90147</a> - swrast: build error undeclared _SC_PHYS_PAGES on osx</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90149">Bug 90149</a> - [SNB+ Bisected]ES3-CTS.gtf.GL3Tests.uniform_buffer_object.uniform_buffer_object_getactiveuniformsiv_for_nonexistent_uniform_indices fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90153">Bug 90153</a> - [SKL Bisected]ES3-CTS.gtf.GL3Tests.uniform_buffer_object.uniform_buffer_object_all_valid_basic_types fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90167">Bug 90167</a> - [softpipe] piglit depthstencil-default_fb-drawpixels-32f_24_8_rev regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90207">Bug 90207</a> - [r600g, bisected] regression: NI/Turks crash on WebGL Water (most WebGL stuff)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90213">Bug 90213</a> - glDrawPixels with GL_COLOR_INDEX never returns.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90243">Bug 90243</a> - [bisected] regression: spec.!opengl 3_2.get-active-attrib-returns-all-inputs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90258">Bug 90258</a> - [IVB] spec.glsl-1_10.execution.fs-dfdy-accuracy fails intermittently</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90310">Bug 90310</a> - Fails to build gallium_dri.so at linking stage with clang because of multiple redefinitions</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90350">Bug 90350</a> - [G96] Portal's portal are incorrectly rendered</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90363">Bug 90363</a> - [nv50] HW state is not reset correctly when using a new GL context</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90397">Bug 90397</a> - ARB_program_interface_query: glGetProgramResourceiv() returns wrong value for GL_REFERENCED_BY_*_SHADER prop for GL_UNIFORM for members of an interface block with an instance name</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90466">Bug 90466</a> - arm: linker error ndefined reference to `nir_metadata_preserve'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90520">Bug 90520</a> - Register spilling clobbers registers used elsewhere in the shader</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90547">Bug 90547</a> - [BDW/BSW/SKL Bisected]Piglit/glean&#64;vertprog1-rsq_test_2_(reciprocal_square_root_of_negative_value) fais</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90580">Bug 90580</a> - [HSW bisected] integer multiplication bug</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90629">Bug 90629</a> - [i965] SIMD16 dual_source_blend assertion `src[i].file != GRF || src[i].width == dst.width' failed</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90749">Bug 90749</a> - [BDW Bisected]dEQP-GLES3.functional.rasterization.fbo.rbo_multisample_max.primitives.lines_wide fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90830">Bug 90830</a> - [bsw bisected regression] GPU hang for spec.arb_gpu_shader5.execution.sampler_array_indexing.vs-nonzero-base</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90839">Bug 90839</a> - [10.5.5/10.6 regression, bisected] PBO glDrawPixels no longer using blit fastpath</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90905">Bug 90905</a> - mesa: Finish subdir-objects transition</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=9951">Bug 9951</a> - GL_LINE_SMOOTH and GL_POLYGON_SMOOTH with i965 driver</li>
</ul>
<h2>Changes</h2>
<ul>
<li>Removed classic Windows software rasterizer.</li>
<li>Removed egl_gallium EGL driver.</li>
<li>Removed gbm_gallium GBM driver.</li>
<li>Removed OpenVG support.</li>
<li>Removed the galahad gallium driver.</li>
<li>Removed the identity gallium driver.</li>
<li>Removed the EGL loader from the Windows SCons build.</li>
<li>Removed the classic osmesa from the Windows SCons build.</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,104 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.1 Release Notes / June 29, 2015</h1>
<p>
Mesa 10.6.1 is a bug fix release which fixes bugs found since the 10.6.0 release.
</p>
<p>
Mesa 10.6.1 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
b4cccd4d0eabcc2bca00c3175d3ad88fdda57ffdb883a7998525b873a21fe607 mesa-10.6.1.tar.gz
6c80a2b647e57c85dc36e609d9aed17f878f0d8e0cf9ace86d14cf604101e1eb mesa-10.6.1.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90347">Bug 90347</a> - [NVE0+] Failure to insert texbar under some circumstances (causing bad colors in Terasology)</li>
</ul>
<h2>Changes</h2>
<p>Anuj Phogat (4):</p>
<ul>
<li>mesa: Handle integer formats in need_rgb_to_luminance_conversion()</li>
<li>mesa: Use helper function need_rgb_to_luminance_conversion()</li>
<li>mesa: Turn need_rgb_to_luminance_conversion() in to a global function</li>
<li>meta: Abort meta path if ReadPixels need rgb to luminance conversion</li>
</ul>
<p>Ben Widawsky (1):</p>
<ul>
<li>i965/gen9: Implement Push Constant Buffer workaround</li>
</ul>
<p>Boyan Ding (2):</p>
<ul>
<li>egl/x11: Set version of swrastLoader to 2</li>
<li>egl/x11: Remove duplicate call to dri2_x11_add_configs_for_visuals</li>
</ul>
<p>Emil Velikov (6):</p>
<ul>
<li>docs: Add sha256sums for the 10.6.0 release</li>
<li>configure: warn about shared_glapi &amp; xlib-glx only when both are set</li>
<li>configure: error out when building backend-less libEGL</li>
<li>configure: error out when building libEGL without shared-glapi</li>
<li>gbm: do not (over)link against libglapi.so</li>
<li>Update version to 10.6.1</li>
</ul>
<p>Frank Henigman (1):</p>
<ul>
<li>gbm: dlopen libglapi so gbm_create_device works</li>
</ul>
<p>Ilia Mirkin (9):</p>
<ul>
<li>nvc0/ir: fix collection of first uses for texture barrier insertion</li>
<li>nv50,nvc0: clamp uniform size to 64k</li>
<li>nvc0/ir: can't have a join on a load with an indirect source</li>
<li>glsl: handle conversions to double when comparing param matches</li>
<li>glsl: add version checks to conditionals for builtin variable enablement</li>
<li>mesa: add GL_PROGRAM_PIPELINE support in KHR_debug calls</li>
<li>glsl: binding point is a texture unit, which is a combined space</li>
<li>nvc0: always put all tfb bufs into bufctx</li>
<li>nv50,nvc0: make sure to pushbuf_refn before putting bo into pushbuf_data</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,165 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.2 Release Notes / July 11, 2015</h1>
<p>
Mesa 10.6.2 is a bug fix release which fixes bugs found since the 10.6.1 release.
</p>
<p>
Mesa 10.6.2 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
9c7ab9300dda6c912faaaff97995ec1820ba21d114d9cf555f145cbad90995f4 mesa-10.6.2.tar.gz
05753d3db4212900927b9894221a1669a10f56786e86a7e818b6e18a0817dca9 mesa-10.6.2.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=73528">Bug 73528</a> - Deferred lighting in Second Life causes system hiccups and screen flickering</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80500">Bug 80500</a> - Flickering shadows in unreleased title trace</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82186">Bug 82186</a> - [r600g] BARTS GPU lockup with minecraft shaders</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84225">Bug 84225</a> - Allow constant-index-expression sampler array indexing with GLSL-ES &lt; 300</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90537">Bug 90537</a> - radeonsi bo/va conflict on RADEON_GEM_VA (rscreen-&gt;ws-&gt;buffer_from_handle returns NULL)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90873">Bug 90873</a> - Kernel hang, TearFree On, Mate desktop environment</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91022">Bug 91022</a> - [g45 g965 bisected] assertions generated from textureGrad cube samplers fix</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91047">Bug 91047</a> - [SNB Bisected] Messed up Fog in Super Smash Bros. Melee in Dolphin</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91056">Bug 91056</a> - The Bard's Tale (2005, native) has rendering issues</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91117">Bug 91117</a> - Nimbus (running in wine) has rendering issues, objects are semi-transparent</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91124">Bug 91124</a> - Civilization V (in Wine) has rendering issues: text missing, menu bar corrupted</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91173">Bug 91173</a> - Oddworld: Stranger's Wrath HD: disfigured models in wrong colors</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91226">Bug 91226</a> - Crash in glLinkProgram (NEW)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91231">Bug 91231</a> - [NV92] Psychonauts (native) segfaults on start when DRI3 enabled</li>
</ul>
<h2>Changes</h2>
<p>Chris Wilson (1):</p>
<ul>
<li>loader: Look for any version of currently linked libudev.so</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: Add sha256 checksums for the 10.6.1 release</li>
<li>Update version to 10.6.2</li>
</ul>
<p>Ilia Mirkin (8):</p>
<ul>
<li>nv50/ir: propagate modifier to right arg when const-folding mad</li>
<li>nv50/ir: fix emission of address reg in 3rd source</li>
<li>nv50/ir: copy joinAt when splitting both before and after</li>
<li>mesa: reset the source packing when creating temp transfer image</li>
<li>nv50/ir: don't emit src2 in immediate form</li>
<li>mesa/prog: relative offsets into constbufs are not constant</li>
<li>nv50/ir: UCMP arguments are float, so make sure modifiers are applied</li>
<li>nvc0: turn sample counts off during blit</li>
</ul>
<p>Kenneth Graunke (5):</p>
<ul>
<li>i965/fs: Fix ir_txs in emit_texture_gen4_simd16().</li>
<li>i965: Reserve more batch space to accomodate Gen6 perfmonitors.</li>
<li>i965/vs: Fix matNxM vertex attributes where M != 4.</li>
<li>Revert "glsl: clone inputs and outputs during linking"</li>
<li>Revert "i965: Delete linked GLSL IR when using NIR."</li>
</ul>
<p>Marek Olšák (3):</p>
<ul>
<li>r600g: disable single-sample fast color clear due to hangs</li>
<li>radeonsi: fix a hang with DrawTransformFeedback on 4 SE chips</li>
<li>st/dri: don't set PIPE_BIND_SCANOUT for MSAA surfaces</li>
</ul>
<p>Mario Kleiner (2):</p>
<ul>
<li>nouveau: Use dup fd as key in drm-winsys hash table to fix ZaphodHeads.</li>
<li>winsys/radeon: Use dup fd as key in drm-winsys hash table to fix ZaphodHeads.</li>
</ul>
<p>Matt Turner (2):</p>
<ul>
<li>i965/fs: Don't mess up stride for uniform integer multiplication.</li>
<li>Revert SHA1 additions.</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>winsys/radeon: Unmap GPU VM address range when destroying BO</li>
</ul>
<p>Mike Stroyan (2):</p>
<ul>
<li>meta: Only change and restore viewport 0 in mesa meta mode</li>
<li>i965: allocate at least 1 BLEND_STATE element</li>
</ul>
<p>Neil Roberts (4):</p>
<ul>
<li>i965/skl: Set the pulls bary bit in 3DSTATE_PS_EXTRA</li>
<li>glsl: Add missing check for whether an expression is an add operation</li>
<li>glsl: Make sure not to dereference NULL</li>
<li>i965: Don't try to print the GLSL IR if it has been freed</li>
</ul>
<p>Tapani Pälli (8):</p>
<ul>
<li>glsl: clone inputs and outputs during linking</li>
<li>i965: Delete linked GLSL IR when using NIR.</li>
<li>glsl: Allow dynamic sampler array indexing with GLSL ES &lt; 3.00</li>
<li>mesa/glsl: new compiler option EmitNoIndirectSampler</li>
<li>i965: use EmitNoIndirectSampler for gen &lt; 7</li>
<li>i915: use EmitNoIndirectSampler</li>
<li>mesa/st: use EmitNoIndirectSampler if !ARB_gpu_shader5</li>
<li>glsl: validate sampler array indexing for 'constant-index-expression'</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,106 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.3 Release Notes / July 26, 2015</h1>
<p>
Mesa 10.6.3 is a bug fix release which fixes bugs found since the 10.6.2 release.
</p>
<p>
Mesa 10.6.3 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
c27e1e33798e69a6d2d2425aee8ac7b4c0b243066a65dd76cbb182ea31b1c7f2 mesa-10.6.3.tar.gz
58592e07c350cd2e8969b73fa83048c657a39fe2f13f3b88f5e5818fe2e4676d mesa-10.6.3.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90728">Bug 90728</a> - dvd playback with vlc and vdpau causes segmentation fault</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91337">Bug 91337</a> - OSMesaGetProcAdress(&quot;OSMesaPixelStore&quot;) returns nil</li>
</ul>
<h2>Changes</h2>
<p>Brian Paul (1):</p>
<ul>
<li>osmesa: fix OSMesaPixelsStore typo</li>
</ul>
<p>Chad Versace (1):</p>
<ul>
<li>mesa: Fix generation of git_sha1.h.tmp for gitlinks</li>
</ul>
<p>Christian König (2):</p>
<ul>
<li>vl: cleanup video buffer private when the decoder is destroyed</li>
<li>st/vdpau: fix mixer size checks</li>
</ul>
<p>Emil Velikov (3):</p>
<ul>
<li>docs: Add sha256 checksums for the 10.6.2 release</li>
<li>auxiliary/vl: use the correct screen index</li>
<li>Update version to 10.6.3</li>
</ul>
<p>Francisco Jerez (1):</p>
<ul>
<li>i965/gen9: Use custom MOCS entries set up by the kernel.</li>
</ul>
<p>Ilia Mirkin (5):</p>
<ul>
<li>nv50, nvc0: enable at least one color RT if alphatest is enabled</li>
<li>nvc0/ir: fix txq on indirect samplers</li>
<li>nvc0/ir: don't worry about sampler in txq handling</li>
<li>gm107/ir: fix indirect txq emission</li>
<li>nv50: fix max level clamping on G80</li>
</ul>
<p>Kenneth Graunke (1):</p>
<ul>
<li>program: Allow redundant OPTION ARB_fog_* directives.</li>
</ul>
<p>Rob Clark (1):</p>
<ul>
<li>xa: don't leak fences</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,137 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.4 Release Notes / August 11, 2015</h1>
<p>
Mesa 10.6.4 is a bug fix release which fixes bugs found since the 10.6.3 release.
</p>
<p>
Mesa 10.6.4 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
4960bf17d8b5d6a6503c6954ec6cf480b5cd930797bac901c60bea192675f85e mesa-10.6.4.tar.gz
8f5ac103f0f503de2f7a985b0df349bd4ecdfe7f51c714be146fa5a9a3c07b77 mesa-10.6.4.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=73512">Bug 73512</a> - [clover] mesa.icd. should contain full path</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91290">Bug 91290</a> - SIGSEGV glcpp/glcpp-parse.y:1077</li>
</ul>
<h2>Changes</h2>
<p>Anuj Phogat (6):</p>
<ul>
<li>mesa: Turn get_readpixels_transfer_ops() in to a global function</li>
<li>meta: Fix transfer operations check in meta pbo path for readpixels</li>
<li>meta: Abort meta pbo path if readpixels need signed-unsigned conversion</li>
<li>meta: Don't do fragment color clamping in _mesa_meta_pbo_GetTexSubImage</li>
<li>mesa: Add a helper function _mesa_need_luminance_to_rgb_conversion()</li>
<li>meta: Fix reading luminance texture as rgba in _mesa_meta_pbo_GetTexSubImage()</li>
</ul>
<p>Ben Widawsky (1):</p>
<ul>
<li>i965/skl: Add production thread counts and URB size</li>
</ul>
<p>Eduardo Lima Mitev (3):</p>
<ul>
<li>mesa: Fix errors values returned by glShaderBinary()</li>
<li>mesa: Validate target before resolving tex obj in glTex(ture)SubImageXD</li>
<li>mesa: Fix error returned by glCopyTexImage2D() upon an invalid internal format</li>
</ul>
<p>Emil Velikov (6):</p>
<ul>
<li>docs: Add checksums for mesa 10.6.3 tarballs</li>
<li>configure.ac: do not set HAVE_DRI(23) when libdrm is missing</li>
<li>egl/wayland: libdrm is a hard requirement, treat it as such</li>
<li>winsys/radeon: don't leak the fd when it is 0</li>
<li>bugzilla_mesa.sh: sort the bugs list by number</li>
<li>Update version to 10.6.4</li>
</ul>
<p>Francisco Jerez (1):</p>
<ul>
<li>i965/fs: Fix fs_inst::regs_read() for sources in the ATTR file.</li>
</ul>
<p>Frank Binns (2):</p>
<ul>
<li>egl/dri: Add error info needed for EGL_EXT_image_dma_buf_import extension</li>
<li>egl: Add eglQuerySurface surface type check for EGL_LARGEST_PBUFFER attrib</li>
</ul>
<p>Igor Gnatenko (1):</p>
<ul>
<li>opencl: use versioned .so in mesa.icd</li>
</ul>
<p>Ilia Mirkin (1):</p>
<ul>
<li>nvc0: fix geometry program revalidation of clipping params</li>
</ul>
<p>Kenneth Graunke (1):</p>
<ul>
<li>glsl: Fix a bug where LHS swizzles of swizzles were too small.</li>
</ul>
<p>Marek Olšák (6):</p>
<ul>
<li>st/mesa: don't call st_validate_state in BlitFramebuffer</li>
<li>radeonsi: upload shader rodata after updating scratch relocations</li>
<li>st/mesa: don't ignore texture buffer state changes</li>
<li>radeonsi: rework how shader pointers to descriptors are set</li>
<li>radeonsi: completely rework updating descriptors without CP DMA</li>
<li>r600g: fix the CB_SHADER_MASK setup</li>
</ul>
<p>Samuel Iglesias Gonsalvez (1):</p>
<ul>
<li>glsl/glcpp: fix SIGSEGV when checking error condition for macro redefinition</li>
</ul>
<p>Samuel Pitoiset (1):</p>
<ul>
<li>nv50: avoid segfault with enabled but unbound vertex attrib</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,124 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.5 Release Notes / August 22, 2015</h1>
<p>
Mesa 10.6.5 is a bug fix release which fixes bugs found since the 10.6.4 release.
</p>
<p>
Mesa 10.6.5 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
afe290fc7af75a25df5ee52396a9f09e5dba85fb3e159304bdda265b8564b0d4 mesa-10.6.5.tar.gz
fb6fac3c85bcfa9d06b8dd439169f23f0c0924a88e44362e738b99b1feff762f mesa-10.6.5.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85252">Bug 85252</a> - Segfault in compiler while processing ternary operator with void arguments</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91570">Bug 91570</a> - Upgrading mesa to 10.6 causes segfault in OpenGL applications with GeForce4 MX 440 / AGP 8X</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91610">Bug 91610</a> - [BSW] GPU hang for spec.shaders.point-vertex-id gl_instanceid divisor</li>
</ul>
<h2>Changes</h2>
<p>Adam Jackson (1):</p>
<ul>
<li>glx: Fix __glXWireToEvent for BufferSwapComplete</li>
</ul>
<p>Alex Deucher (2):</p>
<ul>
<li>radeonsi: add new OLAND pci id</li>
<li>radeonsi: properly set the raster_config for KV</li>
</ul>
<p>Emil Velikov (4):</p>
<ul>
<li>docs: add sha256 checksums for 10.6.4</li>
<li>vc4: add missing nir include, to fix the build</li>
<li>Revert "radeonsi: properly set the raster_config for KV"</li>
<li>Update version to 10.6.5</li>
</ul>
<p>Frank Binns (1):</p>
<ul>
<li>egl/x11: don't abort when creating a DRI2 drawable fails</li>
</ul>
<p>Ilia Mirkin (3):</p>
<ul>
<li>nouveau: no need to do tnl wakeup, state updates are always hooked up</li>
<li>gm107/ir: indirect handle goes first on maxwell also</li>
<li>nv50,nvc0: take level into account when doing eng2d multi-layer blits</li>
</ul>
<p>Jason Ekstrand (4):</p>
<ul>
<li>meta/copy_image: Stash off the scissor</li>
<li>mesa/formats: Only do byteswapping for packed formats</li>
<li>mesa/formats: Fix swizzle flipping for big-endian targets</li>
<li>mesa/formats: Don't flip channels of null array formats</li>
</ul>
<p>Marek Olšák (3):</p>
<ul>
<li>radeonsi: fix polygon offset scale</li>
<li>r600g: fix polygon offset scale</li>
<li>r600g: allow setting geometry shader sampler states</li>
</ul>
<p>Neil Roberts (1):</p>
<ul>
<li>i965/bdw: Fix setting the instancing state for the SGVS element</li>
</ul>
<p>Oded Gabbay (2):</p>
<ul>
<li>mesa: clear existing swizzle info before bitwise-OR</li>
<li>mesa/formats: don't byteswap when building array formats</li>
</ul>
<p>Renaud Gaubert (1):</p>
<ul>
<li>glsl: avoid compiler's segfault when processing operators with void arguments</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,164 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.6 Release Notes / September 04, 2015</h1>
<p>
Mesa 10.6.6 is a bug fix release which fixes bugs found since the 10.6.5 release.
</p>
<p>
Mesa 10.6.6 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
416517aa9df4791f97d34451a9e4da33c966afcd18c115c5769b92b15b018ef5 mesa-10.6.6.tar.gz
570f2154b7340ff5db61ff103bc6e85165b8958798b78a50fa2df488e98e5778 mesa-10.6.6.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84677">Bug 84677</a> - Triangle disappears with glPolygonMode GL_LINE</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90734">Bug 90734</a> - glBufferSubData is corrupting data when buffer is &gt; 32k</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90748">Bug 90748</a> - [BDW Bisected]dEQP-GLES3.functional.fbo.completeness.renderable.texture.depth.rg_half_float_oes fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90902">Bug 90902</a> - [bsw][regression] dEQP: &quot;Found invalid pixel values&quot;</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90925">Bug 90925</a> - &quot;high fidelity&quot;: Segfault in _mesa_program_resource_find_name</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91254">Bug 91254</a> - (regresion) video using VA-API on Intel slow and freeze system with mesa 10.6 or 10.6.1</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91292">Bug 91292</a> - [BDW+] glVertexAttribDivisor not working in combination with glPolygonMode</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91673">Bug 91673</a> - Segfault when calling glTexSubImage2D on storage texture to bound FBO</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91726">Bug 91726</a> - R600 asserts in tgsi_cmp/make_src_for_op3</li>
</ul>
<h2>Changes</h2>
<p>Chris Wilson (2):</p>
<ul>
<li>i965: Prevent coordinate overflow in intel_emit_linear_blit</li>
<li>i965: Always re-emit the pipeline select during invariant state emission</li>
</ul>
<p>Daniel Scharrer (1):</p>
<ul>
<li>mesa: add missing queries for ARB_direct_state_access</li>
</ul>
<p>Dave Airlie (8):</p>
<ul>
<li>mesa/arb_gpu_shader_fp64: add support for glGetUniformdv</li>
<li>mesa/texgetimage: fix missing stencil check</li>
<li>st/readpixels: fix accel path for skipimages.</li>
<li>texcompress_s3tc/fxt1: fix stride checks (v1.1)</li>
<li>mesa/readpixels: check strides are equal before skipping conversion</li>
<li>mesa: enable texture stencil8 for multisample</li>
<li>r600/sb: update last_cf for finalize if.</li>
<li>r600g: fix calculation for gpr allocation</li>
</ul>
<p>David Heidelberg (1):</p>
<ul>
<li>st/nine: Require gcc &gt;= 4.6</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: add sha256 checksums for 10.6.5</li>
<li>get-pick-list.sh: Require explicit "10.6" for nominating stable patches</li>
</ul>
<p>Glenn Kennard (4):</p>
<ul>
<li>r600g: Fix assert in tgsi_cmp</li>
<li>r600g/sb: Handle undef in read port tracker</li>
<li>r600g/sb: Don't read junk after EOP</li>
<li>r600g/sb: Don't crash on empty if jump target</li>
</ul>
<p>Ilia Mirkin (5):</p>
<ul>
<li>st/mesa: fix assignments with 4-operand arguments (i.e. BFI)</li>
<li>st/mesa: pass through 4th opcode argument in bitmap/pixel visitors</li>
<li>nv50,nvc0: disable depth bounds test on blit</li>
<li>nv50: fix 2d engine blits for 64- and 128-bit formats</li>
<li>mesa: only copy the requested teximage faces</li>
</ul>
<p>Jason Ekstrand (1):</p>
<ul>
<li>i965/fs: Split VGRFs after lowering pull constants</li>
</ul>
<p>Kenneth Graunke (3):</p>
<ul>
<li>i965: Fix copy propagation type changes.</li>
<li>Revert "i965: Advertise a line width of 40.0 on Cherryview and Skylake."</li>
<li>i965: Momentarily pretend to support ARB_texture_stencil8 for blits.</li>
</ul>
<p>Marek Olšák (3):</p>
<ul>
<li>gallium/radeon: fix the ADDRESS_HI mask for EVENT_WRITE CIK packets</li>
<li>mesa: create multisample fallback textures like normal textures</li>
<li>radeonsi: fix a Unigine Heaven hang when drirc is missing</li>
</ul>
<p>Matt Turner (1):</p>
<ul>
<li>i965/fs: Handle MRF destinations in lower_integer_multiplication().</li>
</ul>
<p>Neil Roberts (2):</p>
<ul>
<li>i965: Swap the order of the vertex ID and edge flag attributes</li>
<li>i965/bdw: Fix 3DSTATE_VF_INSTANCING when the edge flag is used</li>
</ul>
<p>Tapani Pälli (5):</p>
<ul>
<li>mesa: update fbo state in glTexStorage</li>
<li>glsl: build stageref mask using IR, not symbol table</li>
<li>glsl: expose build_program_resource_list function</li>
<li>glsl: create program resource list after LinkShader</li>
<li>mesa: add GL_RED, GL_RG support for floating point textures</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,75 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.7 Release Notes / September 10, 2015</h1>
<p>
Mesa 10.6.7 is a bug fix release which fixes bugs found since the 10.6.6 release.
</p>
<p>
Mesa 10.6.7 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
4ba10c59abee30d72476543a57afd2f33803dabf4620dc333b335d47966ff842 mesa-10.6.7.tar.gz
feb1f640b915dada88a7c793dfaff0ae23580f8903f87a6b76469253de0d28d8 mesa-10.6.7.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90751">Bug 90751</a> - [BDW Bisected]dEQP-GLES3.functional.fbo.completeness.renderable.texture.stencil.stencil_index8 fails</li>
</ul>
<h2>Changes</h2>
<p>Dave Airlie (1):</p>
<ul>
<li>mesa/teximage: use correct extension for accept stencil texture.</li>
</ul>
<p>Emil Velikov (3):</p>
<ul>
<li>docs: add sha256 checksums for 10.6.6</li>
<li>Revert "i965: Momentarily pretend to support ARB_texture_stencil8 for blits."</li>
<li>Update version to 10.6.7</li>
</ul>
<p>Kenneth Graunke (1):</p>
<ul>
<li>glsl: Handle attribute aliasing in attribute storage limit check.</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,136 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.8 Release Notes / September 20, 2015</h1>
<p>
Mesa 10.6.8 is a bug fix release which fixes bugs found since the 10.6.7 release.
</p>
<p>
Mesa 10.6.8 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
1f34dba2a8059782e3e4e0f18b9628004e253b2c69085f735b846d2e63c9e250 mesa-10.6.8.tar.gz
e36ee5ceeadb3966fb5ce5b4cf18322dbb76a4f075558ae49c3bba94f57d58fd mesa-10.6.8.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90621">Bug 90621</a> - Mesa fail to build from git</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91526">Bug 91526</a> - World of Warcraft (on Wine) has UI corruption with nouveau</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91719">Bug 91719</a> - [SNB,HSW,BYT] dEQP regressions associated with using NIR for vertex shaders</li>
</ul>
<h2>Changes</h2>
<p>Alejandro Piñeiro (1):</p>
<ul>
<li>i965/vec4: fill src_reg type using the constructor type parameter</li>
</ul>
<p>Antia Puentes (1):</p>
<ul>
<li>i965/vec4: Fix saturation errors when coalescing registers</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: add sha256 checksums for 10.6.7</li>
<li>cherry-ignore: add commit non applicable for 10.6</li>
</ul>
<p>Hans de Goede (4):</p>
<ul>
<li>nv30: Fix creation of scanout buffers</li>
<li>nv30: Implement color resolve for msaa</li>
<li>nv30: Fix max width / height checks in nv30 sifm code</li>
<li>nv30: Disable msaa unless requested from the env by NV30_MAX_MSAA</li>
</ul>
<p>Ian Romanick (2):</p>
<ul>
<li>mesa: Pass the type to _mesa_uniform_matrix as a glsl_base_type</li>
<li>mesa: Don't allow wrong type setters for matrix uniforms</li>
</ul>
<p>Ilia Mirkin (5):</p>
<ul>
<li>st/mesa: don't fall back to 16F when 32F is requested</li>
<li>nvc0: always emit a full shader colormask</li>
<li>nvc0: remove BGRA4 format support</li>
<li>st/mesa: avoid integer overflows with buffers &gt;= 512MB</li>
<li>nv50, nvc0: fix max texture buffer size to 128M elements</li>
</ul>
<p>Jason Ekstrand (1):</p>
<ul>
<li>i965/vec4: Don't reswizzle hardware registers</li>
</ul>
<p>Jose Fonseca (1):</p>
<ul>
<li>gallivm: Workaround LLVM PR23628.</li>
</ul>
<p>Kenneth Graunke (1):</p>
<ul>
<li>i965: Momentarily pretend to support ARB_texture_stencil8 for blits.</li>
</ul>
<p>Oded Gabbay (1):</p>
<ul>
<li>llvmpipe: convert double to long long instead of unsigned long long</li>
</ul>
<p>Ray Strode (1):</p>
<ul>
<li>gbm: convert gbm bo format to fourcc format on dma-buf import</li>
</ul>
<p>Ulrich Weigand (1):</p>
<ul>
<li>mesa: Fix texture compression on big-endian systems</li>
</ul>
<p>Vinson Lee (1):</p>
<ul>
<li>gallivm: Do not use NoFramePointerElim with LLVM 3.7.</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,130 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 10.6.9 Release Notes / Octover 03, 2015</h1>
<p>
Mesa 10.6.9 is a bug fix release which fixes bugs found since the 10.6.8 release.
</p>
<p>
Mesa 10.6.9 implements the OpenGL 3.3 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 3.3. OpenGL
3.3 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
3406876aac67546d0c3e2cb97da330b62644c313e7992b95618662e13c54296a mesa-10.6.9.tar.gz
b04c4de6280b863babc2929573da17218d92e9e4ba6272d548d135415723e8c3 mesa-10.6.9.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=38109">Bug 38109</a> - i915 driver crashes if too few vertices are submitted (Mesa 7.10.2)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=55552">Bug 55552</a> - Compile errors with --enable-mangling</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86281">Bug 86281</a> - brw_meta_fast_clear (brw=brw&#64;entry=0x7fffd4097a08, fb=fb&#64;entry=0x7fffd40fa900, buffers=buffers&#64;entry=2, partial_clear=partial_clear&#64;entry=false)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91970">Bug 91970</a> - [BSW regression] dEQP-GLES3.functional.shaders.precision.int.highp_mul_vertex</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92072">Bug 92072</a> - Wine breakage since d082c5324 (st/mesa: don't call st_validate_state in BlitFramebuffer)</li>
</ul>
<h2>Changes</h2>
<p>Brian Paul (1):</p>
<ul>
<li>st/mesa: try PIPE_BIND_RENDER_TARGET when choosing float texture formats</li>
</ul>
<p>Chris Wilson (1):</p>
<ul>
<li>i965: Remove early release of DRI2 miptree</li>
</ul>
<p>Emil Velikov (4):</p>
<ul>
<li>docs: add sha256 checksums for 10.6.8</li>
<li>cherry-ignore: add commit non applicable for 10.6</li>
<li>cherry-ignore: add commit non applicable for 10.6</li>
<li>Update version to 10.6.9</li>
</ul>
<p>Iago Toral Quiroga (1):</p>
<ul>
<li>mesa: Fix GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE for default framebuffer.</li>
</ul>
<p>Ian Romanick (5):</p>
<ul>
<li>t_dd_dmatmp: Make "count" actually be the count</li>
<li>t_dd_dmatmp: Clean up improper code formatting from previous patch</li>
<li>t_dd_dmatmp: Use '&amp; 3' instead of '% 4' everywhere</li>
<li>t_dd_dmatmp: Pull out common 'count -= count &amp; 3' code</li>
<li>t_dd_dmatmp: Use addition instead of subtraction in loop bounds</li>
</ul>
<p>Jeremy Huddleston (1):</p>
<ul>
<li>configure.ac: Add support to enable read-only text segment on x86.</li>
</ul>
<p>Kristian Høgsberg Kristensen (1):</p>
<ul>
<li>i965: Respect stride and subreg_offset for ATTR registers</li>
</ul>
<p>Kyle Brenneman (3):</p>
<ul>
<li>glx: Fix build errors with --enable-mangling (v2)</li>
<li>mapi: Make _glapi_get_stub work with "gl" or "mgl" prefix.</li>
<li>glx: Don't hard-code the name "libGL.so.1" in driOpenDriver (v3)</li>
</ul>
<p>Leo Liu (1):</p>
<ul>
<li>radeon/vce: fix vui time_scale zero error</li>
</ul>
<p>Marek Olšák (1):</p>
<ul>
<li>st/mesa: fix front buffer regression after dropping st_validate_state in Blit</li>
</ul>
<p>Roland Scheidegger (1):</p>
<ul>
<li>mesa: fix mipmap generation for immutable, compressed textures</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,259 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 11.0.0 Release Notes / September 12, 2015</h1>
<p>
Mesa 11.0.0 is a new development release.
People who are concerned with stability and reliability should stick
with a previous release or wait for Mesa 11.0.1.
</p>
<p>
Mesa 11.0.0 implements the OpenGL 4.1 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 4.1. OpenGL
4.1 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
7d7e4ddffa3b162506efa01e2cc41e329caa4995336b92e5cc21f2e1fb36c1b3 mesa-11.0.0.tar.gz
e095a3eb2eca9dfde7efca8946527c8ae20a0cc938a8c78debc7f158ad44af32 mesa-11.0.0.tar.xz
</pre>
<h2>New features</h2>
<p>
Note: some of the new features are only available with certain drivers.
</p>
<ul>
<li>New hardware support for AMD GCN 1.2 GPUs: Tonga, Iceland, Carrizo, Fiji</li>
<li>OpenGL 4.1 on radeonsi, nvc0</li>
<li>OpenGL ES 3.0 on freedreno (a3xx, a4xx)
<li>GL_AMD_vertex_shader_viewport_index on radeonsi</li>
<li>GL_ARB_conditional_render_inverted on r600, radeonsi</li>
<li>GL_ARB_depth_buffer_float on a4xx</li>
<li>GL_ARB_derivative_control on radeonsi</li>
<li>GL_ARB_draw_buffers, GL_ARB_draw_buffers_blend on a4xx</li>
<li>GL_ARB_fragment_layer_viewport on radeonsi</li>
<li>GL_ARB_framebuffer_no_attachments on i965</li>
<li>GL_ARB_get_texture_sub_image for all drivers</li>
<li>GL_ARB_gpu_shader5 on radeonsi</li>
<li>GL_ARB_gpu_shader_fp64 on llvmpipe, radeonsi</li>
<li>GL_ARB_shader_image_load_store on i965</li>
<li>GL_ARB_shader_precision on radeonsi, nvc0</li>
<li>GL_ARB_shader_image_size on i965</li>
<li>GL_ARB_shader_stencil_export on llvmpipe</li>
<li>GL_ARB_shader_subroutine on core profile all drivers</li>
<li>GL_ARB_tessellation_shader on nvc0, radeonsi</li>
<li>GL_ARB_transform_feedback2, GL_ARB_transform_feedback_instanced, GL_EXT_transform_feedback on a3xx, a4xx</li>
<li>GL_ARB_vertex_attrib_64bit on llvmpipe, radeonsi</li>
<li>GL_ARB_viewport_array on radeonsi</li>
<li>GL_EXT_depth_bounds_test on radeonsi, nv30, nv50, nvc0</li>
<li>GL_EXT_texture_compression_s3tc on freedreno (a3xx)</li>
<li>GL_NV_read_depth (GLES) on all drivers</li>
<li>GL_NV_read_depth_stencil (GLES) on all drivers</li>
<li>GL_NV_read_stencil (GLES) on all drivers</li>
<li>GL_OES_texture_float on all r300, r600, radeonsi, nv30, nv50, nvc0, softpipe, llvmpipe</li>
<li>GL_OES_texture_half_float on all r300, r600, radeonsi, nv30, nv50, nvc0, softpipe, llvmpipe</li>
<li>GL_OES_texture_float_linear on all r300, r600, radeonsi, nv30, nv50, nvc0, softpipe, llvmpipe</li>
<li>GL_OES_texture_half_float_linear on all r300, r600, radeonsi, nv30, nv50, nvc0, softpipe, llvmpipe</li>
<li>GL_EXT_draw_buffers2 on a4xx</li>
<li>GLX_ARB_create_context_robustness on r600, radeonsi</li>
<li>EGL_EXT_create_context_robustness on r600, radeonsi</li>
<li>EGL_KHR_gl_colorspace on r600, radeonsi, nv50, nvc0</li>
<li>EGL_KHR_gl_texture_3D_image on r600, radeonsi, nv50, nvc0</li>
<li>EGL 1.5 on r600, radeonsi, nv50, nvc0</li>
</ul>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=51658">Bug 51658</a> - r200 (&amp; possibly radeon) DRI fixes for gnome shell on Mesa 8.0.3</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=65525">Bug 65525</a> - [llvmpipe] lp_scene.h:210:lp_scene_alloc: Assertion `size &lt;= (64 * 1024)' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=66346">Bug 66346</a> - shader_query.cpp:49: error: invalid conversion from 'void*' to 'GLuint'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=73512">Bug 73512</a> - [clover] mesa.icd. should contain full path</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=73528">Bug 73528</a> - Deferred lighting in Second Life causes system hiccups and screen flickering</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=74329">Bug 74329</a> - Please expose OES_texture_float and OES_texture_half_float on the ES3 context</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80500">Bug 80500</a> - Flickering shadows in unreleased title trace</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82186">Bug 82186</a> - [r600g] BARTS GPU lockup with minecraft shaders</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84225">Bug 84225</a> - Allow constant-index-expression sampler array indexing with GLSL-ES &lt; 300</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84677">Bug 84677</a> - Triangle disappears with glPolygonMode GL_LINE</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85252">Bug 85252</a> - Segfault in compiler while processing ternary operator with void arguments</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89131">Bug 89131</a> - [Bisected] Graphical corruption in Weston, shows old framebuffer pieces</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90000">Bug 90000</a> - [i965 Bisected NIR] Piglit/gglean_fragprog1-z-write_test fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90073">Bug 90073</a> - Leaks in xcb_dri3_open_reply_fds() and get_render_node_from_id_path_tag</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90249">Bug 90249</a> - Fails to build egl_dri2 on osx</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90310">Bug 90310</a> - Fails to build gallium_dri.so at linking stage with clang because of multiple redefinitions</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90347">Bug 90347</a> - [NVE0+] Failure to insert texbar under some circumstances (causing bad colors in Terasology)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90466">Bug 90466</a> - arm: linker error ndefined reference to `nir_metadata_preserve'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90520">Bug 90520</a> - Register spilling clobbers registers used elsewhere in the shader</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90537">Bug 90537</a> - radeonsi bo/va conflict on RADEON_GEM_VA (rscreen-&gt;ws-&gt;buffer_from_handle returns NULL)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90547">Bug 90547</a> - [BDW/BSW/SKL Bisected]Piglit/glean&#64;vertprog1-rsq_test_2_(reciprocal_square_root_of_negative_value) fais</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90580">Bug 90580</a> - [HSW bisected] integer multiplication bug</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90600">Bug 90600</a> - IOError: [Errno 2] No such file or directory: 'gl_API.xml'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90621">Bug 90621</a> - Mesa fail to build from git</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90629">Bug 90629</a> - [i965] SIMD16 dual_source_blend assertion `src[i].file != GRF || src[i].width == dst.width' failed</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90691">Bug 90691</a> - [BSW]Piglit/spec/nv_conditional_render/dlist fails intermittently</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90728">Bug 90728</a> - dvd playback with vlc and vdpau causes segmentation fault</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90734">Bug 90734</a> - glBufferSubData is corrupting data when buffer is &gt; 32k</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90748">Bug 90748</a> - [BDW Bisected]dEQP-GLES3.functional.fbo.completeness.renderable.texture.depth.rg_half_float_oes fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90749">Bug 90749</a> - [BDW Bisected]dEQP-GLES3.functional.rasterization.fbo.rbo_multisample_max.primitives.lines_wide fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90751">Bug 90751</a> - [BDW Bisected]dEQP-GLES3.functional.fbo.completeness.renderable.texture.stencil.stencil_index8 fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90797">Bug 90797</a> - [ALL bisected] Mesa change cause performance case manhattan fail.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90817">Bug 90817</a> - swrast fails to load with certain remote X servers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90830">Bug 90830</a> - [bsw bisected regression] GPU hang for spec.arb_gpu_shader5.execution.sampler_array_indexing.vs-nonzero-base</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90839">Bug 90839</a> - [10.5.5/10.6 regression, bisected] PBO glDrawPixels no longer using blit fastpath</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90873">Bug 90873</a> - Kernel hang, TearFree On, Mate desktop environment</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90887">Bug 90887</a> - PhiMovesPass in register allocator broken</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90895">Bug 90895</a> - [IVB/HSW/BDW/BSW Bisected] GLB2.7 Egypt, GfxBench3.0 T-Rex &amp; ALU and many SynMark cases performance reduced by 10-23%</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90902">Bug 90902</a> - [bsw][regression] dEQP: &quot;Found invalid pixel values&quot;</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90903">Bug 90903</a> - egl_dri2.c:dri2_load fails to load libglapi on osx</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90904">Bug 90904</a> - OSX: EXC_BAD_ACCESS when using translate_sse + gallium + softpipe/llvmpipe</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90905">Bug 90905</a> - mesa: Finish subdir-objects transition</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90925">Bug 90925</a> - &quot;high fidelity&quot;: Segfault in _mesa_program_resource_find_name</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91022">Bug 91022</a> - [g45 g965 bisected] assertions generated from textureGrad cube samplers fix</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91047">Bug 91047</a> - [SNB Bisected] Messed up Fog in Super Smash Bros. Melee in Dolphin</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91056">Bug 91056</a> - The Bard's Tale (2005, native) has rendering issues</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91077">Bug 91077</a> - dri2_glx.c:1186: undefined reference to `loader_open_device'</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91099">Bug 91099</a> - [llvmpipe] piglit glsl-max-varyings &gt;max_varying_components regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91101">Bug 91101</a> - [softpipe] piglit glsl-1.50&#64;execution&#64;geometry&#64;max-input-components regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91117">Bug 91117</a> - Nimbus (running in wine) has rendering issues, objects are semi-transparent</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91124">Bug 91124</a> - Civilization V (in Wine) has rendering issues: text missing, menu bar corrupted</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91173">Bug 91173</a> - Oddworld: Stranger's Wrath HD: disfigured models in wrong colors</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91193">Bug 91193</a> - [290x] Dota2 reborn ingame rendering breaks with git-af4b9c7</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91222">Bug 91222</a> - lp_test_format regression on CentOS 7</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91226">Bug 91226</a> - Crash in glLinkProgram (NEW)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91231">Bug 91231</a> - [NV92] Psychonauts (native) segfaults on start when DRI3 enabled</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91254">Bug 91254</a> - (regresion) video using VA-API on Intel slow and freeze system with mesa 10.6 or 10.6.1</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91290">Bug 91290</a> - SIGSEGV glcpp/glcpp-parse.y:1077</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91292">Bug 91292</a> - [BDW+] glVertexAttribDivisor not working in combination with glPolygonMode</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91337">Bug 91337</a> - OSMesaGetProcAdress(&quot;OSMesaPixelStore&quot;) returns nil</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91418">Bug 91418</a> - Visual Studio 2015 vsnprintf build error</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91425">Bug 91425</a> - [regression, bisected] Piglit spec/ext_packed_float/ getteximage-invalid-format-for-packed-type fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91441">Bug 91441</a> - make check DispatchSanity_test.GL30 regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91444">Bug 91444</a> - regression bisected radeonsi: don't change pipe_resource in resource_copy_region</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91461">Bug 91461</a> - gl_TessLevel* writes have no effect for all but the last TCS invocation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91513">Bug 91513</a> - [IVB/HSW/BDW/SKL Bisected] Lightsmark performance reduced by 7%-10%</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91526">Bug 91526</a> - World of Warcraft (on Wine) has UI corruption with nouveau</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91544">Bug 91544</a> - [i965, regression, bisected] regression of several tests in 93977d3a151675946c03e</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91551">Bug 91551</a> - DXTn compressed normal maps produce severe artifacts on all NV5x and NVDx chipsets</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91570">Bug 91570</a> - Upgrading mesa to 10.6 causes segfault in OpenGL applications with GeForce4 MX 440 / AGP 8X</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91591">Bug 91591</a> - rounding.h:102:2: error: #error &quot;Unsupported or undefined LONG_BIT&quot;</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91610">Bug 91610</a> - [BSW] GPU hang for spec.shaders.point-vertex-id gl_instanceid divisor</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91673">Bug 91673</a> - Segfault when calling glTexSubImage2D on storage texture to bound FBO</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91726">Bug 91726</a> - R600 asserts in tgsi_cmp/make_src_for_op3</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91847">Bug 91847</a> - glGenerateTextureMipmap not working (no errors) unless glActiveTexture(GL_TEXTURE1) is called before</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91857">Bug 91857</a> - Mesa 10.6.3 linker is slow</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91881">Bug 91881</a> - regression: GPU lockups since mesa-11.0.0_rc1 on RV620 (r600) driver</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91890">Bug 91890</a> - [nve7] witcher2: blurry image &amp; DATA_ERRORs (class 0xa097 mthd 0x2380/0x238c)</li>
</ul>
<h2>Changes</h2>
<li>Removed the EGL loader from the Linux SCons build.</li>
</div>
</body>
</html>

View File

@@ -1,134 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 11.0.1 Release Notes / September 26, 2015</h1>
<p>
Mesa 11.0.1 is a bug fix release which fixes bugs found since the 11.0.0 release.
</p>
<p>
Mesa 11.0.1 implements the OpenGL 4.1 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 4.1. OpenGL
4.1 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
6dab262877e12c0546a0e2970c6835a0f217e6d4026ccecb3cd5dd733d1ce867 mesa-11.0.1.tar.gz
43d0dfcd1f1e36f07f8228cd76d90175d3fc74c1ed25d7071794a100a98ef2a6 mesa-11.0.1.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=38109">Bug 38109</a> - i915 driver crashes if too few vertices are submitted (Mesa 7.10.2)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91114">Bug 91114</a> - ES3-CTS.gtf.GL3Tests.shadow.shadow_execution_vert fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91716">Bug 91716</a> - [bisected] piglit.shaders.glsl-vs-int-attrib regresses on 32 bit BYT, HSW, IVB, SNB</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91719">Bug 91719</a> - [SNB,HSW,BYT] dEQP regressions associated with using NIR for vertex shaders</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92009">Bug 92009</a> - ES3-CTS.gtf.GL3Tests.packed_pixels.packed_pixels fails</li>
</ul>
<h2>Changes</h2>
<p>Antia Puentes (2):</p>
<ul>
<li>i965/vec4: Fix saturation errors when coalescing registers</li>
<li>i965/vec4_nir: Load constants as integers</li>
</ul>
<p>Anuj Phogat (1):</p>
<ul>
<li>meta: Abort meta pbo path if TexSubImage need signed unsigned conversion</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: add sha256 checksums for 11.0.0</li>
<li>Update version to 11.0.1</li>
</ul>
<p>Iago Toral Quiroga (1):</p>
<ul>
<li>mesa: Fix GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE for default framebuffer.</li>
</ul>
<p>Ian Romanick (5):</p>
<ul>
<li>t_dd_dmatmp: Make "count" actually be the count</li>
<li>t_dd_dmatmp: Clean up improper code formatting from previous patch</li>
<li>t_dd_dmatmp: Use '&amp; 3' instead of '% 4' everywhere</li>
<li>t_dd_dmatmp: Pull out common 'count -= count &amp; 3' code</li>
<li>t_dd_dmatmp: Use addition instead of subtraction in loop bounds</li>
</ul>
<p>Ilia Mirkin (6):</p>
<ul>
<li>st/mesa: avoid integer overflows with buffers &gt;= 512MB</li>
<li>nv50, nvc0: fix max texture buffer size to 128M elements</li>
<li>freedreno/a3xx: fix blending of L8 format</li>
<li>nv50,nvc0: detect underlying resource changes and update tic</li>
<li>nv50,nvc0: flush texture cache in presence of coherent bufs</li>
<li>radeonsi: load fmask ptr relative to the resources array</li>
</ul>
<p>Jason Ekstrand (2):</p>
<ul>
<li>nir: Fix a bunch of ralloc parenting errors</li>
<li>i965/vec4: Don't reswizzle hardware registers</li>
</ul>
<p>Jeremy Huddleston (1):</p>
<ul>
<li>configure.ac: Add support to enable read-only text segment on x86.</li>
</ul>
<p>Ray Strode (1):</p>
<ul>
<li>gbm: convert gbm bo format to fourcc format on dma-buf import</li>
</ul>
<p>Tapani Pälli (2):</p>
<ul>
<li>mesa: fix errors when reading depth with glReadPixels</li>
<li>i965: fix textureGrad for cubemaps</li>
</ul>
<p>Ulrich Weigand (1):</p>
<ul>
<li>mesa: Fix texture compression on big-endian systems</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,85 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 11.0.2 Release Notes / September 28, 2015</h1>
<p>
Mesa 11.0.2 is a bug fix release which fixes bugs found since the 11.0.1 release.
</p>
<p>
Mesa 11.0.2 implements the OpenGL 4.1 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 4.1. OpenGL
4.1 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
45170773500d6ae2f9eb93fc85efee69f7c97084411ada4eddf92f78bca56d20 mesa-11.0.2.tar.gz
fce11fb27eb87adf1e620a76455d635c6136dfa49ae58c53b34ef8d0c7b7eae4 mesa-11.0.2.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91582">Bug 91582</a> - [bisected] Regression in DEQP gles2.functional.negative_api.texture.texsubimage2d_neg_offset</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91970">Bug 91970</a> - [BSW regression] dEQP-GLES3.functional.shaders.precision.int.highp_mul_vertex</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92095">Bug 92095</a> - [Regression, bisected] arb_shader_atomic_counters.compiler.builtins.frag</li>
</ul>
<h2>Changes</h2>
<p>Eduardo Lima Mitev (3):</p>
<ul>
<li>mesa: Fix order of format+type and internal format checks for glTexImageXD ops</li>
<li>mesa: Move _mesa_base_tex_format() from teximage to glformats files</li>
<li>mesa: Use the effective internal format instead for validation</li>
</ul>
<p>Emil Velikov (2):</p>
<ul>
<li>docs: add sha256 checksums for 11.0.1</li>
<li>Update version to 11.0.2</li>
</ul>
<p>Kristian Høgsberg Kristensen (1):</p>
<ul>
<li>i965: Respect stride and subreg_offset for ATTR registers</li>
</ul>
<p>Matt Turner (1):</p>
<ul>
<li>glsl: Expose gl_MaxTess{Control,Evaluation}AtomicCounters.</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,185 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 11.0.3 Release Notes / October 10, 2015</h1>
<p>
Mesa 11.0.3 is a bug fix release which fixes bugs found since the 11.0.2 release.
</p>
<p>
Mesa 11.0.3 implements the OpenGL 4.1 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 4.1. OpenGL
4.1 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
c2210e3daecc10ed9fdcea500327652ed6effc2f47c4b9cee63fb08f560d7117 mesa-11.0.3.tar.gz
ab2992eece21adc23c398720ef8c6933cb69ea42e1b2611dc09d031e17e033d6 mesa-11.0.3.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=55552">Bug 55552</a> - Compile errors with --enable-mangling</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=71789">Bug 71789</a> - [r300g] Visuals not found in (default) depth = 24</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91044">Bug 91044</a> - piglit spec/egl_khr_create_context/valid debug flag gles* fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91342">Bug 91342</a> - Very dark textures on some objects in indoors environments in Postal 2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91596">Bug 91596</a> - EGL_KHR_gl_colorspace (v2) causes problem with Android-x86 GUI</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91718">Bug 91718</a> - piglit.spec.arb_shader_image_load_store.invalid causes intermittent GPU HANG</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92072">Bug 92072</a> - Wine breakage since d082c5324 (st/mesa: don't call st_validate_state in BlitFramebuffer)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92265">Bug 92265</a> - Black windows in weston after update mesa to 11.0.2-1</li>
</ul>
<h2>Changes</h2>
<p>Brian Paul (1):</p>
<ul>
<li>st/mesa: try PIPE_BIND_RENDER_TARGET when choosing float texture formats</li>
</ul>
<p>Daniel Scharrer (1):</p>
<ul>
<li>mesa: Add abs input modifier to base for POW in ffvertex_prog</li>
</ul>
<p>Emil Velikov (3):</p>
<ul>
<li>docs: add sha256 checksums for 11.0.2</li>
<li>Revert "nouveau: make sure there's always room to emit a fence"</li>
<li>Update version to 11.0.3</li>
</ul>
<p>Francisco Jerez (1):</p>
<ul>
<li>i965/fs: Fix hang on IVB and VLV with image format mismatch.</li>
</ul>
<p>Ian Romanick (1):</p>
<ul>
<li>meta: Handle array textures in scaled MSAA blits</li>
</ul>
<p>Ilia Mirkin (6):</p>
<ul>
<li>nouveau: be more careful about freeing temporary transfer buffers</li>
<li>nouveau: delay deleting buffer with unflushed fence</li>
<li>nouveau: wait to unref the transfer's bo until it's no longer used</li>
<li>nv30: pretend to have packed texture/surface formats</li>
<li>nv30: always go through translate module on big-endian</li>
<li>nouveau: make sure there's always room to emit a fence</li>
</ul>
<p>Jason Ekstrand (1):</p>
<ul>
<li>mesa: Correctly handle GL_BGRA_EXT in ES3 format_and_type checks</li>
</ul>
<p>Kyle Brenneman (3):</p>
<ul>
<li>glx: Fix build errors with --enable-mangling (v2)</li>
<li>mapi: Make _glapi_get_stub work with "gl" or "mgl" prefix.</li>
<li>glx: Don't hard-code the name "libGL.so.1" in driOpenDriver (v3)</li>
</ul>
<p>Leo Liu (1):</p>
<ul>
<li>radeon/vce: fix vui time_scale zero error</li>
</ul>
<p>Marek Olšák (21):</p>
<ul>
<li>st/mesa: fix front buffer regression after dropping st_validate_state in Blit</li>
<li>radeonsi: handle index buffer alloc failures</li>
<li>radeonsi: handle constant buffer alloc failures</li>
<li>gallium/radeon: handle buffer_map staging buffer failures better</li>
<li>gallium/radeon: handle buffer alloc failures in r600_draw_rectangle</li>
<li>gallium/radeon: add a fail path for depth MSAA texture readback</li>
<li>radeonsi: report alloc failure from si_shader_binary_read</li>
<li>radeonsi: add malloc fail paths to si_create_shader_state</li>
<li>radeonsi: skip drawing if the tess factor ring allocation fails</li>
<li>radeonsi: skip drawing if GS ring allocations fail</li>
<li>radeonsi: handle shader precompile failures</li>
<li>radeonsi: handle fixed-func TCS shader create failure</li>
<li>radeonsi: skip drawing if VS, TCS, TES, GS fail to compile or upload</li>
<li>radeonsi: skip drawing if PS fails to compile or upload</li>
<li>radeonsi: skip drawing if updating the scratch buffer fails</li>
<li>radeonsi: don't forget to update scratch relocations for LS, HS, ES shaders</li>
<li>radeonsi: handle dummy constant buffer allocation failure</li>
<li>gallium/u_blitter: handle allocation failures</li>
<li>radeonsi: add scratch buffer to the buffer list when it's re-allocated</li>
<li>st/dri: don't use _ctx in client_wait_sync</li>
<li>egl/dri2: don't require a context for ClientWaitSync (v2)</li>
</ul>
<p>Matthew Waters (1):</p>
<ul>
<li>egl: rework handling EGL_CONTEXT_FLAGS</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>st/dri: Use packed RGB formats</li>
</ul>
<p>Roland Scheidegger (1):</p>
<ul>
<li>mesa: fix mipmap generation for immutable, compressed textures</li>
</ul>
<p>Tom Stellard (3):</p>
<ul>
<li>gallium/radeon: Use call_once() when initailizing LLVM targets</li>
<li>gallivm: Allow drivers and state trackers to initialize gallivm LLVM targets v2</li>
<li>radeon/llvm: Initialize gallivm targets when initializing the AMDGPU target v2</li>
</ul>
<p>Varad Gautam (1):</p>
<ul>
<li>egl: restore surface type before linking config to its display</li>
</ul>
<p>Ville Syrjälä (3):</p>
<ul>
<li>i830: Fix collision between I830_UPLOAD_RASTER_RULES and I830_UPLOAD_TEX(0)</li>
<li>i915: Fix texcoord vs. varying collision in fragment programs</li>
<li>i915: Remember to call intel_prepare_render() before blitting</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,168 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 11.0.4 Release Notes / October 24, 2015</h1>
<p>
Mesa 11.0.4 is a bug fix release which fixes bugs found since the 11.0.3 release.
</p>
<p>
Mesa 11.0.4 implements the OpenGL 4.1 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 4.1. OpenGL
4.1 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
ed412ca6a46d1bd055120e5c12806c15419ae8c4dd6d3f6ea20a83091d5c78bf mesa-11.0.4.tar.gz
40201bf7fc6fa12a6d9edfe870b41eb4dd6669154e3c42c48a96f70805f5483d mesa-11.0.4.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86281">Bug 86281</a> - brw_meta_fast_clear (brw=brw&#64;entry=0x7fffd4097a08, fb=fb&#64;entry=0x7fffd40fa900, buffers=buffers&#64;entry=2, partial_clear=partial_clear&#64;entry=false)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86720">Bug 86720</a> - [radeon] Europa Universalis 4 freezing during game start (10.3.3+, still broken on 11.0.2)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91788">Bug 91788</a> - [HSW Regression] Synmark2_v6 Multithread performance case FPS reduced by 36%</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92304">Bug 92304</a> - [cts] cts.shaders.negative conformance tests fail</li>
</ul>
<h2>Changes</h2>
<p>Alejandro Piñeiro (2):</p>
<ul>
<li>i965/vec4: check writemask when bailing out at register coalesce</li>
<li>i965/vec4: fill src_reg type using the constructor type parameter</li>
</ul>
<p>Brian Paul (2):</p>
<ul>
<li>vbo: fix incorrect switch statement in init_mat_currval()</li>
<li>mesa: fix incorrect opcode in save_BlendFunci()</li>
</ul>
<p>Chih-Wei Huang (3):</p>
<ul>
<li>mesa: android: Fix the incorrect path of sse_minmax.c</li>
<li>nv50/ir: use C++11 standard std::unordered_map if possible</li>
<li>nv30: include the header of ffs prototype</li>
</ul>
<p>Chris Wilson (1):</p>
<ul>
<li>i965: Remove early release of DRI2 miptree</li>
</ul>
<p>Dave Airlie (1):</p>
<ul>
<li>mesa/uniforms: fix get_uniform for doubles (v2)</li>
</ul>
<p>Emil Velikov (1):</p>
<ul>
<li>docs: add sha256 checksums for 11.0.3</li>
</ul>
<p>Francisco Jerez (5):</p>
<ul>
<li>i965: Don't tell the hardware about our UAV access.</li>
<li>mesa: Expose function to calculate whether a shader image unit is valid.</li>
<li>mesa: Skip redundant texture completeness checking during image validation.</li>
<li>i965: Use _mesa_is_image_unit_valid() instead of gl_image_unit::_Valid.</li>
<li>mesa: Get rid of texture-dependent image unit derived state.</li>
</ul>
<p>Ian Romanick (8):</p>
<ul>
<li>glsl: Allow built-in functions as constant expressions in OpenGL ES 1.00</li>
<li>ff_fragment_shader: Use binding to set the sampler unit</li>
<li>glsl/linker: Use constant_initializer instead of constant_value to initialize uniforms</li>
<li>glsl: Use constant_initializer instead of constant_value to determine whether to keep an unused uniform</li>
<li>glsl: Only set ir_variable::constant_value for const-decorated variables</li>
<li>glsl: Restrict initializers for global variables to constant expression in ES</li>
<li>glsl: Add method to determine whether an expression contains the sequence operator</li>
<li>glsl: In later GLSL versions, sequence operator is cannot be a constant expression</li>
</ul>
<p>Ilia Mirkin (1):</p>
<ul>
<li>nouveau: make sure there's always room to emit a fence</li>
</ul>
<p>Indrajit Das (1):</p>
<ul>
<li>st/va: Used correct parameter to derive the value of the "h" variable in vlVaCreateImage</li>
</ul>
<p>Jonathan Gray (1):</p>
<ul>
<li>configure.ac: ensure RM is set</li>
</ul>
<p>Krzysztof Sobiecki (1):</p>
<ul>
<li>st/fbo: use pipe_surface_release instead of pipe_surface_reference</li>
</ul>
<p>Leo Liu (1):</p>
<ul>
<li>st/omx/dec/h264: fix field picture type 0 poc disorder</li>
</ul>
<p>Marek Olšák (3):</p>
<ul>
<li>st/mesa: fix clip state dependencies</li>
<li>radeonsi: fix a GS copy shader leak</li>
<li>gallium: add PIPE_SHADER_CAP_MAX_UNROLL_ITERATIONS_HINT</li>
</ul>
<p>Nicolai Hähnle (1):</p>
<ul>
<li>u_vbuf: fix vb slot assignment for translated buffers</li>
</ul>
<p>Rob Clark (1):</p>
<ul>
<li>freedreno/a3xx: cache-flush is needed after MEM_WRITE</li>
</ul>
<p>Tapani Pälli (3):</p>
<ul>
<li>mesa: add GL_UNSIGNED_INT_24_8 to _mesa_pack_depth_span</li>
<li>mesa: Set api prefix to version string when overriding version</li>
<li>mesa: fix ARRAY_SIZE query for GetProgramResourceiv</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,172 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 11.0.5 Release Notes / November 11, 2015</h1>
<p>
Mesa 11.0.5 is a bug fix release which fixes bugs found since the 11.0.4 release.
</p>
<p>
Mesa 11.0.5 implements the OpenGL 4.1 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 4.1. OpenGL
4.1 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
8495ef5c06f7f726452462b7d408a5b40048373ff908f2283a3b4d1f49b45ee6 mesa-11.0.5.tar.gz
9c255a2a6695fcc6ef4a279e1df0aeaf417dc142f39ee59dfb533d80494bb67a mesa-11.0.5.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91993">Bug 91993</a> - Graphical glitch in Astromenace (open-source game).</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92214">Bug 92214</a> - Flightgear crashes during splashboot with R600 driver, LLVM 3.7.0 and mesa 11.0.2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92437">Bug 92437</a> - osmesa: Expose GL entry points for Windows build, via .def file</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92476">Bug 92476</a> - [cts] ES2-CTS.gtf.GL2ExtensionTests.egl_image.egl_image fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92623">Bug 92623</a> - Differences in prog_data ignored when caching fragment programs (causes hangs)</li>
</ul>
<h2>Changes</h2>
<p>Alex Deucher (1):</p>
<ul>
<li>radeon/uvd: don't expose HEVC on old UVD hw (v3)</li>
</ul>
<p>Ben Widawsky (1):</p>
<ul>
<li>i965/skl: Add GT4 PCI IDs</li>
</ul>
<p>Emil Velikov (4):</p>
<ul>
<li>docs: add sha256 checksums for 11.0.4</li>
<li>cherry-ignore: ignore a possible wrong nomination</li>
<li>Revert "mesa/glformats: Undo code changes from _mesa_base_tex_format() move"</li>
<li>Update version to 11.0.5</li>
</ul>
<p>Emmanuel Gil Peyrot (1):</p>
<ul>
<li>gbm.h: Add a missing stddef.h include for size_t.</li>
</ul>
<p>Eric Anholt (1):</p>
<ul>
<li>vc4: When the create ioctl fails, free our cache and try again.</li>
</ul>
<p>Ian Romanick (1):</p>
<ul>
<li>i965: Fix is-renderable check in intel_image_target_renderbuffer_storage</li>
</ul>
<p>Ilia Mirkin (3):</p>
<ul>
<li>nvc0: respect edgeflag attribute width</li>
<li>nouveau: set MaxDrawBuffers to the same value as MaxColorAttachments</li>
<li>nouveau: relax fence emit space assert</li>
</ul>
<p>Ivan Kalvachev (1):</p>
<ul>
<li>r600g: Fix special negative immediate constants when using ABS modifier.</li>
</ul>
<p>Jason Ekstrand (2):</p>
<ul>
<li>nir/lower_vec_to_movs: Pass the shader around directly</li>
<li>nir: Report progress from lower_vec_to_movs().</li>
</ul>
<p>Jose Fonseca (2):</p>
<ul>
<li>gallivm: Translate all util_cpu_caps bits to LLVM attributes.</li>
<li>gallivm: Explicitly disable unsupported CPU features.</li>
</ul>
<p>Julien Isorce (4):</p>
<ul>
<li>st/va: pass picture desc to begin and decode</li>
<li>nvc0: fix crash when nv50_miptree_from_handle fails</li>
<li>st/va: do not destroy old buffer when new one failed</li>
<li>st/va: add more errors checks in vlVaBufferSetNumElements and vlVaMapBuffer</li>
</ul>
<p>Kenneth Graunke (6):</p>
<ul>
<li>i965: Fix missing BRW_NEW_*_PROG_DATA flagging caused by cache reuse.</li>
<li>nir: Report progress from nir_split_var_copies().</li>
<li>nir: Properly invalidate metadata in nir_split_var_copies().</li>
<li>nir: Properly invalidate metadata in nir_opt_copy_prop().</li>
<li>nir: Properly invalidate metadata in nir_lower_vec_to_movs().</li>
<li>nir: Properly invalidate metadata in nir_opt_remove_phis().</li>
</ul>
<p>Marek Olšák (1):</p>
<ul>
<li>radeonsi: add register definitions for Stoney</li>
</ul>
<p>Nanley Chery (1):</p>
<ul>
<li>mesa/glformats: Undo code changes from _mesa_base_tex_format() move</li>
</ul>
<p>Nicolai Hähnle (1):</p>
<ul>
<li>st/mesa: fix mipmap generation for immutable textures with incomplete pyramids</li>
</ul>
<p>Nigel Stewart (1):</p>
<ul>
<li>osmesa: Expose GL entry points for Windows build via DEF file.</li>
</ul>
<p>Roland Scheidegger (1):</p>
<ul>
<li>gallivm: disable f16c when not using AVX</li>
</ul>
<p>Samuel Li (2):</p>
<ul>
<li>radeonsi: add support for Stoney asics (v3)</li>
<li>radeonsi: add Stoney pci ids</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,145 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 11.0.6 Release Notes / November 21, 2015</h1>
<p>
Mesa 11.0.6 is a bug fix release which fixes bugs found since the 11.0.5 release.
</p>
<p>
Mesa 11.0.6 implements the OpenGL 4.1 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 4.1. OpenGL
4.1 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
4bdf054af66ebabf3eca0616f9f5e44c2f234695661b570261c391bc2f4f7482 mesa-11.0.6.tar.gz
8340e64cdc91999840404c211496f3de38e7b4cb38db34e2f72f1642c5134760 mesa-11.0.6.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91780">Bug 91780</a> - Rendering issues with geometry shader</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92588">Bug 92588</a> - [HSW,BDW,BSW,SKL-Y][GLES 3.1 CTS] ES31-CTS.arrays_of_arrays.InteractionFunctionCalls2 - assert</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92738">Bug 92738</a> - Randon R7 240 doesn't work on 16KiB page size platform</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92860">Bug 92860</a> - [radeonsi][bisected] st/mesa: implement ARB_copy_image - Corruption in ARK Survival Evolved</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92900">Bug 92900</a> - [regression bisected] About 700 piglit regressions is what could go wrong</li>
</ul>
<h2>Changes</h2>
<p>Alex Deucher (1):</p>
<ul>
<li>radeonsi: enable optimal raster config setting for fiji (v2)</li>
</ul>
<p>Ben Widawsky (1):</p>
<ul>
<li>i965/skl/gt4: Fix URB programming restriction.</li>
</ul>
<p>Boyuan Zhang (2):</p>
<ul>
<li>st/vaapi: fix vaapi VC-1 simple/main corruption v2</li>
<li>radeon/uvd: fix VC-1 simple/main profile decode v2</li>
</ul>
<p>Dave Airlie (1):</p>
<ul>
<li>r600: initialised PGM_RESOURCES_2 for ES/GS</li>
</ul>
<p>Emil Velikov (4):</p>
<ul>
<li>docs: add sha256 checksums for 11.0.5</li>
<li>cherry-ignore: add the swrast front buffer support</li>
<li>automake: use static llvm for make distcheck</li>
<li>Update version to 11.0.6</li>
</ul>
<p>Eric Anholt (3):</p>
<ul>
<li>vc4: Return GL_OUT_OF_MEMORY when buffer allocation fails.</li>
<li>vc4: Return NULL when we can't make our shadow for a sampler view.</li>
<li>vc4: Add support for nir_op_uge, using the carry bit on QPU_A_SUB.</li>
</ul>
<p>Ian Romanick (2):</p>
<ul>
<li>meta/generate_mipmap: Don't leak the sampler object</li>
<li>meta/generate_mipmap: Only modify the draw framebuffer binding in fallback_required</li>
</ul>
<p>Ilia Mirkin (2):</p>
<ul>
<li>mesa/copyimage: allow width/height to not be multiples of block</li>
<li>nouveau: don't expose HEVC decoding support</li>
</ul>
<p>Jason Ekstrand (1):</p>
<ul>
<li>nir/vars_to_ssa: Rework copy set handling in lower_copies_to_load_store</li>
</ul>
<p>Kenneth Graunke (1):</p>
<ul>
<li>glsl: Allow implicit int -&gt; uint conversions for the % operator.</li>
</ul>
<p>Marek Olšák (1):</p>
<ul>
<li>radeonsi: initialize SX_PS_DOWNCONVERT to 0 on Stoney</li>
</ul>
<p>Michel Dänzer (1):</p>
<ul>
<li>winsys/radeon: Use CPU page size instead of hardcoding 4096 bytes v3</li>
</ul>
<p>Oded Gabbay (1):</p>
<ul>
<li>llvmpipe: use simple coeffs calc for 128bit vectors</li>
</ul>
<p>Roland Scheidegger (2):</p>
<ul>
<li>radeon: fix bgrx8/xrgb8 blits</li>
<li>r200: fix bgrx8/xrgb8 blits</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,154 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 11.0.7 Release Notes / December 9, 2015</h1>
<p>
Mesa 11.0.7 is a bug fix release which fixes bugs found since the 11.0.6 release.
</p>
<p>
Mesa 11.0.7 implements the OpenGL 4.1 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 4.1. OpenGL
4.1 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
07c27004ff68b288097d17b2faa7bdf15ec73c96b7e6c9835266e544adf0a62f mesa-11.0.7.tar.gz
e7e90a332ede6c8fd08eff90786a3fd1605a4e62ebf3a9b514047838194538cb mesa-11.0.7.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90348">Bug 90348</a> - Spilling failure of b96 merged value</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92363">Bug 92363</a> - [BSW/BDW] ogles1conform Gets test fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92438">Bug 92438</a> - Segfault in pushbuf_kref when running the android emulator (qemu) on nv50</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93110">Bug 93110</a> - [NVE4] textureSize() and textureQueryLevels() uses a texture bound during the previous draw call</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93126">Bug 93126</a> - wrongly claim supporting GL_EXT_texture_rg</li>
</ul>
<h2>Changes</h2>
<p>Chris Wilson (1):</p>
<ul>
<li>meta: Compute correct buffer size with SkipRows/SkipPixels</li>
</ul>
<p>Daniel Stone (1):</p>
<ul>
<li>egl/wayland: Ignore rects from SwapBuffersWithDamage</li>
</ul>
<p>Dave Airlie (4):</p>
<ul>
<li>texgetimage: consolidate 1D array handling code.</li>
<li>r600: geometry shader gsvs itemsize workaround</li>
<li>r600: rv670 use at least 16es/gs threads</li>
<li>r600: workaround empty geom shader.</li>
</ul>
<p>Emil Velikov (4):</p>
<ul>
<li>docs: add sha256 checksums for 11.0.6</li>
<li>get-pick-list.sh: Require explicit "11.0" for nominating stable patches</li>
<li>mesa; add get-extra-pick-list.sh script into bin/</li>
<li>Update version to 11.0.7</li>
</ul>
<p>François Tigeot (1):</p>
<ul>
<li>xmlconfig: Add support for DragonFly</li>
</ul>
<p>Ian Romanick (22):</p>
<ul>
<li>mesa: Make bind_vertex_buffer avilable outside varray.c</li>
<li>mesa: Refactor update_array_format to make _mesa_update_array_format_public</li>
<li>mesa: Refactor enable_vertex_array_attrib to make _mesa_enable_vertex_array_attrib</li>
<li>i965: Pass brw_context instead of gl_context to brw_draw_rectlist</li>
<li>i965: Use DSA functions for VBOs in brw_meta_fast_clear</li>
<li>i965: Use internal functions for buffer object access</li>
<li>i965: Don't pollute the buffer object namespace in brw_meta_fast_clear</li>
<li>meta: Use DSA functions for PBO in create_texture_for_pbo</li>
<li>meta: Use _mesa_NamedBufferData and _mesa_NamedBufferSubData for users of _mesa_meta_setup_vertex_objects</li>
<li>i965: Use _mesa_NamedBufferSubData for users of _mesa_meta_setup_vertex_objects</li>
<li>meta: Don't leave the VBO bound after _mesa_meta_setup_vertex_objects</li>
<li>meta: Track VBO using gl_buffer_object instead of GL API object handle</li>
<li>meta: Use DSA functions for VBOs in _mesa_meta_setup_vertex_objects</li>
<li>meta: Use internal functions for buffer object and VAO access</li>
<li>meta: Don't pollute the buffer object namespace in _mesa_meta_setup_vertex_objects</li>
<li>meta: Partially convert _mesa_meta_DrawTex to DSA</li>
<li>meta: Track VBO using gl_buffer_object instead of GL API object handle in _mesa_meta_DrawTex</li>
<li>meta: Use internal functions for buffer object and VAO access in _mesa_meta_DrawTex</li>
<li>meta: Don't pollute the buffer object namespace in _mesa_meta_DrawTex</li>
<li>meta/TexSubImage: Don't pollute the buffer object namespace</li>
<li>meta/generate_mipmap: Don't leak the framebuffer object</li>
<li>glsl: Fix off-by-one error in array size check assertion</li>
</ul>
<p>Ilia Mirkin (7):</p>
<ul>
<li>nvc0/ir: actually emit AFETCH on kepler</li>
<li>nir: fix typo in idiv lowering, causing large-udiv-udiv failures</li>
<li>nouveau: use the buffer usage to determine placement when no binding</li>
<li>nv50,nvc0: properly handle buffer storage invalidation on dsa buffer</li>
<li>nv50/ir: fix (un)spilling of 3-wide results</li>
<li>mesa: support GL_RED/GL_RG in ES2 contexts when driver support exists</li>
<li>nvc0/ir: start offset at texBindBase for txq, like regular texturing</li>
</ul>
<p>Jonathan Gray (1):</p>
<ul>
<li>automake: fix some occurrences of hardcoded -ldl and -lpthread</li>
</ul>
<p>Leo Liu (1):</p>
<ul>
<li>radeon/vce: disable Stoney VCE for 11.0</li>
</ul>
<p>Marta Lofstedt (1):</p>
<ul>
<li>gles2: Update gl2ext.h to revision: 32120</li>
</ul>
<p>Oded Gabbay (1):</p>
<ul>
<li>llvmpipe: disable VSX in ppc due to LLVM PPC bug</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,200 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 11.0.8 Release Notes / December 9, 2015</h1>
<p>
Mesa 11.0.8 is a bug fix release which fixes bugs found since the 11.0.7 release.
</p>
<p>
Mesa 11.0.8 implements the OpenGL 4.1 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 4.1. OpenGL
4.1 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
ab9db87b54d7525e4b611b82577ea9a9eae55927558df57b190059d5ecd9406f mesa-11.0.8.tar.gz
5696e4730518b6805d2ed5def393c4293f425a2c2c01bd5ed4bdd7ad62f7ad75 mesa-11.0.8.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91806">Bug 91806</a> - configure does not test whether assembler supports sse4.1</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92849">Bug 92849</a> - [IVB HSW BDW] piglit image load/store load-from-cleared-image.shader_test fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92909">Bug 92909</a> - Offset/alignment issue with layout std140 and vec3</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93004">Bug 93004</a> - Guild Wars 2 crash on nouveau DX11 cards</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93215">Bug 93215</a> - [Regression bisected] Ogles1conform Automatic mipmap generation test is fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93266">Bug 93266</a> - gl_arb_shading_language_420pack does not allow binding of image variables</li>
</ul>
<h2>Changes</h2>
<p>Boyuan Zhang (1):</p>
<ul>
<li>radeon/uvd: uv pitch separation for stoney</li>
</ul>
<p>Dave Airlie (9):</p>
<ul>
<li>r600: do SQ flush ES ring rolling workaround</li>
<li>r600: SMX returns CONTEXT_DONE early workaround</li>
<li>r600/shader: split address get out to a function.</li>
<li>r600/shader: add utility functions to do single slot arithmatic</li>
<li>r600g: fix geom shader input indirect indexing.</li>
<li>r600: handle geometry dynamic input array index</li>
<li>radeonsi: handle doubles in lds load path.</li>
<li>mesa/varray: set double arrays to non-normalised.</li>
<li>mesa/shader: return correct attribute location for double matrix arrays</li>
</ul>
<p>Emil Velikov (8):</p>
<ul>
<li>docs: add sha256 checksums for 11.0.7</li>
<li>cherry-ignore: don't pick a specific i965 formats patch</li>
<li>Revert "i965/nir: Remove unused indirect handling"</li>
<li>Revert "i965/state: Get rid of dword_pitch arguments to buffer functions"</li>
<li>Revert "i965/vec4: Use a stride of 1 and byte offsets for UBOs"</li>
<li>Revert "i965/fs: Use a stride of 1 and byte offsets for UBOs"</li>
<li>Revert "i965/vec4: Use byte offsets for UBO pulls on Sandy Bridge"</li>
<li>Update version to 11.0.8</li>
</ul>
<p>Francisco Jerez (1):</p>
<ul>
<li>i965: Resolve color and flush for all active shader images in intel_update_state().</li>
</ul>
<p>Ian Romanick (1):</p>
<ul>
<li>meta/generate_mipmap: Work-around GLES 1.x problem with GL_DRAW_FRAMEBUFFER</li>
</ul>
<p>Ilia Mirkin (17):</p>
<ul>
<li>freedreno/a4xx: support lod_bias</li>
<li>freedreno/a4xx: fix 5_5_5_1 texture sampler format</li>
<li>freedreno/a4xx: point regid to "red" even for alpha-only rb formats</li>
<li>nvc0/ir: fold postfactor into immediate</li>
<li>nv50/ir: deal with loops with no breaks</li>
<li>nv50/ir: the mad source might not have a defining instruction</li>
<li>nv50/ir: fix instruction permutation logic</li>
<li>nv50/ir: don't forget to mark flagsDef on cvt in txb lowering</li>
<li>nv50/ir: fix DCE to not generate 96-bit loads</li>
<li>nv50/ir: avoid looking at uninitialized srcMods entries</li>
<li>gk110/ir: fix imul hi emission with limm arg</li>
<li>gk104/ir: sampler doesn't matter for txf</li>
<li>gk110/ir: fix imad sat/hi flag emission for immediate args</li>
<li>nv50/ir: fix cutoff for using r63 vs r127 when replacing zero</li>
<li>nv50/ir: can't have predication and immediates</li>
<li>glsl: assign varying locations to tess shaders when doing SSO</li>
<li>ttn: add TEX2 support</li>
</ul>
<p>Jason Ekstrand (5):</p>
<ul>
<li>i965/vec4: Use byte offsets for UBO pulls on Sandy Bridge</li>
<li>i965/fs: Use a stride of 1 and byte offsets for UBOs</li>
<li>i965/vec4: Use a stride of 1 and byte offsets for UBOs</li>
<li>i965/state: Get rid of dword_pitch arguments to buffer functions</li>
<li>i965/nir: Remove unused indirect handling</li>
</ul>
<p>Jonathan Gray (2):</p>
<ul>
<li>configure.ac: use pkg-config for libelf</li>
<li>configure: check for python2.7 for PYTHON2</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>i965: Fix fragment shader struct inputs.</li>
<li>i965: Fix scalar vertex shader struct outputs.</li>
</ul>
<p>Marek Olšák (8):</p>
<ul>
<li>radeonsi: fix occlusion queries on Fiji</li>
<li>radeonsi: fix a hang due to uninitialized border color registers</li>
<li>radeonsi: fix Fiji for LLVM &lt;= 3.7</li>
<li>radeonsi: don't call of u_prims_for_vertices for patches and rectangles</li>
<li>radeonsi: apply the streamout workaround to Fiji as well</li>
<li>gallium/radeon: fix Hyper-Z hangs by programming PA_SC_MODE_CNTL_1 correctly</li>
<li>tgsi/scan: add flag colors_written</li>
<li>r600g: write all MRTs only if there is exactly one output (fixes a hang)</li>
</ul>
<p>Matt Turner (1):</p>
<ul>
<li>glsl: Allow binding of image variables with 420pack.</li>
</ul>
<p>Neil Roberts (2):</p>
<ul>
<li>i965: Add MESA_FORMAT_B8G8R8X8_SRGB to brw_format_for_mesa_format</li>
<li>i965: Add B8G8R8X8_SRGB to the alpha format override</li>
</ul>
<p>Oded Gabbay (1):</p>
<ul>
<li>configura.ac: fix test for SSE4.1 assembler support</li>
</ul>
<p>Patrick Rudolph (2):</p>
<ul>
<li>nv50,nvc0: fix use-after-free when vertex buffers are unbound</li>
<li>gallium/util: return correct number of bound vertex buffers</li>
</ul>
<p>Samuel Pitoiset (1):</p>
<ul>
<li>nvc0: free memory allocated by the prog which reads MP perf counters</li>
</ul>
<p>Tapani Pälli (1):</p>
<ul>
<li>i965: use _Shader to get fragment program when updating surface state</li>
</ul>
<p>Tom Stellard (2):</p>
<ul>
<li>radeonsi: Rename si_shader::ls_rsrc{1,2} to si_shader::rsrc{1,2}</li>
<li>radeonsi/compute: Use the compiler's COMPUTE_PGM_RSRC* register values</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,127 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 11.0.9 Release Notes / January 22, 2016</h1>
<p>
Mesa 11.0.9 is a bug fix release which fixes bugs found since the 11.0.8 release.
</p>
<p>
Mesa 11.0.9 implements the OpenGL 4.1 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 4.1. OpenGL
4.1 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
1597c2e983f476f98efdd6cd58b5298896d18479ff542bdeff28b98b129ede05 mesa-11.0.9.tar.gz
a1262ff1c66a16ccf341186cf0e57b306b8589eb2cc5ce92ffb6788ab01d2b01 mesa-11.0.9.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91596">Bug 91596</a> - EGL_KHR_gl_colorspace (v2) causes problem with Android-x86 GUI</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92229">Bug 92229</a> - [APITRACE] SOMA have serious graphical errors</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93257">Bug 93257</a> - [SKL, bisected] ASTC dEQP tests segfault</li>
</ul>
<h2>Changes</h2>
<p>Emil Velikov (6):</p>
<ul>
<li>docs: add sha256 checksums for 11.0.8</li>
<li>cherry-ignore: add patch already in branch</li>
<li>cherry-ignore: add the dri3 glx null check patch</li>
<li>i915: correctly parse/set the context flags</li>
<li>egl/dri2: expose srgb configs when KHR_gl_colorspace is available</li>
<li>Update version to 11.0.9</li>
</ul>
<p>Grazvydas Ignotas (1):</p>
<ul>
<li>r600: fix constant buffer size programming</li>
</ul>
<p>Ilia Mirkin (5):</p>
<ul>
<li>nvc0: don't forget to reset VTX_TMP bufctx slot after blit completion</li>
<li>nv50/ir: float(s32 &amp; 0xff) = float(u8), not s8</li>
<li>nv50,nvc0: make sure there's pushbuf space and that we ref the bo early</li>
<li>nv50,nvc0: fix crash when increasing bsp bo size for h264</li>
<li>nvc0: scale up inter_bo size so that it's 16M for a 4K video</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>ralloc: Fix ralloc_adopt() to the old context's last child's parent.</li>
<li>nvc0: Set winding order regardless of domain.</li>
</ul>
<p>Marek Olšák (1):</p>
<ul>
<li>radeonsi: don't miss changes to SPI_TMPRING_SIZE</li>
</ul>
<p>Miklós Máté (1):</p>
<ul>
<li>mesa: Don't leak ATIfs instructions in DeleteFragmentShader</li>
</ul>
<p>Neil Roberts (1):</p>
<ul>
<li>i965: Fix crash when calling glViewport with no surface bound</li>
</ul>
<p>Nicolai Hähnle (6):</p>
<ul>
<li>gallium/radeon: only dispose locally created target machine in radeon_llvm_compile</li>
<li>mesa/bufferobj: make _mesa_delete_buffer_object externally accessible</li>
<li>st/mesa: use _mesa_delete_buffer_object</li>
<li>radeon: use _mesa_delete_buffer_object</li>
<li>i915: use _mesa_delete_buffer_object</li>
<li>i965: use _mesa_delete_buffer_object</li>
</ul>
<p>Oded Gabbay (1):</p>
<ul>
<li>llvmpipe: use vpkswss when dst is signed</li>
</ul>
<p>Rob Herring (1):</p>
<ul>
<li>freedreno/ir3: fix 32-bit builds with pointer-to-int-cast error enabled</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,281 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 11.1.0 Release Notes / 15 December 2015</h1>
<p>
Mesa 11.1.0 is a new development release.
People who are concerned with stability and reliability should stick
with a previous release or wait for Mesa 11.1.1.
</p>
<p>
Mesa 11.1.0 implements the OpenGL 4.1 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 4.1. OpenGL
4.1 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
e3bc44be4df5e4dc728dfda7b55b1aaeadfce36eca6a367b76cc07598070cb2d mesa-11.1.0.tar.gz
9befe03b04223eb1ede177fa8cac001e2850292c8c12a3ec9929106afad9cf1f mesa-11.1.0.tar.xz
</pre>
<h2>New features</h2>
<p>
Note: some of the new features are only available with certain drivers.
</p>
<ul>
<li>OpenGL 3.1 support on freedreno (a3xx, a4xx)</li>
<li>OpenGL 3.3 support for VMware guest VM driver (supported by Workstation 12
and Fusion 8).
<li>GL_AMD_performance_monitor on nv50</li>
<li>GL_ARB_arrays_of_arrays on i965</li>
<li>GL_ARB_blend_func_extended on freedreno (a3xx)</li>
<li>GL_ARB_clear_texture on nv50, nvc0</li>
<li>GL_ARB_clip_control on freedreno/a4xx</li>
<li>GL_ARB_copy_image on nv50, nvc0, radeonsi</li>
<li>GL_ARB_depth_clamp on freedreno/a4xx</li>
<li>GL_ARB_fragment_layer_viewport on i965 (gen6+)</li>
<li>GL_ARB_gpu_shader_fp64 on r600 for Cypress/Cayman/Aruba chips</li>
<li>GL_ARB_gpu_shader5 on r600 for Evergreen and later chips</li>
<li>GL_ARB_seamless_cubemap_per_texture on freedreno/a4xx</li>
<li>GL_ARB_shader_clock on i965 (gen7+)</li>
<li>GL_ARB_shader_stencil_export on i965 (gen9+)</li>
<li>GL_ARB_shader_storage_buffer_object on i965</li>
<li>GL_ARB_shader_texture_image_samples on i965, nv50, nvc0, r600, radeonsi</li>
<li>GL_ARB_texture_barrier / GL_NV_texture_barrier on i965</li>
<li>GL_ARB_texture_buffer_range on freedreno/a3xx</li>
<li>GL_ARB_texture_compression_bptc on freedreno/a4xx</li>
<li>GL_ARB_texture_query_lod on softpipe</li>
<li>GL_ARB_texture_view on radeonsi and r600 (for evergeen and newer)</li>
<li>GL_ARB_vertex_type_2_10_10_10_rev on freedreno (a3xx, a4xx)</li>
<li>GL_EXT_blend_func_extended on all drivers that support the ARB version</li>
<li>GL_EXT_buffer_storage implemented for when ES 3.1 support is gained</li>
<li>GL_EXT_draw_elements_base_vertex on all drivers</li>
<li>GL_EXT_texture_compression_rgtc / latc on freedreno (a3xx & a4xx)</li>
<li>GL_KHR_debug (GLES)</li>
<li>GL_NV_conditional_render on freedreno</li>
<li>GL_OES_draw_elements_base_vertex on all drivers</li>
<li>EGL_KHR_create_context on softpipe, llvmpipe</li>
<li>EGL_KHR_gl_colorspace on softpipe, llvmpipe</li>
<li>new virgl gallium driver for qemu virtio-gpu</li>
<li>16x multisampling on i965 (gen9+)</li>
<li>GL_EXT_shader_samples_identical on i965.</li>
</ul>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28130">Bug 28130</a> - vbo: premature flushing breaks GL_LINE_LOOP</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=38109">Bug 38109</a> - i915 driver crashes if too few vertices are submitted (Mesa 7.10.2)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=49779">Bug 49779</a> - Extra line segments in GL_LINE_LOOP</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=55552">Bug 55552</a> - Compile errors with --enable-mangling</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=71789">Bug 71789</a> - [r300g] Visuals not found in (default) depth = 24</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79783">Bug 79783</a> - Distorted output in obs-studio where other vendors &quot;work&quot;</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80821">Bug 80821</a> - When LIBGL_ALWAYS_SOFTWARE is set, KHR_create_context is not supported</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81174">Bug 81174</a> - Gallium: GL_LINE_LOOP broken with more than 512 points</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83508">Bug 83508</a> - [UBO] Assertion for array of blocks</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84677">Bug 84677</a> - Triangle disappears with glPolygonMode GL_LINE</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86281">Bug 86281</a> - brw_meta_fast_clear (brw=brw&#64;entry=0x7fffd4097a08, fb=fb&#64;entry=0x7fffd40fa900, buffers=buffers&#64;entry=2, partial_clear=partial_clear&#64;entry=false)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86469">Bug 86469</a> - Unreal Engine demo doesn't run</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86720">Bug 86720</a> - [radeon] Europa Universalis 4 freezing during game start (10.3.3+, still broken on 11.0.2)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89014">Bug 89014</a> - PIPE_QUERY_GPU_FINISHED is not acting as expected on SI</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90175">Bug 90175</a> - [hsw bisected][PATCH] atomic counters doesn't work for a binding point different to zero</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90348">Bug 90348</a> - Spilling failure of b96 merged value</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90631">Bug 90631</a> - Compilation failure for fragment shader with many branches on Sandy Bridge</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90734">Bug 90734</a> - glBufferSubData is corrupting data when buffer is &gt; 32k</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90887">Bug 90887</a> - PhiMovesPass in register allocator broken</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91044">Bug 91044</a> - piglit spec/egl_khr_create_context/valid debug flag gles* fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91114">Bug 91114</a> - ES3-CTS.gtf.GL3Tests.shadow.shadow_execution_vert fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91254">Bug 91254</a> - (regresion) video using VA-API on Intel slow and freeze system with mesa 10.6 or 10.6.1</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91292">Bug 91292</a> - [BDW+] glVertexAttribDivisor not working in combination with glPolygonMode</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91342">Bug 91342</a> - Very dark textures on some objects in indoors environments in Postal 2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91526">Bug 91526</a> - World of Warcraft (on Wine) has UI corruption with nouveau</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91551">Bug 91551</a> - DXTn compressed normal maps produce severe artifacts on all NV5x and NVDx chipsets</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91596">Bug 91596</a> - EGL_KHR_gl_colorspace (v2) causes problem with Android-x86 GUI</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91716">Bug 91716</a> - [bisected] piglit.shaders.glsl-vs-int-attrib regresses on 32 bit BYT, HSW, IVB, SNB</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91718">Bug 91718</a> - piglit.spec.arb_shader_image_load_store.invalid causes intermittent GPU HANG</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91719">Bug 91719</a> - [SNB,HSW,BYT] dEQP regressions associated with using NIR for vertex shaders</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91726">Bug 91726</a> - R600 asserts in tgsi_cmp/make_src_for_op3</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91780">Bug 91780</a> - Rendering issues with geometry shader</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91785">Bug 91785</a> - make check DispatchSanity_test.GLES31 regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91788">Bug 91788</a> - [HSW Regression] Synmark2_v6 Multithread performance case FPS reduced by 36%</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91847">Bug 91847</a> - glGenerateTextureMipmap not working (no errors) unless glActiveTexture(GL_TEXTURE1) is called before</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91857">Bug 91857</a> - Mesa 10.6.3 linker is slow</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91881">Bug 91881</a> - regression: GPU lockups since mesa-11.0.0_rc1 on RV620 (r600) driver</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91890">Bug 91890</a> - [nve7] witcher2: blurry image &amp; DATA_ERRORs (class 0xa097 mthd 0x2380/0x238c)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91898">Bug 91898</a> - src/util/mesa-sha1.c:250:25: fatal error: openssl/sha.h: No such file or directory</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91927">Bug 91927</a> - [SKL] [regression] piglit compressed textures tests fail with kernel upgrade</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91930">Bug 91930</a> - Program with GtkGLArea widget does not redraw</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91970">Bug 91970</a> - [BSW regression] dEQP-GLES3.functional.shaders.precision.int.highp_mul_vertex</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91985">Bug 91985</a> - [regression, bisected] FTBFS with commit f9caabe8f1: R600_UCP_CONST_BUFFER is undefined</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91993">Bug 91993</a> - Graphical glitch in Astromenace (open-source game).</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92009">Bug 92009</a> - ES3-CTS.gtf.GL3Tests.packed_pixels.packed_pixels fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92033">Bug 92033</a> - [SNB,regression,dEQP,bisected] functional.shaders.random tests regressed</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92052">Bug 92052</a> - nir/nir_builder.h:79: error: expected primary-expression before . token</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92054">Bug 92054</a> - make check gbm-symbols-check regression</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92066">Bug 92066</a> - [ILK,G45,regression] New assertion on BRW_MAX_MRF breaks ilk and g45</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92072">Bug 92072</a> - Wine breakage since d082c5324 (st/mesa: don't call st_validate_state in BlitFramebuffer)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92095">Bug 92095</a> - [Regression, bisected] arb_shader_atomic_counters.compiler.builtins.frag</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92122">Bug 92122</a> - [bisected, cts] Regression with Assault Android Cactus</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92124">Bug 92124</a> - shader_query.cpp:841:34: error: strndup was not declared in this scope</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92183">Bug 92183</a> - linker.cpp:3187:46: error: strtok_r was not declared in this scope</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92193">Bug 92193</a> - [SKL] ES2-CTS.gtf.GL2ExtensionTests.compressed_astc_texture.compressed_astc_texture fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92214">Bug 92214</a> - Flightgear crashes during splashboot with R600 driver, LLVM 3.7.0 and mesa 11.0.2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92221">Bug 92221</a> - Unintended code changes in _mesa_base_tex_format commit</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92265">Bug 92265</a> - Black windows in weston after update mesa to 11.0.2-1</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92304">Bug 92304</a> - [cts] cts.shaders.negative conformance tests fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92363">Bug 92363</a> - [BSW/BDW] ogles1conform Gets test fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92437">Bug 92437</a> - osmesa: Expose GL entry points for Windows build, via .def file</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92438">Bug 92438</a> - Segfault in pushbuf_kref when running the android emulator (qemu) on nv50</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92476">Bug 92476</a> - [cts] ES2-CTS.gtf.GL2ExtensionTests.egl_image.egl_image fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92588">Bug 92588</a> - [HSW,BDW,BSW,SKL-Y][GLES 3.1 CTS] ES31-CTS.arrays_of_arrays.InteractionFunctionCalls2 - assert</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92621">Bug 92621</a> - [G965 ILK G45] Regression: 24 piglit regressions in glsl-1.10</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92623">Bug 92623</a> - Differences in prog_data ignored when caching fragment programs (causes hangs)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92634">Bug 92634</a> - gallium's vl_mpeg12_decoder does not work with st/va</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92639">Bug 92639</a> - [Regression bisected] Ogles1conform mustpass.c fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92641">Bug 92641</a> - [SKL BSW] [Regression] Ogles1conform userclip.c fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92645">Bug 92645</a> - kodi vdpau interop fails since mesa,meta: move gl_texture_object::TargetIndex initializations</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92705">Bug 92705</a> - [clover] fail to build with llvm-svn/clang-svn 3.8</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92709">Bug 92709</a> - &quot;LLVM triggered Diagnostic Handler: unsupported call to function ldexpf in main&quot; when starting race in stuntrally</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92738">Bug 92738</a> - Randon R7 240 doesn't work on 16KiB page size platform</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92744">Bug 92744</a> - [g965 Regression bisected] Performance regression and piglit assertions due to liveness analysis</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92770">Bug 92770</a> - [SNB, regression, dEQP] deqp-gles3.functional.shaders.discard.dynamic_loop_texture</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92824">Bug 92824</a> - [regression, bisected] `make check` dispatch-sanity broken by GL_EXT_buffer_storage</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92849">Bug 92849</a> - [IVB HSW BDW] piglit image load/store load-from-cleared-image.shader_test fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92859">Bug 92859</a> - [regression, bisected] validate_intrinsic_instr: Assertion triggered</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92860">Bug 92860</a> - [radeonsi][bisected] st/mesa: implement ARB_copy_image - Corruption in ARK Survival Evolved</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92900">Bug 92900</a> - [regression bisected] About 700 piglit regressions is what could go wrong</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92909">Bug 92909</a> - Offset/alignment issue with layout std140 and vec3</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92985">Bug 92985</a> - Mac OS X build error &quot;ar: no archive members specified&quot;</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93015">Bug 93015</a> - Tonga Elemental segfault + VM faults since radeon: implement r600_query_hw_get_result via function pointers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93048">Bug 93048</a> - [CTS regression] mesa af2723 breaks GL Conformance for debug extension</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93063">Bug 93063</a> - drm_helper.h:227:1: error: static declaration of pipe_virgl_create_screen follows non-static declaration</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93091">Bug 93091</a> - [opencl] segfault when running any opencl programs (like clinfo)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93126">Bug 93126</a> - wrongly claim supporting GL_EXT_texture_rg</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93180">Bug 93180</a> - [regression] arb_separate_shader_objects.active sampler conflict fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93235">Bug 93235</a> - [regression] dispatch sanity broken by GetPointerv</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93266">Bug 93266</a> - gl_arb_shading_language_420pack does not allow binding of image variables</li>
</ul>
<h2>Changes</h2>
<li>MPEG4 decoding has been disabled by default in the VAAPI driver</li>
</div>
</body>
</html>

View File

@@ -1,197 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 11.1.1 Release Notes / January 13, 2016</h1>
<p>
Mesa 11.1.1 is a bug fix release which fixes bugs found since the 11.1.0 release.
</p>
<p>
Mesa 11.1.1 implements the OpenGL 4.1 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 4.1. OpenGL
4.1 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
b15089817540ba0bffd0aad323ecf3a8ff6779568451827c7274890b4a269d58 mesa-11.1.1.tar.gz
64db074fc514136b5fb3890111f0d50604db52f0b1e94ba3fcb0fe8668a7fd20 mesa-11.1.1.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91806">Bug 91806</a> - configure does not test whether assembler supports sse4.1</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92229">Bug 92229</a> - [APITRACE] SOMA have serious graphical errors</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92233">Bug 92233</a> - Unigine Heaven 4.0 silhuette run</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93004">Bug 93004</a> - Guild Wars 2 crash on nouveau DX11 cards</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93215">Bug 93215</a> - [Regression bisected] Ogles1conform Automatic mipmap generation test is fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93257">Bug 93257</a> - [SKL, bisected] ASTC dEQP tests segfault</li>
</ul>
<h2>Changes</h2>
<p>Brian Paul (1):</p>
<ul>
<li>st/mesa: check state-&gt;mesa in early return check in st_validate_state()</li>
</ul>
<p>Dave Airlie (6):</p>
<ul>
<li>mesa/varray: set double arrays to non-normalised.</li>
<li>mesa/shader: return correct attribute location for double matrix arrays</li>
<li>glsl: pass stage into mark function</li>
<li>glsl/fp64: add helper for dual slot double detection.</li>
<li>glsl: fix count_attribute_slots to allow for different 64-bit handling</li>
<li>glsl: only update doubles inputs for vertex inputs.</li>
</ul>
<p>Emil Velikov (4):</p>
<ul>
<li>docs: add sha256 checksums for 11.0.1</li>
<li>cherry-ignore: drop the "re-enable" DCC on Stoney</li>
<li>cherry-ignore: don't pick a specific i965 formats patch</li>
<li>Update version to 11.1.1</li>
</ul>
<p>Eric Anholt (2):</p>
<ul>
<li>vc4: Warn instead of abort()ing on exec ioctl failures.</li>
<li>vc4: Keep sample mask writes from being reordered after TLB writes</li>
</ul>
<p>Grazvydas Ignotas (1):</p>
<ul>
<li>r600: fix constant buffer size programming</li>
</ul>
<p>Ian Romanick (1):</p>
<ul>
<li>meta/generate_mipmap: Work-around GLES 1.x problem with GL_DRAW_FRAMEBUFFER</li>
</ul>
<p>Ilia Mirkin (9):</p>
<ul>
<li>nv50/ir: can't have predication and immediates</li>
<li>gk104/ir: simplify and fool-proof texbar algorithm</li>
<li>glsl: assign varying locations to tess shaders when doing SSO</li>
<li>glx/dri3: a drawable might not be bound at wait time</li>
<li>nvc0: don't forget to reset VTX_TMP bufctx slot after blit completion</li>
<li>nv50/ir: float(s32 &amp; 0xff) = float(u8), not s8</li>
<li>nv50,nvc0: make sure there's pushbuf space and that we ref the bo early</li>
<li>nv50,nvc0: fix crash when increasing bsp bo size for h264</li>
<li>nvc0: scale up inter_bo size so that it's 16M for a 4K video</li>
</ul>
<p>Jonathan Gray (2):</p>
<ul>
<li>configure.ac: use pkg-config for libelf</li>
<li>configure: check for python2.7 for PYTHON2</li>
</ul>
<p>Kenneth Graunke (5):</p>
<ul>
<li>ralloc: Fix ralloc_adopt() to the old context's last child's parent.</li>
<li>drirc: Disable ARB_blend_func_extended for Heaven 4.0/Valley 1.0.</li>
<li>glsl: Fix varying struct locations when varying packing is disabled.</li>
<li>nvc0: Set winding order regardless of domain.</li>
<li>nir: Add a lower_fdiv option, turn fdiv into fmul/frcp.</li>
</ul>
<p>Marek Olšák (7):</p>
<ul>
<li>tgsi/scan: add flag colors_written</li>
<li>r600g: write all MRTs only if there is exactly one output (fixes a hang)</li>
<li>radeonsi: don't call of u_prims_for_vertices for patches and rectangles</li>
<li>radeonsi: apply the streamout workaround to Fiji as well</li>
<li>gallium/radeon: fix Hyper-Z hangs by programming PA_SC_MODE_CNTL_1 correctly</li>
<li>program: add _mesa_reserve_parameter_storage</li>
<li>st/mesa: fix GLSL uniform updates for glBitmap &amp; glDrawPixels (v2)</li>
</ul>
<p>Mark Janes (1):</p>
<ul>
<li>Add missing platform information for KBL</li>
</ul>
<p>Miklós Máté (1):</p>
<ul>
<li>mesa: Don't leak ATIfs instructions in DeleteFragmentShader</li>
</ul>
<p>Neil Roberts (3):</p>
<ul>
<li>i965: Add MESA_FORMAT_B8G8R8X8_SRGB to brw_format_for_mesa_format</li>
<li>i965: Add B8G8R8X8_SRGB to the alpha format override</li>
<li>i965: Fix crash when calling glViewport with no surface bound</li>
</ul>
<p>Nicolai Hähnle (2):</p>
<ul>
<li>gallium/radeon: only dispose locally created target machine in radeon_llvm_compile</li>
<li>gallium/radeon: fix regression in a number of driver queries</li>
</ul>
<p>Oded Gabbay (1):</p>
<ul>
<li>configura.ac: fix test for SSE4.1 assembler support</li>
</ul>
<p>Patrick Rudolph (2):</p>
<ul>
<li>nv50,nvc0: fix use-after-free when vertex buffers are unbound</li>
<li>gallium/util: return correct number of bound vertex buffers</li>
</ul>
<p>Rob Herring (1):</p>
<ul>
<li>freedreno/ir3: fix 32-bit builds with pointer-to-int-cast error enabled</li>
</ul>
<p>Samuel Pitoiset (3):</p>
<ul>
<li>nvc0: free memory allocated by the prog which reads MP perf counters</li>
<li>nv50,nvc0: free memory allocated by performance metrics</li>
<li>nv50: free memory allocated by the prog which reads MP perf counters</li>
</ul>
<p>Sarah Sharp (1):</p>
<ul>
<li>mesa: Add KBL PCI IDs and platform information.</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,182 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 11.1.2 Release Notes / February 10, 2016</h1>
<p>
Mesa 11.1.2 is a bug fix release which fixes bugs found since the 11.1.1 release.
</p>
<p>
Mesa 11.1.2 implements the OpenGL 4.1 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 4.1. OpenGL
4.1 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
ba0e7462b2936b86e6684c26fbb55519f8d9ad31d13a1c1e1afbe41e73466eea mesa-11.1.2.tar.gz
8f72aead896b340ba0f7a4a474bfaf71681f5d675592aec1cb7ba698e319148b mesa-11.1.2.tar.xz
</pre>
<h2>New features</h2>
<p>None</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91596">Bug 91596</a> - EGL_KHR_gl_colorspace (v2) causes problem with Android-x86 GUI</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93628">Bug 93628</a> - Exception: attempt to use unavailable module DRM when building MesaGL 11.1.0 on windows</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93648">Bug 93648</a> - Random lines being rendered when playing Dolphin (geometry shaders related, w/ apitrace)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93650">Bug 93650</a> - GL_ARB_separate_shader_objects is buggy (PCSX2)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93717">Bug 93717</a> - Meta mipmap generation can corrupt texture state</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93722">Bug 93722</a> - Segfault when compiling shader with a subroutine that takes a parameter</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93731">Bug 93731</a> - glUniformSubroutinesuiv segfaults when subroutine uniform is bound to a specific location</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93761">Bug 93761</a> - A conditional discard in a fragment shader causes no depth writing at all</li>
</ul>
<h2>Changes</h2>
<p>Ben Widawsky (1):</p>
<ul>
<li>i965/bxt: Fix conservative wm thread counts.</li>
</ul>
<p>Dave Airlie (1):</p>
<ul>
<li>glsl: fix subroutine lowering reusing actual parmaters</li>
</ul>
<p>Emil Velikov (6):</p>
<ul>
<li>docs: add sha256 checksums for 11.1.1</li>
<li>cherry-ignore: drop the i965/kbl .num_slices patch</li>
<li>i915: correctly parse/set the context flags</li>
<li>targets/dri: android: use WHOLE static libraries</li>
<li>egl/dri2: expose srgb configs when KHR_gl_colorspace is available</li>
<li>Update version to 11.1.2</li>
</ul>
<p>Eric Anholt (2):</p>
<ul>
<li>vc4: Don't record the seqno of a failed job submit.</li>
<li>vc4: Throttle outstanding rendering after submission.</li>
</ul>
<p>François Tigeot (1):</p>
<ul>
<li>gallium: Add DragonFly support</li>
</ul>
<p>Grazvydas Ignotas (1):</p>
<ul>
<li>r600g: don't leak driver const buffers</li>
</ul>
<p>Ian Romanick (2):</p>
<ul>
<li>meta/blit: Restore GL_DEPTH_STENCIL_TEXTURE_MODE state for GL_TEXTURE_RECTANGLE</li>
<li>meta: Use internal functions to set texture parameters</li>
</ul>
<p>Ilia Mirkin (6):</p>
<ul>
<li>st/mesa: use surface format to generate mipmaps when available</li>
<li>glsl: always compute proper varying type, irrespective of varying packing</li>
<li>nvc0: avoid crashing when there are holes in vertex array bindings</li>
<li>nv50,nvc0: fix buffer clearing to respect engine alignment requirements</li>
<li>nv50/ir: fix false global CSE on instructions with multiple defs</li>
<li>st/mesa: treat a write as a read for range purposes</li>
</ul>
<p>Jason Ekstrand (3):</p>
<ul>
<li>i965/vec4: Use UW type for multiply into accumulator on GEN8+</li>
<li>i965/fs/generator: Take an actual shader stage rather than a string</li>
<li>i965/fs: Always set channel 2 of texture headers in some stages</li>
</ul>
<p>Jose Fonseca (2):</p>
<ul>
<li>scons: Conditionally use DRM module on pipe-loader.</li>
<li>pipe-loader: Fix PATH_MAX define on MSVC.</li>
</ul>
<p>Karol Herbst (1):</p>
<ul>
<li>nv50/ir: fix memory corruption when spilling and redoing RA</li>
</ul>
<p>Kenneth Graunke (2):</p>
<ul>
<li>glsl: Make bitfield_insert/extract and bfi/bfm non-vectorizable.</li>
<li>glsl: Allow implicit int -&gt; uint conversions for bitwise operators (&amp;, ^, |).</li>
</ul>
<p>Leo Liu (2):</p>
<ul>
<li>vl: add zig zag scan for list 4x4</li>
<li>st/omx/dec/h264: fix corruption when scaling matrix present flag set</li>
</ul>
<p>Marek Olšák (1):</p>
<ul>
<li>radeonsi: don't miss changes to SPI_TMPRING_SIZE</li>
</ul>
<p>Nicolai Hähnle (11):</p>
<ul>
<li>mesa/bufferobj: make _mesa_delete_buffer_object externally accessible</li>
<li>st/mesa: use _mesa_delete_buffer_object</li>
<li>radeon: use _mesa_delete_buffer_object</li>
<li>i915: use _mesa_delete_buffer_object</li>
<li>i965: use _mesa_delete_buffer_object</li>
<li>util/u_pstipple.c: copy immediates during transformation</li>
<li>radeonsi: extract the VGT_GS_MODE calculation into its own function</li>
<li>radeonsi: ensure that VGT_GS_MODE is sent when necessary</li>
<li>radeonsi: add DCC buffer for sampler views on new CS</li>
<li>st/mesa: use the correct address generation functions in st_TexSubImage blit</li>
<li>radeonsi: fix discard-only fragment shaders (11.1 version)</li>
</ul>
<p>Timothy Arceri (4):</p>
<ul>
<li>glsl: fix segfault linking subroutine uniform with explicit location</li>
<li>mesa: fix segfault in glUniformSubroutinesuiv()</li>
<li>glsl: fix interface block error message</li>
<li>glsl: create helper to remove outer vertex index array used by some stages</li>
</ul>
</div>
</body>
</html>

View File

@@ -1,85 +0,0 @@
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
<html lang="en">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<title>Mesa Release Notes</title>
<link rel="stylesheet" type="text/css" href="../mesa.css">
</head>
<body>
<div class="header">
<h1>The Mesa 3D Graphics Library</h1>
</div>
<iframe src="../contents.html"></iframe>
<div class="content">
<h1>Mesa 11.2.0 Release Notes / TBD</h1>
<p>
Mesa 11.2.0 is a new development release.
People who are concerned with stability and reliability should stick
with a previous release or wait for Mesa 11.2.1.
</p>
<p>
Mesa 11.2.0 implements the OpenGL 4.1 API, but the version reported by
glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 4.1. OpenGL
4.1 is <strong>only</strong> available if requested at context creation
because compatibility contexts are not supported.
</p>
<h2>SHA256 checksums</h2>
<pre>
TBD.
</pre>
<h2>New features</h2>
<p>
Note: some of the new features are only available with certain drivers.
</p>
<ul>
<li>GL_ARB_arrays_of_arrays on all gallium drivers that provide GLSL 1.30</li>
<li>GL_ARB_base_instance on freedreno/a4xx</li>
<li>GL_ARB_compute_shader on i965</li>
<li>GL_ARB_copy_image on r600</li>
<li>GL_ARB_indirect_parameters on nvc0</li>
<li>GL_ARB_query_buffer_object on nvc0</li>
<li>GL_ARB_shader_atomic_counters on nvc0</li>
<li>GL_ARB_shader_draw_parameters on i965, nvc0</li>
<li>GL_ARB_shader_storage_buffer_object on nvc0</li>
<li>GL_ARB_tessellation_shader on i965 and r600 (evergreen/cayman only)</li>
<li>GL_ARB_texture_buffer_object_rgb32 on freedreno/a4xx</li>
<li>GL_ARB_texture_buffer_range on freedreno/a4xx</li>
<li>GL_ARB_texture_query_lod on freedreno/a4xx</li>
<li>GL_ARB_texture_rgb10_a2ui on freedreno/a4xx</li>
<li>GL_ARB_texture_view on freedreno/a4xx</li>
<li>GL_ARB_vertex_type_10f_11f_11f_rev on freedreno/a4xx</li>
<li>GL_KHR_texture_compression_astc_ldr on freedreno/a4xx</li>
<li>GL_AMD_performance_monitor on radeonsi (CIK+ only)</li>
<li>GL_ATI_meminfo on r600, radeonsi</li>
<li>GL_NVX_gpu_memory_info on r600, radeonsi</li>
<li>New OSMesaCreateContextAttribs() function (for creating core profile
contexts)</li>
</ul>
<h2>Bug fixes</h2>
TBD.
<h2>Changes</h2>
Microsoft Visual Studio 2013 or later is now required for building
on Windows.
Previously, Visual Studio 2008 and later were supported.
TBD.
</div>
</body>
</html>

View File

@@ -1693,7 +1693,7 @@ bc644be551ed585fc4f66c16b64a91c9 MesaGLUT-7.10.tar.gz
<li>llvmpipe: Special case complementary and identify blend factors in SoA.</li>
<li>llvmpipe: Make rgb/alpha bland func/factors match, when there is no alpha.</li>
<li>draw: Prevent clipped vertices overflow.</li>
<li>draw: Fulfil the new min_lod/max_lod/lod_bias/border_color dynamic state</li>
<li>draw: Fullfil the new min_lod/max_lod/lod_bias/border_color dynamic state</li>
<li>gallivm: Fetch the lod from the dynamic state when min_lod == max_lod.</li>
<li>gallivm: Remove dead experimental code.</li>
<li>llvmpipe: Decouple sampler view and sampler state updates.</li>

View File

@@ -48,7 +48,7 @@ c49c19c2bbef4f3b7f1389974dff25f4 MesaGLUT-7.6.zip
<h2>New features</h2>
<ul>
<li>OpenVG front-end (state tracker for Gallium).
<li><a href="../openvg.html">OpenVG</a> front-end (state tracker for Gallium).
This was written by Zack Rusin at Tungsten Graphics.
<li>GL_ARB_vertex_array_object and GL_APPLE_vertex_array_object extensions
(supported in Gallium drivers, Intel DRI drivers, and software drivers)</li>

View File

@@ -63,20 +63,6 @@ execution. These are generally used for debugging.
Example: export MESA_GLSL=dump,nopt
</p>
<p>
Shaders can be dumped and replaced on runtime for debugging purposes. Mesa
needs to be configured with '--with-sha1' to enable this functionality. This
feature is not currently supported by SCons build.
This is controlled via following environment variables:
<ul>
<li><b>MESA_SHADER_DUMP_PATH</b> - path where shader sources are dumped
<li><b>MESA_SHADER_READ_PATH</b> - path where replacement shaders are read
</ul>
Note, path set must exist before running for dumping or replacing to work.
When both are set, these paths should be different so the dumped shaders do
not clobber the replacement shaders.
</p>
<h2 id="support">GLSL Version</h2>

View File

@@ -133,8 +133,10 @@ each directory.
<ul>
<li><b>clover</b> - OpenCL state tracker
<li><b>dri</b> - Meta state tracker for DRI drivers
<li><b>egl</b> - Meta state tracker for EGL drivers
<li><b>glx</b> - Meta state tracker for GLX
<li><b>vdpau</b> - VDPAU state tracker
<li><b>vega</b> - OpenVG 1.x state tracker
<li><b>wgl</b> -
<li><b>xorg</b> - Meta state tracker for Xorg video drivers
<li><b>xvmc</b> - XvMC state tracker

View File

@@ -1,176 +0,0 @@
Name
EXT_shader_samples_identical
Name Strings
GL_EXT_shader_samples_identical
Contact
Ian Romanick, Intel (ian.d.romanick 'at' intel.com)
Contributors
Chris Forbes, Mesa
Magnus Wendt, Intel
Neil S. Roberts, Intel
Graham Sellers, AMD
Status
XXX - Not complete yet.
Version
Last Modified Date: November 19, 2015
Revision: 6
Number
TBD
Dependencies
OpenGL 3.2, or OpenGL ES 3.1, or ARB_texture_multisample is required.
This extension is written against the OpenGL 4.5 (Core Profile)
Specification
Overview
Multisampled antialiasing has become a common method for improving the
quality of rendered images. Multisampling differs from supersampling in
that the color of a primitive that covers all or part of a pixel is
resolved once, regardless of the number of samples covered. If a large
polygon is rendered, the colors of all samples in each interior pixel will
be the same. This suggests a simple compression scheme that can reduce
the necessary memory bandwidth requirements. In one such scheme, each
sample is stored in a separate slice of the multisample surface. An
additional multisample control surface (MCS) contains a mapping from pixel
samples to slices.
If all the values stored in the MCS for a particular pixel are the same,
then all the samples have the same value. Applications can take advantage
of this information to reduce the bandwidth of reading multisample
textures. A custom multisample resolve filter could optimize resolving
pixels where every sample is identical by reading the color once.
color = texelFetch(sampler, coordinate, 0);
if (!textureSamplesIdenticalEXT(sampler, coordinate)) {
for (int i = 1; i < MAX_SAMPLES; i++) {
vec4 c = texelFetch(sampler, coordinate, i);
//... accumulate c into color
}
}
New Procedures and Functions
None.
New Tokens
None.
Additions to the OpenGL 4.5 (Core Profile) Specification
None.
Modifications to The OpenGL Shading Language Specification, Version 4.50.5
Including the following line in a shader can be used to control the
language features described in this extension:
#extension GL_EXT_shader_samples_identical
A new preprocessor #define is added to the OpenGL Shading Language:
#define GL_EXT_shader_samples_identical
Add to the table in section 8.7 "Texture Lookup Functions"
Syntax:
bool textureSamplesIdenticalEXT(gsampler2DMS sampler, ivec2 coord)
bool textureSamplesIdenticalEXT(gsampler2DMSArray sampler,
ivec3 coord)
Description:
Returns true if it can be determined that all samples within the texel
of the multisample texture bound to <sampler> at <coord> contain the
same values or false if this cannot be determined."
Additions to the AGL/EGL/GLX/WGL Specifications
None
Errors
None
New State
None
New Implementation Dependent State
None
Issues
1) What should the new functions be called?
RESOLVED: textureSamplesIdenticalEXT. Initially
textureAllSamplesIdenticalEXT was considered, but
textureSamplesIdenticalEXT is more similar to the existing textureSamples
function.
2) It seems like applications could implement additional optimization if
they were provided with raw MCS data. Should this extension also
provide that data?
There are a number of challenges in providing raw MCS data. The biggest
problem being that the amount of MCS data depends on the number of
samples, and that is not known at compile time. Additionally, without new
texelFetch functions, applications would have difficulty utilizing the
information.
Another option is to have a function that returns an array of tuples of
sample number and count. This also has difficulties with the maximum
array size not being known at compile time.
RESOLVED: Do not expose raw MCS data in this extension.
3) Should this extension also extend SPIR-V?
RESOLVED: Yes, but this has not yet been written.
4) Is it possible for textureSamplesIdenticalEXT to report false negatives?
RESOLVED: Yes. It is possible that the underlying hardware may not detect
that separate writes of the same color to different samples of a pixel are
the same. The shader function is at the whim of the underlying hardware
implementation. It is also possible that a compressed multisample surface
is not used. In that case the function will likely always return false.
Revision History
Rev Date Author Changes
--- ---------- -------- ---------------------------------------------
1 2014/08/20 cforbes Initial version
2 2015/10/23 idr Change from MESA to EXT. Rebase on OpenGL 4.5,
and add dependency on OpenGL ES 3.1. Initial
draft of overview section and issues 1 through
3.
3 2015/10/27 idr Typo fixes.
4 2015/11/10 idr Rename extension from EXT_shader_multisample_compression
to EXT_shader_samples_identical.
Add issue #4.
5 2015/11/18 idr Fix some typos spotted by gsellers. Change the
name of the name of the function to
textureSamplesIdenticalEXT.
6 2015/11/19 idr Fix more typos spotted by Nicolai Hähnle.

View File

@@ -1,147 +0,0 @@
Name
MESA_image_dma_buf_export
Name Strings
EGL_MESA_image_dma_buf_export
Contributors
Dave Airlie
Contact
Dave Airlie (airlied 'at' redhat 'dot' com)
Status
Complete, shipping.
Version
Version 3, May 5, 2015
Number
EGL Extension #87
Dependencies
Requires EGL 1.4 or later. This extension is written against the
wording of the EGL 1.4 specification.
EGL_KHR_base_image is required.
The EGL implementation must be running on a Linux kernel supporting the
dma_buf buffer sharing mechanism.
Overview
This extension provides entry points for integrating EGLImage with the
dma-buf infrastructure. The extension allows creating a Linux dma_buf
file descriptor or multiple file descriptors, in the case of multi-plane
YUV image, from an EGLImage.
It is designed to provide the complementary functionality to
EGL_EXT_image_dma_buf_import.
IP Status
Open-source; freely implementable.
New Types
This extension uses the 64-bit unsigned integer type EGLuint64KHR
first introduced by the EGL_KHR_stream extension, but does not
depend on that extension. The typedef may be reproduced separately
for this extension, if not already present in eglext.h.
typedef khronos_uint64_t EGLuint64KHR;
New Procedures and Functions
EGLBoolean eglExportDMABUFImageQueryMESA(EGLDisplay dpy,
EGLImageKHR image,
int *fourcc,
int *num_planes,
EGLuint64KHR *modifiers);
EGLBoolean eglExportDMABUFImageMESA(EGLDisplay dpy,
EGLImageKHR image,
int *fds,
EGLint *strides,
EGLint *offsets);
New Tokens
None
Additions to the EGL 1.4 Specification:
To mirror the import extension, this extension attempts to return
enough information to enable an exported dma-buf to be imported
via eglCreateImageKHR and EGL_LINUX_DMA_BUF_EXT token.
Retrieving the information is a two step process, so two APIs
are required.
The first entrypoint
EGLBoolean eglExportDMABUFImageQueryMESA(EGLDisplay dpy,
EGLImageKHR image,
int *fourcc,
int *num_planes,
EGLuint64KHR *modifiers);
is used to retrieve the pixel format of the buffer, as specified by
drm_fourcc.h, the number of planes in the image and the Linux
drm modifiers. <fourcc>, <num_planes> and <modifiers> may be NULL,
in which case no value is retrieved.
The second entrypoint retrieves the dma_buf file descriptors,
strides and offsets for the image. The caller should pass
arrays sized according to the num_planes values retrieved previously.
Passing arrays of the wrong size will have undefined results.
If the number of fds is less than the number of planes, then
subsequent fd slots should contain -1.
EGLBoolean eglExportDMABUFImageMESA(EGLDisplay dpy,
EGLImageKHR image,
int *fds,
EGLint *strides,
EGLint *offsets);
<fds>, <strides>, <offsets> can be NULL if the infomatation isn't
required by the caller.
Issues
1. Should the API look more like an attribute getting API?
ANSWER: No, from a user interface pov, having to iterate across calling
the API up to 12 times using attribs seems like the wrong solution.
2. Should the API take a plane and just get the fd/stride/offset for that
plane?
ANSWER: UNKNOWN,this might be just as valid an API.
3. Does ownership of the file descriptor remain with the app?
ANSWER: Yes, the app is responsible for closing any fds retrieved.
4. If number of planes and number of fds differ what should we do?
ANSWER: Return -1 for the secondary slots, as this avoids having
to dup the fd extra times to make the interface sane.
Revision History
Version 3, May, 2015
Just use the KHR 64-bit type.
Version 2, March, 2015
Add a query interface (Dave Airlie)
Version 1, June 3, 2014
Initial draft (Dave Airlie)

View File

@@ -42,7 +42,9 @@ Tungsten Graphics, Inc. have supported the ongoing development of Mesa.
<li>The
<a href="http://www.mesa3d.org">Mesa</a>
website is hosted by
<a href="http://sourceforge.net">sourceforge.net</a>.
<a href="http://sourceforge.net">
<img src="http://sourceforge.net/sflogo.php?group_id=3&amp;type=1"
width="88" height="31" align="bottom" alt="Sourceforge.net" border="0"></a>
<br>
<br>

View File

@@ -30,10 +30,6 @@
<dt><a href="http://www.valgrind.org">Valgrind</a></dt>
<dd>is a very useful tool for tracking down
memory-related problems in your code.</dd>
<dt><a href="http:scan.coverity.com/projects/mesa">Coverity</a><dt>
<dd>provides static code analysis of Mesa. If you create an account
you can see the results and try to fix outstanding issues.</dd>
</dl>
</div>

View File

@@ -150,7 +150,7 @@ New features:
Changes:
<ul>
<li>renamed aux.h as glaux.h (MS-DOS names can't start with aux)
<li>most filenames are in 8.3 format to accommodate MS-DOS
<li>most filenames are in 8.3 format to accomodate MS-DOS
<li>use GLubytes to store arrays of colors instead of GLints
</ul>
@@ -1224,7 +1224,7 @@ Bug fixes:
</ul>
Changes:
<ul>
<li>max texture units reduced to six to accommodate texture rectangles
<li>max texture units reduced to six to accomodate texture rectangles
<li>removed unfinished GL_MESA_sprite_point extension code
</ul>

View File

@@ -19,7 +19,6 @@
<p>
This page lists known issues with
<a href="http://www.spec.org/gwpg/gpc.static/vp11info.html" target="_main">SPEC Viewperf 11</a>
and <a href="https://www.spec.org/gwpg/gpc.static/vp12info.html" target="_main">SPEC Viewperf 12</a>
when running on Mesa-based drivers.
</p>
@@ -41,15 +40,13 @@ These issues have been reported to the SPEC organization in the hope that
they'll be fixed in the future.
</p>
<h2><u>Viewperf 11</u></h2>
<p>
Some of the Viewperf 11 tests use a lot of memory.
Some of the Viewperf tests use a lot of memory.
At least 2GB of RAM is recommended.
</p>
<h3>Catia-03 test 2</h3>
<h2>Catia-03 test 2</h2>
<p>
This test creates over 38000 vertex buffer objects. On some systems
@@ -62,7 +59,7 @@ either in Viewperf or the Mesa driver.
<h3>Catia-03 tests 3, 4, 8</h3>
<h2>Catia-03 tests 3, 4, 8</h2>
<p>
These tests use features of the
@@ -82,7 +79,7 @@ Subsequent drawing calls become no-ops and the rendering is incorrect.
<h3>sw-02 tests 1, 2, 4, 6</h3>
<h2>sw-02 tests 1, 2, 4, 6</h2>
<p>
These tests depend on the
@@ -102,7 +99,7 @@ color. This is probably due to some uninitialized state somewhere.
<h3>sw-02 test 6</h3>
<h2>sw-02 test 6</h2>
<p>
The lines drawn in this test appear in a random color.
@@ -114,7 +111,7 @@ situation, we get a random color.
<h3>Lightwave-01 test 3</h3>
<h2>Lightwave-01 test 3</h2>
<p>
This test uses a number of mipmapped textures, but the textures are
@@ -175,7 +172,7 @@ However, we have no plans to implement this work-around in Mesa.
</p>
<h3>Maya-03 test 2</h3>
<h2>Maya-03 test 2</h2>
<p>
This test makes some unusual calls to glRotate. For example:
@@ -207,7 +204,7 @@ and with a semi-random color (between white and black) since GL_FOG is enabled.
</p>
<h3>Proe-05 test 1</h3>
<h2>Proe-05 test 1</h2>
<p>
This uses depth testing but there's two problems:
@@ -235,7 +232,7 @@ glClear is called so clearing the depth buffer would be a no-op anyway.
</p>
<h3>Proe-05 test 6</h3>
<h2>Proe-05 test 6</h2>
<p>
This test draws an engine model with a two-pass algorithm.
@@ -264,86 +261,6 @@ blending with appropriate patterns/modes to ensure the same fragments
are produced in both passes.
</p>
<h2><u>Viewperf 12</u></h2>
<p>
Note that Viewperf 12 only runs on 64-bit Windows 7 or later.
</p>
<h3>catia-04</h3>
<p>
One of the catia tests calls wglGetProcAddress() to get some
GL_EXT_direct_state_access functions (such as glBindMultiTextureEXT) and some
GL_NV_half_float functions (such as glMultiTexCoord3hNV).
If the extension/function is not supported, wglGetProcAddress() can return NULL.
Unfortunately, Viewperf doesn't check for null pointers and crashes when it
later tries to use the pointer.
</p>
<p>
Another catia test uses OpenGL 3.1's primitive restart feature.
But when Viewperf creates an OpenGL context, it doesn't request version 3.1
If the driver returns version 3.0 or earlier all the calls related to primitive
restart generate an OpenGL error.
Some of the rendering is then incorrect.
</p>
<h3>energy-01</h3>
<p>
This test creates a 3D luminance texture of size 1K x 1K x 1K.
If the OpenGL driver/device doesn't support a texture of this size
the glTexImage3D() call will fail with GL_INVALID_VALUE or GL_OUT_OF_MEMORY
and all that's rendered is plain white polygons.
Ideally, the test would use a proxy texture to determine the max 3D
texture size. But it does not do that.
</p>
<h3>maya-04</h3>
<p>
This test generates many GL_INVALID_OPERATION errors in its calls to
glUniform().
Causes include:
<ul>
<li> Trying to set float uniforms with glUniformi()
<li> Trying to set float uniforms with glUniform3f()
<li> Trying to set matrix uniforms with glUniform() instead of glUniformMatrix().
</ul>
<p>
Apparently, the indexes returned by glGetUniformLocation() were hard-coded
into the application trace when it was created.
Since different implementations of glGetUniformLocation() may return different
values for any given uniform name, subsequent calls to glUniform() will be
invalid since they refer to the wrong uniform variables.
This causes many OpenGL errors and leads to incorrect rendering.
</p>
<h3>medical-01</h3>
<p>
This test uses a single GLSL fragment shader which contains a GLSL 1.20
array initializer statement, but it neglects to specify
<code>#version 120</code> at the top of the shader code.
So, the shader does not compile and all that's rendered is plain white polygons.
</p>
<p>
Also, the test tries to create a very large 3D texture that may exceed
the device driver's limit.
When this happens, the glTexImage3D call fails and all that's rendered is
a white box.
</p>
<h3>showcase-01</h3>
<p>
This is actually a DX11 test based on Autodesk's Showcase product.
As such, it won't run with Mesa.
</p>
</div>
</body>

View File

@@ -26,31 +26,6 @@ VMware Workstation running on Linux or Windows and VMware Fusion running on
MacOS are all supported.
</p>
<p>
With the August 2015 Workstation 12 / Fusion 8 releases, OpenGL 3.3
is supported in the guest.
This requires:
<ul>
<li>The VM is configured for virtual hardware version 12.
<li>The host OS, GPU and graphics driver supports DX11 (Windows) or
OpenGL 4.0 (Linux, Mac)
<li>On Linux, the vmwgfx kernel module must be version 2.9.0 or later.
<li>A recent version of Mesa with the updated svga gallium driver.
</ul>
</p>
<p>
Otherwise, OpenGL 2.1 is supported.
</p>
<p>
OpenGL 3.3 support can be disabled by setting the environment variable
SVGA_VGPU10=0.
You will then have OpenGL 2.1 support.
This may be useful to work around application bugs (such as incorrect use
of the OpenGL 3.x core profile).
</p>
<p>
Most modern Linux distros include the SVGA3D driver so end users shouldn't
be concerned with this information.
@@ -148,33 +123,10 @@ To get the latest code from git:
<h2>Building the Code</h2>
<ul>
<li>
Determine where the GL-related libraries reside on your system and set
the LIBDIR environment variable accordingly.
<br><br>
For 32-bit Ubuntu systems:
<pre>
export LIBDIR=/usr/lib/i386-linux-gnu
</pre>
For 64-bit Ubuntu systems:
<pre>
export LIBDIR=/usr/lib/x86_64-linux-gnu
</pre>
For 32-bit Fedora systems:
<pre>
export LIBDIR=/usr/lib
</pre>
For 64-bit Fedora systems:
<pre>
export LIBDIR=/usr/lib64
</pre>
</li>
<li>Build libdrm:
<li>Build libdrm: If you're on a 32-bit system, you should skip the --libdir configure option. Note also the comment about toolchain libdrm above.
<pre>
cd $TOP/drm
./autogen.sh --prefix=/usr --libdir=${LIBDIR}
./autogen.sh --prefix=/usr --libdir=/usr/lib64
make
sudo make install
</pre>
@@ -185,9 +137,12 @@ The libxatracker library is used exclusively by the X server to do render,
copy and video acceleration:
<br>
The following configure options doesn't build the EGL system.
<br>
As before, if you're on a 32-bit system, you should skip the --libdir
configure option.
<pre>
cd $TOP/mesa
./autogen.sh --prefix=/usr --libdir=${LIBDIR} --with-gallium-drivers=svga --with-dri-drivers=swrast --enable-xa --disable-dri3 --enable-glx-tls
./autogen.sh --prefix=/usr --libdir=/usr/lib64 --with-gallium-drivers=svga --with-dri-drivers= --enable-xa --disable-dri3
make
sudo make install
</pre>
@@ -197,39 +152,25 @@ if they're not installed in your system. You should be told what's missing.
<br>
<br>
<li>xf86-video-vmware: Now, once libxatracker is installed, we proceed with
building and replacing the current Xorg driver.
First check if your system is 32- or 64-bit.
<li>xf86-video-vmware: Now, once libxatracker is installed, we proceed with building and replacing the current Xorg driver. First check if your system is 32- or 64-bit. If you're building for a 32-bit system, you will not be needing the --libdir=/usr/lib64 option to autogen.
<pre>
cd $TOP/xf86-video-vmware
./autogen.sh --prefix=/usr --libdir=${LIBDIR}
./autogen.sh --prefix=/usr --libdir=/usr/lib64
make
sudo make install
</pre>
<li>vmwgfx kernel module. First make sure that any old version of this kernel module is removed from the system by issuing
<pre>
<pre>
sudo rm /lib/modules/`uname -r`/kernel/drivers/gpu/drm/vmwgfx.ko*
</pre>
Build and install:
<pre>
</pre>
Then
<pre>
cd $TOP/vmwgfx
make
sudo make install
sudo depmod -a
</pre>
If you're using a Ubuntu OS:
<pre>
sudo update-initramfs -u
</pre>
If you're using a Fedora OS:
<pre>
sudo dracut --force
</pre>
Add 'vmwgfx' to the /etc/modules file:
<pre>
echo vmwgfx | sudo tee -a /etc/modules
</pre>
sudo cp 00-vmwgfx.rules /etc/udev/rules.d
sudo depmod -ae
</pre>
Note: some distros put DRM kernel drivers in different directories.
For example, sometimes vmwgfx.ko might be found in
@@ -286,16 +227,6 @@ If you don't see this, try setting this environment variable:
then rerun glxinfo and examine the output for error messages.
</p>
<p>
If OpenGL 3.3 is not working (you only get OpenGL 2.1):
</p>
<ul>
<li>Make sure the VM uses hardware version 12.
<li>Make sure the vmwgfx kernel module is version 2.9.0 or later.
<li>Check the vmware.log file for errors.
<li>Run 'dmesg | grep vmwgfx' and look for "DX: yes".
</div>
</body>
</html>

1
doxygen/.gitignore vendored
View File

@@ -1,4 +1,3 @@
*.db
*.tag
*.tmp
agpgart

View File

@@ -33,4 +33,3 @@ subset: $(SUBSET:.doxy=.tag)
clean:
-rm -rf $(FULL:.doxy=) $(SUBSET:.doxy=)
-rm -rf *.tag
-rm -rf *.db

View File

@@ -50,7 +50,6 @@
#define E_OUTOFMEMORY MAKE_HRESULT(1, 0x007, 14)
#define E_NOINTERFACE MAKE_HRESULT(1, 0x000, 0x4002)
#define E_POINTER MAKE_HRESULT(1, 0x000, 0x4003)
#define E_FAIL MAKE_HRESULT(1, 0x000, 0x4005)
#define S_OK ((HRESULT)0)
#define S_FALSE ((HRESULT)1)
@@ -227,7 +226,6 @@ typedef struct _RGNDATA {
#define D3DERR_DRIVERINVALIDCALL MAKE_D3DHRESULT(2157)
#define D3DERR_DEVICEREMOVED MAKE_D3DHRESULT(2160)
#define D3DERR_DEVICEHUNG MAKE_D3DHRESULT(2164)
#define S_PRESENT_OCCLUDED MAKE_D3DSTATUS(2168)
/********************************************************
* Bitmasks *
@@ -473,7 +471,6 @@ typedef enum _D3DBUSTYPE {
} D3DBUSTYPE;
typedef enum _D3DCMPFUNC {
D3DCMP_NEVER_ZERO = 0, //Needed to avoid warnings
D3DCMP_NEVER = 1,
D3DCMP_LESS = 2,
D3DCMP_EQUAL = 3,
@@ -574,7 +571,6 @@ typedef enum _D3DDEVTYPE {
} D3DDEVTYPE;
typedef enum _D3DFILLMODE {
D3DFILL_SOLID_ZERO = 0,
D3DFILL_POINT = 1,
D3DFILL_WIREFRAME = 2,
D3DFILL_SOLID = 3
@@ -655,7 +651,6 @@ typedef enum _D3DFORMAT {
D3DFMT_BINARYBUFFER = 199,
D3DFMT_ATI1 = MAKEFOURCC('A', 'T', 'I', '1'),
D3DFMT_ATI2 = MAKEFOURCC('A', 'T', 'I', '2'),
D3DFMT_ATOC = MAKEFOURCC('A', 'T', 'O', 'C'),
D3DFMT_DF16 = MAKEFOURCC('D', 'F', '1', '6'),
D3DFMT_DF24 = MAKEFOURCC('D', 'F', '2', '4'),
D3DFMT_INTZ = MAKEFOURCC('I', 'N', 'T', 'Z'),
@@ -663,7 +658,6 @@ typedef enum _D3DFORMAT {
D3DFMT_NVDB = MAKEFOURCC('N', 'V', 'D', 'B'),
D3DFMT_NV11 = MAKEFOURCC('N', 'V', '1', '1'),
D3DFMT_NV12 = MAKEFOURCC('N', 'V', '1', '2'),
D3DFMT_RESZ = MAKEFOURCC('R', 'E', 'S', 'Z'),
D3DFMT_Y210 = MAKEFOURCC('Y', '2', '1', '0'),
D3DFMT_Y216 = MAKEFOURCC('Y', '2', '1', '6'),
D3DFMT_Y410 = MAKEFOURCC('Y', '4', '1', '0')

View File

@@ -1,12 +1,11 @@
#ifndef __egl_h_
#define __egl_h_ 1
#ifdef __cplusplus
extern "C" {
#endif
/* -*- mode: c; tab-width: 8; -*- */
/* vi: set sw=4 ts=8: */
/* Reference version of egl.h for EGL 1.4.
* $Revision: 9356 $ on $Date: 2009-10-21 02:52:25 -0700 (Wed, 21 Oct 2009) $
*/
/*
** Copyright (c) 2013-2014 The Khronos Group Inc.
** Copyright (c) 2007-2009 The Khronos Group Inc.
**
** Permission is hereby granted, free of charge, to any person obtaining a
** copy of this software and/or associated documentation files (the
@@ -27,277 +26,304 @@ extern "C" {
** TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS.
*/
/*
** This header is generated from the Khronos OpenGL / OpenGL ES XML
** API Registry. The current version of the Registry, generator scripts
** used to make the header, and the header can be found at
** http://www.opengl.org/registry/
**
** Khronos $Revision: 31039 $ on $Date: 2015-05-04 17:01:57 -0700 (Mon, 04 May 2015) $
*/
#ifndef __egl_h_
#define __egl_h_
/* All platform-dependent types and macro boilerplate (such as EGLAPI
* and EGLAPIENTRY) should go in eglplatform.h.
*/
#include <EGL/eglplatform.h>
/* Generated on date 20150504 */
#ifdef __cplusplus
extern "C" {
#endif
/* Generated C header for:
* API: egl
* Versions considered: .*
* Versions emitted: .*
* Default extensions included: None
* Additional extensions included: _nomatch_^
* Extensions removed: _nomatch_^
/* EGL Types */
/* EGLint is defined in eglplatform.h */
typedef unsigned int EGLBoolean;
typedef unsigned int EGLenum;
typedef void *EGLConfig;
typedef void *EGLContext;
typedef void *EGLDisplay;
typedef void *EGLSurface;
typedef void *EGLClientBuffer;
/* EGL Versioning */
#define EGL_VERSION_1_0 1
#define EGL_VERSION_1_1 1
#define EGL_VERSION_1_2 1
#define EGL_VERSION_1_3 1
#define EGL_VERSION_1_4 1
/* EGL Enumerants. Bitmasks and other exceptional cases aside, most
* enums are assigned unique values starting at 0x3000.
*/
#ifndef EGL_VERSION_1_0
#define EGL_VERSION_1_0 1
typedef unsigned int EGLBoolean;
typedef void *EGLDisplay;
#include <KHR/khrplatform.h>
#include <EGL/eglplatform.h>
typedef void *EGLConfig;
typedef void *EGLSurface;
typedef void *EGLContext;
/* EGL aliases */
#define EGL_FALSE 0
#define EGL_TRUE 1
/* Out-of-band handle values */
#define EGL_DEFAULT_DISPLAY ((EGLNativeDisplayType)0)
#define EGL_NO_CONTEXT ((EGLContext)0)
#define EGL_NO_DISPLAY ((EGLDisplay)0)
#define EGL_NO_SURFACE ((EGLSurface)0)
/* Out-of-band attribute value */
#define EGL_DONT_CARE ((EGLint)-1)
/* Errors / GetError return values */
#define EGL_SUCCESS 0x3000
#define EGL_NOT_INITIALIZED 0x3001
#define EGL_BAD_ACCESS 0x3002
#define EGL_BAD_ALLOC 0x3003
#define EGL_BAD_ATTRIBUTE 0x3004
#define EGL_BAD_CONFIG 0x3005
#define EGL_BAD_CONTEXT 0x3006
#define EGL_BAD_CURRENT_SURFACE 0x3007
#define EGL_BAD_DISPLAY 0x3008
#define EGL_BAD_MATCH 0x3009
#define EGL_BAD_NATIVE_PIXMAP 0x300A
#define EGL_BAD_NATIVE_WINDOW 0x300B
#define EGL_BAD_PARAMETER 0x300C
#define EGL_BAD_SURFACE 0x300D
#define EGL_CONTEXT_LOST 0x300E /* EGL 1.1 - IMG_power_management */
/* Reserved 0x300F-0x301F for additional errors */
/* Config attributes */
#define EGL_BUFFER_SIZE 0x3020
#define EGL_ALPHA_SIZE 0x3021
#define EGL_BLUE_SIZE 0x3022
#define EGL_GREEN_SIZE 0x3023
#define EGL_RED_SIZE 0x3024
#define EGL_DEPTH_SIZE 0x3025
#define EGL_STENCIL_SIZE 0x3026
#define EGL_CONFIG_CAVEAT 0x3027
#define EGL_CONFIG_ID 0x3028
#define EGL_LEVEL 0x3029
#define EGL_MAX_PBUFFER_HEIGHT 0x302A
#define EGL_MAX_PBUFFER_PIXELS 0x302B
#define EGL_MAX_PBUFFER_WIDTH 0x302C
#define EGL_NATIVE_RENDERABLE 0x302D
#define EGL_NATIVE_VISUAL_ID 0x302E
#define EGL_NATIVE_VISUAL_TYPE 0x302F
#define EGL_SAMPLES 0x3031
#define EGL_SAMPLE_BUFFERS 0x3032
#define EGL_SURFACE_TYPE 0x3033
#define EGL_TRANSPARENT_TYPE 0x3034
#define EGL_TRANSPARENT_BLUE_VALUE 0x3035
#define EGL_TRANSPARENT_GREEN_VALUE 0x3036
#define EGL_TRANSPARENT_RED_VALUE 0x3037
#define EGL_NONE 0x3038 /* Attrib list terminator */
#define EGL_BIND_TO_TEXTURE_RGB 0x3039
#define EGL_BIND_TO_TEXTURE_RGBA 0x303A
#define EGL_MIN_SWAP_INTERVAL 0x303B
#define EGL_MAX_SWAP_INTERVAL 0x303C
#define EGL_LUMINANCE_SIZE 0x303D
#define EGL_ALPHA_MASK_SIZE 0x303E
#define EGL_COLOR_BUFFER_TYPE 0x303F
#define EGL_RENDERABLE_TYPE 0x3040
#define EGL_MATCH_NATIVE_PIXMAP 0x3041 /* Pseudo-attribute (not queryable) */
#define EGL_CONFORMANT 0x3042
/* Reserved 0x3041-0x304F for additional config attributes */
/* Config attribute values */
#define EGL_SLOW_CONFIG 0x3050 /* EGL_CONFIG_CAVEAT value */
#define EGL_NON_CONFORMANT_CONFIG 0x3051 /* EGL_CONFIG_CAVEAT value */
#define EGL_TRANSPARENT_RGB 0x3052 /* EGL_TRANSPARENT_TYPE value */
#define EGL_RGB_BUFFER 0x308E /* EGL_COLOR_BUFFER_TYPE value */
#define EGL_LUMINANCE_BUFFER 0x308F /* EGL_COLOR_BUFFER_TYPE value */
/* More config attribute values, for EGL_TEXTURE_FORMAT */
#define EGL_NO_TEXTURE 0x305C
#define EGL_TEXTURE_RGB 0x305D
#define EGL_TEXTURE_RGBA 0x305E
#define EGL_TEXTURE_2D 0x305F
/* Config attribute mask bits */
#define EGL_PBUFFER_BIT 0x0001 /* EGL_SURFACE_TYPE mask bits */
#define EGL_PIXMAP_BIT 0x0002 /* EGL_SURFACE_TYPE mask bits */
#define EGL_WINDOW_BIT 0x0004 /* EGL_SURFACE_TYPE mask bits */
#define EGL_VG_COLORSPACE_LINEAR_BIT 0x0020 /* EGL_SURFACE_TYPE mask bits */
#define EGL_VG_ALPHA_FORMAT_PRE_BIT 0x0040 /* EGL_SURFACE_TYPE mask bits */
#define EGL_MULTISAMPLE_RESOLVE_BOX_BIT 0x0200 /* EGL_SURFACE_TYPE mask bits */
#define EGL_SWAP_BEHAVIOR_PRESERVED_BIT 0x0400 /* EGL_SURFACE_TYPE mask bits */
#define EGL_OPENGL_ES_BIT 0x0001 /* EGL_RENDERABLE_TYPE mask bits */
#define EGL_OPENVG_BIT 0x0002 /* EGL_RENDERABLE_TYPE mask bits */
#define EGL_OPENGL_ES2_BIT 0x0004 /* EGL_RENDERABLE_TYPE mask bits */
#define EGL_OPENGL_BIT 0x0008 /* EGL_RENDERABLE_TYPE mask bits */
/* QueryString targets */
#define EGL_VENDOR 0x3053
#define EGL_VERSION 0x3054
#define EGL_EXTENSIONS 0x3055
#define EGL_CLIENT_APIS 0x308D
/* QuerySurface / SurfaceAttrib / CreatePbufferSurface targets */
#define EGL_HEIGHT 0x3056
#define EGL_WIDTH 0x3057
#define EGL_LARGEST_PBUFFER 0x3058
#define EGL_TEXTURE_FORMAT 0x3080
#define EGL_TEXTURE_TARGET 0x3081
#define EGL_MIPMAP_TEXTURE 0x3082
#define EGL_MIPMAP_LEVEL 0x3083
#define EGL_RENDER_BUFFER 0x3086
#define EGL_VG_COLORSPACE 0x3087
#define EGL_VG_ALPHA_FORMAT 0x3088
#define EGL_HORIZONTAL_RESOLUTION 0x3090
#define EGL_VERTICAL_RESOLUTION 0x3091
#define EGL_PIXEL_ASPECT_RATIO 0x3092
#define EGL_SWAP_BEHAVIOR 0x3093
#define EGL_MULTISAMPLE_RESOLVE 0x3099
/* EGL_RENDER_BUFFER values / BindTexImage / ReleaseTexImage buffer targets */
#define EGL_BACK_BUFFER 0x3084
#define EGL_SINGLE_BUFFER 0x3085
/* OpenVG color spaces */
#define EGL_VG_COLORSPACE_sRGB 0x3089 /* EGL_VG_COLORSPACE value */
#define EGL_VG_COLORSPACE_LINEAR 0x308A /* EGL_VG_COLORSPACE value */
/* OpenVG alpha formats */
#define EGL_VG_ALPHA_FORMAT_NONPRE 0x308B /* EGL_ALPHA_FORMAT value */
#define EGL_VG_ALPHA_FORMAT_PRE 0x308C /* EGL_ALPHA_FORMAT value */
/* Constant scale factor by which fractional display resolutions &
* aspect ratio are scaled when queried as integer values.
*/
#define EGL_DISPLAY_SCALING 10000
/* Unknown display resolution/aspect ratio */
#define EGL_UNKNOWN ((EGLint)-1)
/* Back buffer swap behaviors */
#define EGL_BUFFER_PRESERVED 0x3094 /* EGL_SWAP_BEHAVIOR value */
#define EGL_BUFFER_DESTROYED 0x3095 /* EGL_SWAP_BEHAVIOR value */
/* CreatePbufferFromClientBuffer buffer types */
#define EGL_OPENVG_IMAGE 0x3096
/* QueryContext targets */
#define EGL_CONTEXT_CLIENT_TYPE 0x3097
/* CreateContext attributes */
#define EGL_CONTEXT_CLIENT_VERSION 0x3098
/* Multisample resolution behaviors */
#define EGL_MULTISAMPLE_RESOLVE_DEFAULT 0x309A /* EGL_MULTISAMPLE_RESOLVE value */
#define EGL_MULTISAMPLE_RESOLVE_BOX 0x309B /* EGL_MULTISAMPLE_RESOLVE value */
/* BindAPI/QueryAPI targets */
#define EGL_OPENGL_ES_API 0x30A0
#define EGL_OPENVG_API 0x30A1
#define EGL_OPENGL_API 0x30A2
/* GetCurrentSurface targets */
#define EGL_DRAW 0x3059
#define EGL_READ 0x305A
/* WaitNative engines */
#define EGL_CORE_NATIVE_ENGINE 0x305B
/* EGL 1.2 tokens renamed for consistency in EGL 1.3 */
#define EGL_COLORSPACE EGL_VG_COLORSPACE
#define EGL_ALPHA_FORMAT EGL_VG_ALPHA_FORMAT
#define EGL_COLORSPACE_sRGB EGL_VG_COLORSPACE_sRGB
#define EGL_COLORSPACE_LINEAR EGL_VG_COLORSPACE_LINEAR
#define EGL_ALPHA_FORMAT_NONPRE EGL_VG_ALPHA_FORMAT_NONPRE
#define EGL_ALPHA_FORMAT_PRE EGL_VG_ALPHA_FORMAT_PRE
/* EGL extensions must request enum blocks from the Khronos
* API Registrar, who maintains the enumerant registry. Submit
* a bug in Khronos Bugzilla against task "Registry".
*/
/* EGL Functions */
EGLAPI EGLint EGLAPIENTRY eglGetError(void);
EGLAPI EGLDisplay EGLAPIENTRY eglGetDisplay(EGLNativeDisplayType display_id);
EGLAPI EGLBoolean EGLAPIENTRY eglInitialize(EGLDisplay dpy, EGLint *major, EGLint *minor);
EGLAPI EGLBoolean EGLAPIENTRY eglTerminate(EGLDisplay dpy);
EGLAPI const char * EGLAPIENTRY eglQueryString(EGLDisplay dpy, EGLint name);
EGLAPI EGLBoolean EGLAPIENTRY eglGetConfigs(EGLDisplay dpy, EGLConfig *configs,
EGLint config_size, EGLint *num_config);
EGLAPI EGLBoolean EGLAPIENTRY eglChooseConfig(EGLDisplay dpy, const EGLint *attrib_list,
EGLConfig *configs, EGLint config_size,
EGLint *num_config);
EGLAPI EGLBoolean EGLAPIENTRY eglGetConfigAttrib(EGLDisplay dpy, EGLConfig config,
EGLint attribute, EGLint *value);
EGLAPI EGLSurface EGLAPIENTRY eglCreateWindowSurface(EGLDisplay dpy, EGLConfig config,
EGLNativeWindowType win,
const EGLint *attrib_list);
EGLAPI EGLSurface EGLAPIENTRY eglCreatePbufferSurface(EGLDisplay dpy, EGLConfig config,
const EGLint *attrib_list);
EGLAPI EGLSurface EGLAPIENTRY eglCreatePixmapSurface(EGLDisplay dpy, EGLConfig config,
EGLNativePixmapType pixmap,
const EGLint *attrib_list);
EGLAPI EGLBoolean EGLAPIENTRY eglDestroySurface(EGLDisplay dpy, EGLSurface surface);
EGLAPI EGLBoolean EGLAPIENTRY eglQuerySurface(EGLDisplay dpy, EGLSurface surface,
EGLint attribute, EGLint *value);
EGLAPI EGLBoolean EGLAPIENTRY eglBindAPI(EGLenum api);
EGLAPI EGLenum EGLAPIENTRY eglQueryAPI(void);
EGLAPI EGLBoolean EGLAPIENTRY eglWaitClient(void);
EGLAPI EGLBoolean EGLAPIENTRY eglReleaseThread(void);
EGLAPI EGLSurface EGLAPIENTRY eglCreatePbufferFromClientBuffer(
EGLDisplay dpy, EGLenum buftype, EGLClientBuffer buffer,
EGLConfig config, const EGLint *attrib_list);
EGLAPI EGLBoolean EGLAPIENTRY eglSurfaceAttrib(EGLDisplay dpy, EGLSurface surface,
EGLint attribute, EGLint value);
EGLAPI EGLBoolean EGLAPIENTRY eglBindTexImage(EGLDisplay dpy, EGLSurface surface, EGLint buffer);
EGLAPI EGLBoolean EGLAPIENTRY eglReleaseTexImage(EGLDisplay dpy, EGLSurface surface, EGLint buffer);
EGLAPI EGLBoolean EGLAPIENTRY eglSwapInterval(EGLDisplay dpy, EGLint interval);
EGLAPI EGLContext EGLAPIENTRY eglCreateContext(EGLDisplay dpy, EGLConfig config,
EGLContext share_context,
const EGLint *attrib_list);
EGLAPI EGLBoolean EGLAPIENTRY eglDestroyContext(EGLDisplay dpy, EGLContext ctx);
EGLAPI EGLBoolean EGLAPIENTRY eglMakeCurrent(EGLDisplay dpy, EGLSurface draw,
EGLSurface read, EGLContext ctx);
EGLAPI EGLContext EGLAPIENTRY eglGetCurrentContext(void);
EGLAPI EGLSurface EGLAPIENTRY eglGetCurrentSurface(EGLint readdraw);
EGLAPI EGLDisplay EGLAPIENTRY eglGetCurrentDisplay(void);
EGLAPI EGLBoolean EGLAPIENTRY eglQueryContext(EGLDisplay dpy, EGLContext ctx,
EGLint attribute, EGLint *value);
EGLAPI EGLBoolean EGLAPIENTRY eglWaitGL(void);
EGLAPI EGLBoolean EGLAPIENTRY eglWaitNative(EGLint engine);
EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffers(EGLDisplay dpy, EGLSurface surface);
EGLAPI EGLBoolean EGLAPIENTRY eglCopyBuffers(EGLDisplay dpy, EGLSurface surface,
EGLNativePixmapType target);
/* This is a generic function pointer type, whose name indicates it must
* be cast to the proper type *and calling convention* before use.
*/
typedef void (*__eglMustCastToProperFunctionPointerType)(void);
#define EGL_ALPHA_SIZE 0x3021
#define EGL_BAD_ACCESS 0x3002
#define EGL_BAD_ALLOC 0x3003
#define EGL_BAD_ATTRIBUTE 0x3004
#define EGL_BAD_CONFIG 0x3005
#define EGL_BAD_CONTEXT 0x3006
#define EGL_BAD_CURRENT_SURFACE 0x3007
#define EGL_BAD_DISPLAY 0x3008
#define EGL_BAD_MATCH 0x3009
#define EGL_BAD_NATIVE_PIXMAP 0x300A
#define EGL_BAD_NATIVE_WINDOW 0x300B
#define EGL_BAD_PARAMETER 0x300C
#define EGL_BAD_SURFACE 0x300D
#define EGL_BLUE_SIZE 0x3022
#define EGL_BUFFER_SIZE 0x3020
#define EGL_CONFIG_CAVEAT 0x3027
#define EGL_CONFIG_ID 0x3028
#define EGL_CORE_NATIVE_ENGINE 0x305B
#define EGL_DEPTH_SIZE 0x3025
#define EGL_DONT_CARE ((EGLint)-1)
#define EGL_DRAW 0x3059
#define EGL_EXTENSIONS 0x3055
#define EGL_FALSE 0
#define EGL_GREEN_SIZE 0x3023
#define EGL_HEIGHT 0x3056
#define EGL_LARGEST_PBUFFER 0x3058
#define EGL_LEVEL 0x3029
#define EGL_MAX_PBUFFER_HEIGHT 0x302A
#define EGL_MAX_PBUFFER_PIXELS 0x302B
#define EGL_MAX_PBUFFER_WIDTH 0x302C
#define EGL_NATIVE_RENDERABLE 0x302D
#define EGL_NATIVE_VISUAL_ID 0x302E
#define EGL_NATIVE_VISUAL_TYPE 0x302F
#define EGL_NONE 0x3038
#define EGL_NON_CONFORMANT_CONFIG 0x3051
#define EGL_NOT_INITIALIZED 0x3001
#define EGL_NO_CONTEXT ((EGLContext)0)
#define EGL_NO_DISPLAY ((EGLDisplay)0)
#define EGL_NO_SURFACE ((EGLSurface)0)
#define EGL_PBUFFER_BIT 0x0001
#define EGL_PIXMAP_BIT 0x0002
#define EGL_READ 0x305A
#define EGL_RED_SIZE 0x3024
#define EGL_SAMPLES 0x3031
#define EGL_SAMPLE_BUFFERS 0x3032
#define EGL_SLOW_CONFIG 0x3050
#define EGL_STENCIL_SIZE 0x3026
#define EGL_SUCCESS 0x3000
#define EGL_SURFACE_TYPE 0x3033
#define EGL_TRANSPARENT_BLUE_VALUE 0x3035
#define EGL_TRANSPARENT_GREEN_VALUE 0x3036
#define EGL_TRANSPARENT_RED_VALUE 0x3037
#define EGL_TRANSPARENT_RGB 0x3052
#define EGL_TRANSPARENT_TYPE 0x3034
#define EGL_TRUE 1
#define EGL_VENDOR 0x3053
#define EGL_VERSION 0x3054
#define EGL_WIDTH 0x3057
#define EGL_WINDOW_BIT 0x0004
EGLAPI EGLBoolean EGLAPIENTRY eglChooseConfig (EGLDisplay dpy, const EGLint *attrib_list, EGLConfig *configs, EGLint config_size, EGLint *num_config);
EGLAPI EGLBoolean EGLAPIENTRY eglCopyBuffers (EGLDisplay dpy, EGLSurface surface, EGLNativePixmapType target);
EGLAPI EGLContext EGLAPIENTRY eglCreateContext (EGLDisplay dpy, EGLConfig config, EGLContext share_context, const EGLint *attrib_list);
EGLAPI EGLSurface EGLAPIENTRY eglCreatePbufferSurface (EGLDisplay dpy, EGLConfig config, const EGLint *attrib_list);
EGLAPI EGLSurface EGLAPIENTRY eglCreatePixmapSurface (EGLDisplay dpy, EGLConfig config, EGLNativePixmapType pixmap, const EGLint *attrib_list);
EGLAPI EGLSurface EGLAPIENTRY eglCreateWindowSurface (EGLDisplay dpy, EGLConfig config, EGLNativeWindowType win, const EGLint *attrib_list);
EGLAPI EGLBoolean EGLAPIENTRY eglDestroyContext (EGLDisplay dpy, EGLContext ctx);
EGLAPI EGLBoolean EGLAPIENTRY eglDestroySurface (EGLDisplay dpy, EGLSurface surface);
EGLAPI EGLBoolean EGLAPIENTRY eglGetConfigAttrib (EGLDisplay dpy, EGLConfig config, EGLint attribute, EGLint *value);
EGLAPI EGLBoolean EGLAPIENTRY eglGetConfigs (EGLDisplay dpy, EGLConfig *configs, EGLint config_size, EGLint *num_config);
EGLAPI EGLDisplay EGLAPIENTRY eglGetCurrentDisplay (void);
EGLAPI EGLSurface EGLAPIENTRY eglGetCurrentSurface (EGLint readdraw);
EGLAPI EGLDisplay EGLAPIENTRY eglGetDisplay (EGLNativeDisplayType display_id);
EGLAPI EGLint EGLAPIENTRY eglGetError (void);
EGLAPI __eglMustCastToProperFunctionPointerType EGLAPIENTRY eglGetProcAddress (const char *procname);
EGLAPI EGLBoolean EGLAPIENTRY eglInitialize (EGLDisplay dpy, EGLint *major, EGLint *minor);
EGLAPI EGLBoolean EGLAPIENTRY eglMakeCurrent (EGLDisplay dpy, EGLSurface draw, EGLSurface read, EGLContext ctx);
EGLAPI EGLBoolean EGLAPIENTRY eglQueryContext (EGLDisplay dpy, EGLContext ctx, EGLint attribute, EGLint *value);
EGLAPI const char *EGLAPIENTRY eglQueryString (EGLDisplay dpy, EGLint name);
EGLAPI EGLBoolean EGLAPIENTRY eglQuerySurface (EGLDisplay dpy, EGLSurface surface, EGLint attribute, EGLint *value);
EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffers (EGLDisplay dpy, EGLSurface surface);
EGLAPI EGLBoolean EGLAPIENTRY eglTerminate (EGLDisplay dpy);
EGLAPI EGLBoolean EGLAPIENTRY eglWaitGL (void);
EGLAPI EGLBoolean EGLAPIENTRY eglWaitNative (EGLint engine);
#endif /* EGL_VERSION_1_0 */
#ifndef EGL_VERSION_1_1
#define EGL_VERSION_1_1 1
#define EGL_BACK_BUFFER 0x3084
#define EGL_BIND_TO_TEXTURE_RGB 0x3039
#define EGL_BIND_TO_TEXTURE_RGBA 0x303A
#define EGL_CONTEXT_LOST 0x300E
#define EGL_MIN_SWAP_INTERVAL 0x303B
#define EGL_MAX_SWAP_INTERVAL 0x303C
#define EGL_MIPMAP_TEXTURE 0x3082
#define EGL_MIPMAP_LEVEL 0x3083
#define EGL_NO_TEXTURE 0x305C
#define EGL_TEXTURE_2D 0x305F
#define EGL_TEXTURE_FORMAT 0x3080
#define EGL_TEXTURE_RGB 0x305D
#define EGL_TEXTURE_RGBA 0x305E
#define EGL_TEXTURE_TARGET 0x3081
EGLAPI EGLBoolean EGLAPIENTRY eglBindTexImage (EGLDisplay dpy, EGLSurface surface, EGLint buffer);
EGLAPI EGLBoolean EGLAPIENTRY eglReleaseTexImage (EGLDisplay dpy, EGLSurface surface, EGLint buffer);
EGLAPI EGLBoolean EGLAPIENTRY eglSurfaceAttrib (EGLDisplay dpy, EGLSurface surface, EGLint attribute, EGLint value);
EGLAPI EGLBoolean EGLAPIENTRY eglSwapInterval (EGLDisplay dpy, EGLint interval);
#endif /* EGL_VERSION_1_1 */
#ifndef EGL_VERSION_1_2
#define EGL_VERSION_1_2 1
typedef unsigned int EGLenum;
typedef void *EGLClientBuffer;
#define EGL_ALPHA_FORMAT 0x3088
#define EGL_ALPHA_FORMAT_NONPRE 0x308B
#define EGL_ALPHA_FORMAT_PRE 0x308C
#define EGL_ALPHA_MASK_SIZE 0x303E
#define EGL_BUFFER_PRESERVED 0x3094
#define EGL_BUFFER_DESTROYED 0x3095
#define EGL_CLIENT_APIS 0x308D
#define EGL_COLORSPACE 0x3087
#define EGL_COLORSPACE_sRGB 0x3089
#define EGL_COLORSPACE_LINEAR 0x308A
#define EGL_COLOR_BUFFER_TYPE 0x303F
#define EGL_CONTEXT_CLIENT_TYPE 0x3097
#define EGL_DISPLAY_SCALING 10000
#define EGL_HORIZONTAL_RESOLUTION 0x3090
#define EGL_LUMINANCE_BUFFER 0x308F
#define EGL_LUMINANCE_SIZE 0x303D
#define EGL_OPENGL_ES_BIT 0x0001
#define EGL_OPENVG_BIT 0x0002
#define EGL_OPENGL_ES_API 0x30A0
#define EGL_OPENVG_API 0x30A1
#define EGL_OPENVG_IMAGE 0x3096
#define EGL_PIXEL_ASPECT_RATIO 0x3092
#define EGL_RENDERABLE_TYPE 0x3040
#define EGL_RENDER_BUFFER 0x3086
#define EGL_RGB_BUFFER 0x308E
#define EGL_SINGLE_BUFFER 0x3085
#define EGL_SWAP_BEHAVIOR 0x3093
#define EGL_UNKNOWN ((EGLint)-1)
#define EGL_VERTICAL_RESOLUTION 0x3091
EGLAPI EGLBoolean EGLAPIENTRY eglBindAPI (EGLenum api);
EGLAPI EGLenum EGLAPIENTRY eglQueryAPI (void);
EGLAPI EGLSurface EGLAPIENTRY eglCreatePbufferFromClientBuffer (EGLDisplay dpy, EGLenum buftype, EGLClientBuffer buffer, EGLConfig config, const EGLint *attrib_list);
EGLAPI EGLBoolean EGLAPIENTRY eglReleaseThread (void);
EGLAPI EGLBoolean EGLAPIENTRY eglWaitClient (void);
#endif /* EGL_VERSION_1_2 */
#ifndef EGL_VERSION_1_3
#define EGL_VERSION_1_3 1
#define EGL_CONFORMANT 0x3042
#define EGL_CONTEXT_CLIENT_VERSION 0x3098
#define EGL_MATCH_NATIVE_PIXMAP 0x3041
#define EGL_OPENGL_ES2_BIT 0x0004
#define EGL_VG_ALPHA_FORMAT 0x3088
#define EGL_VG_ALPHA_FORMAT_NONPRE 0x308B
#define EGL_VG_ALPHA_FORMAT_PRE 0x308C
#define EGL_VG_ALPHA_FORMAT_PRE_BIT 0x0040
#define EGL_VG_COLORSPACE 0x3087
#define EGL_VG_COLORSPACE_sRGB 0x3089
#define EGL_VG_COLORSPACE_LINEAR 0x308A
#define EGL_VG_COLORSPACE_LINEAR_BIT 0x0020
#endif /* EGL_VERSION_1_3 */
#ifndef EGL_VERSION_1_4
#define EGL_VERSION_1_4 1
#define EGL_DEFAULT_DISPLAY ((EGLNativeDisplayType)0)
#define EGL_MULTISAMPLE_RESOLVE_BOX_BIT 0x0200
#define EGL_MULTISAMPLE_RESOLVE 0x3099
#define EGL_MULTISAMPLE_RESOLVE_DEFAULT 0x309A
#define EGL_MULTISAMPLE_RESOLVE_BOX 0x309B
#define EGL_OPENGL_API 0x30A2
#define EGL_OPENGL_BIT 0x0008
#define EGL_SWAP_BEHAVIOR_PRESERVED_BIT 0x0400
EGLAPI EGLContext EGLAPIENTRY eglGetCurrentContext (void);
#endif /* EGL_VERSION_1_4 */
#ifndef EGL_VERSION_1_5
#define EGL_VERSION_1_5 1
typedef void *EGLSync;
typedef intptr_t EGLAttrib;
typedef khronos_utime_nanoseconds_t EGLTime;
typedef void *EGLImage;
#define EGL_CONTEXT_MAJOR_VERSION 0x3098
#define EGL_CONTEXT_MINOR_VERSION 0x30FB
#define EGL_CONTEXT_OPENGL_PROFILE_MASK 0x30FD
#define EGL_CONTEXT_OPENGL_RESET_NOTIFICATION_STRATEGY 0x31BD
#define EGL_NO_RESET_NOTIFICATION 0x31BE
#define EGL_LOSE_CONTEXT_ON_RESET 0x31BF
#define EGL_CONTEXT_OPENGL_CORE_PROFILE_BIT 0x00000001
#define EGL_CONTEXT_OPENGL_COMPATIBILITY_PROFILE_BIT 0x00000002
#define EGL_CONTEXT_OPENGL_DEBUG 0x31B0
#define EGL_CONTEXT_OPENGL_FORWARD_COMPATIBLE 0x31B1
#define EGL_CONTEXT_OPENGL_ROBUST_ACCESS 0x31B2
#define EGL_OPENGL_ES3_BIT 0x00000040
#define EGL_CL_EVENT_HANDLE 0x309C
#define EGL_SYNC_CL_EVENT 0x30FE
#define EGL_SYNC_CL_EVENT_COMPLETE 0x30FF
#define EGL_SYNC_PRIOR_COMMANDS_COMPLETE 0x30F0
#define EGL_SYNC_TYPE 0x30F7
#define EGL_SYNC_STATUS 0x30F1
#define EGL_SYNC_CONDITION 0x30F8
#define EGL_SIGNALED 0x30F2
#define EGL_UNSIGNALED 0x30F3
#define EGL_SYNC_FLUSH_COMMANDS_BIT 0x0001
#define EGL_FOREVER 0xFFFFFFFFFFFFFFFFull
#define EGL_TIMEOUT_EXPIRED 0x30F5
#define EGL_CONDITION_SATISFIED 0x30F6
#define EGL_NO_SYNC ((EGLSync)0)
#define EGL_SYNC_FENCE 0x30F9
#define EGL_GL_COLORSPACE 0x309D
#define EGL_GL_COLORSPACE_SRGB 0x3089
#define EGL_GL_COLORSPACE_LINEAR 0x308A
#define EGL_GL_RENDERBUFFER 0x30B9
#define EGL_GL_TEXTURE_2D 0x30B1
#define EGL_GL_TEXTURE_LEVEL 0x30BC
#define EGL_GL_TEXTURE_3D 0x30B2
#define EGL_GL_TEXTURE_ZOFFSET 0x30BD
#define EGL_GL_TEXTURE_CUBE_MAP_POSITIVE_X 0x30B3
#define EGL_GL_TEXTURE_CUBE_MAP_NEGATIVE_X 0x30B4
#define EGL_GL_TEXTURE_CUBE_MAP_POSITIVE_Y 0x30B5
#define EGL_GL_TEXTURE_CUBE_MAP_NEGATIVE_Y 0x30B6
#define EGL_GL_TEXTURE_CUBE_MAP_POSITIVE_Z 0x30B7
#define EGL_GL_TEXTURE_CUBE_MAP_NEGATIVE_Z 0x30B8
#define EGL_IMAGE_PRESERVED 0x30D2
#define EGL_NO_IMAGE ((EGLImage)0)
EGLAPI EGLSync EGLAPIENTRY eglCreateSync (EGLDisplay dpy, EGLenum type, const EGLAttrib *attrib_list);
EGLAPI EGLBoolean EGLAPIENTRY eglDestroySync (EGLDisplay dpy, EGLSync sync);
EGLAPI EGLint EGLAPIENTRY eglClientWaitSync (EGLDisplay dpy, EGLSync sync, EGLint flags, EGLTime timeout);
EGLAPI EGLBoolean EGLAPIENTRY eglGetSyncAttrib (EGLDisplay dpy, EGLSync sync, EGLint attribute, EGLAttrib *value);
EGLAPI EGLImage EGLAPIENTRY eglCreateImage (EGLDisplay dpy, EGLContext ctx, EGLenum target, EGLClientBuffer buffer, const EGLAttrib *attrib_list);
EGLAPI EGLBoolean EGLAPIENTRY eglDestroyImage (EGLDisplay dpy, EGLImage image);
EGLAPI EGLDisplay EGLAPIENTRY eglGetPlatformDisplay (EGLenum platform, void *native_display, const EGLAttrib *attrib_list);
EGLAPI EGLSurface EGLAPIENTRY eglCreatePlatformWindowSurface (EGLDisplay dpy, EGLConfig config, void *native_window, const EGLAttrib *attrib_list);
EGLAPI EGLSurface EGLAPIENTRY eglCreatePlatformPixmapSurface (EGLDisplay dpy, EGLConfig config, void *native_pixmap, const EGLAttrib *attrib_list);
EGLAPI EGLBoolean EGLAPIENTRY eglWaitSync (EGLDisplay dpy, EGLSync sync, EGLint flags);
#endif /* EGL_VERSION_1_5 */
/* Now, define eglGetProcAddress using the generic function ptr. type */
EGLAPI __eglMustCastToProperFunctionPointerType EGLAPIENTRY
eglGetProcAddress(const char *procname);
#ifdef __cplusplus
}
#endif
#endif
#endif /* __egl_h_ */

View File

@@ -6,7 +6,7 @@ extern "C" {
#endif
/*
** Copyright (c) 2013-2014 The Khronos Group Inc.
** Copyright (c) 2013 The Khronos Group Inc.
**
** Permission is hereby granted, free of charge, to any person obtaining a
** copy of this software and/or associated documentation files (the
@@ -33,12 +33,12 @@ extern "C" {
** used to make the header, and the header can be found at
** http://www.opengl.org/registry/
**
** Khronos $Revision$ on $Date$
** Khronos $Revision: 24567 $ on $Date: 2013-12-18 09:50:17 -0800 (Wed, 18 Dec 2013) $
*/
#include <EGL/eglplatform.h>
#define EGL_EGLEXT_VERSION 20150508
#define EGL_EGLEXT_VERSION 20131218
/* Generated C header for:
* API: egl
@@ -94,28 +94,12 @@ EGLAPI EGLSyncKHR EGLAPIENTRY eglCreateSync64KHR (EGLDisplay dpy, EGLenum type,
#define EGL_OPENGL_ES3_BIT_KHR 0x00000040
#endif /* EGL_KHR_create_context */
#ifndef EGL_KHR_create_context_no_error
#define EGL_KHR_create_context_no_error 1
#define EGL_CONTEXT_OPENGL_NO_ERROR_KHR 0x31B3
#endif /* EGL_KHR_create_context_no_error */
#ifndef EGL_KHR_fence_sync
#define EGL_KHR_fence_sync 1
typedef khronos_utime_nanoseconds_t EGLTimeKHR;
#ifdef KHRONOS_SUPPORT_INT64
#define EGL_SYNC_PRIOR_COMMANDS_COMPLETE_KHR 0x30F0
#define EGL_SYNC_CONDITION_KHR 0x30F8
#define EGL_SYNC_FENCE_KHR 0x30F9
typedef EGLSyncKHR (EGLAPIENTRYP PFNEGLCREATESYNCKHRPROC) (EGLDisplay dpy, EGLenum type, const EGLint *attrib_list);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLDESTROYSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync);
typedef EGLint (EGLAPIENTRYP PFNEGLCLIENTWAITSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint flags, EGLTimeKHR timeout);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETSYNCATTRIBKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint attribute, EGLint *value);
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLSyncKHR EGLAPIENTRY eglCreateSyncKHR (EGLDisplay dpy, EGLenum type, const EGLint *attrib_list);
EGLAPI EGLBoolean EGLAPIENTRY eglDestroySyncKHR (EGLDisplay dpy, EGLSyncKHR sync);
EGLAPI EGLint EGLAPIENTRY eglClientWaitSyncKHR (EGLDisplay dpy, EGLSyncKHR sync, EGLint flags, EGLTimeKHR timeout);
EGLAPI EGLBoolean EGLAPIENTRY eglGetSyncAttribKHR (EGLDisplay dpy, EGLSyncKHR sync, EGLint attribute, EGLint *value);
#endif
#endif /* KHRONOS_SUPPORT_INT64 */
#endif /* EGL_KHR_fence_sync */
@@ -223,38 +207,9 @@ EGLAPI EGLBoolean EGLAPIENTRY eglQuerySurface64KHR (EGLDisplay dpy, EGLSurface s
#endif
#endif /* EGL_KHR_lock_surface3 */
#ifndef EGL_KHR_partial_update
#define EGL_KHR_partial_update 1
#define EGL_BUFFER_AGE_KHR 0x313D
typedef EGLBoolean (EGLAPIENTRYP PFNEGLSETDAMAGEREGIONKHRPROC) (EGLDisplay dpy, EGLSurface surface, EGLint *rects, EGLint n_rects);
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglSetDamageRegionKHR (EGLDisplay dpy, EGLSurface surface, EGLint *rects, EGLint n_rects);
#endif
#endif /* EGL_KHR_partial_update */
#ifndef EGL_KHR_platform_android
#define EGL_KHR_platform_android 1
#define EGL_PLATFORM_ANDROID_KHR 0x3141
#endif /* EGL_KHR_platform_android */
#ifndef EGL_KHR_platform_gbm
#define EGL_KHR_platform_gbm 1
#define EGL_PLATFORM_GBM_KHR 0x31D7
#endif /* EGL_KHR_platform_gbm */
#ifndef EGL_KHR_platform_wayland
#define EGL_KHR_platform_wayland 1
#define EGL_PLATFORM_WAYLAND_KHR 0x31D8
#endif /* EGL_KHR_platform_wayland */
#ifndef EGL_KHR_platform_x11
#define EGL_KHR_platform_x11 1
#define EGL_PLATFORM_X11_KHR 0x31D5
#define EGL_PLATFORM_X11_SCREEN_KHR 0x31D6
#endif /* EGL_KHR_platform_x11 */
#ifndef EGL_KHR_reusable_sync
#define EGL_KHR_reusable_sync 1
typedef khronos_utime_nanoseconds_t EGLTimeKHR;
#ifdef KHRONOS_SUPPORT_INT64
#define EGL_SYNC_STATUS_KHR 0x30F1
#define EGL_SIGNALED_KHR 0x30F2
@@ -266,9 +221,17 @@ EGLAPI EGLBoolean EGLAPIENTRY eglSetDamageRegionKHR (EGLDisplay dpy, EGLSurface
#define EGL_SYNC_FLUSH_COMMANDS_BIT_KHR 0x0001
#define EGL_FOREVER_KHR 0xFFFFFFFFFFFFFFFFull
#define EGL_NO_SYNC_KHR ((EGLSyncKHR)0)
typedef EGLSyncKHR (EGLAPIENTRYP PFNEGLCREATESYNCKHRPROC) (EGLDisplay dpy, EGLenum type, const EGLint *attrib_list);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLDESTROYSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync);
typedef EGLint (EGLAPIENTRYP PFNEGLCLIENTWAITSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint flags, EGLTimeKHR timeout);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLSIGNALSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLenum mode);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETSYNCATTRIBKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint attribute, EGLint *value);
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLSyncKHR EGLAPIENTRY eglCreateSyncKHR (EGLDisplay dpy, EGLenum type, const EGLint *attrib_list);
EGLAPI EGLBoolean EGLAPIENTRY eglDestroySyncKHR (EGLDisplay dpy, EGLSyncKHR sync);
EGLAPI EGLint EGLAPIENTRY eglClientWaitSyncKHR (EGLDisplay dpy, EGLSyncKHR sync, EGLint flags, EGLTimeKHR timeout);
EGLAPI EGLBoolean EGLAPIENTRY eglSignalSyncKHR (EGLDisplay dpy, EGLSyncKHR sync, EGLenum mode);
EGLAPI EGLBoolean EGLAPIENTRY eglGetSyncAttribKHR (EGLDisplay dpy, EGLSyncKHR sync, EGLint attribute, EGLint *value);
#endif
#endif /* KHRONOS_SUPPORT_INT64 */
#endif /* EGL_KHR_reusable_sync */
@@ -370,14 +333,6 @@ EGLAPI EGLSurface EGLAPIENTRY eglCreateStreamProducerSurfaceKHR (EGLDisplay dpy,
#define EGL_KHR_surfaceless_context 1
#endif /* EGL_KHR_surfaceless_context */
#ifndef EGL_KHR_swap_buffers_with_damage
#define EGL_KHR_swap_buffers_with_damage 1
typedef EGLBoolean (EGLAPIENTRYP PFNEGLSWAPBUFFERSWITHDAMAGEKHRPROC) (EGLDisplay dpy, EGLSurface surface, EGLint *rects, EGLint n_rects);
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffersWithDamageKHR (EGLDisplay dpy, EGLSurface surface, EGLint *rects, EGLint n_rects);
#endif
#endif /* EGL_KHR_swap_buffers_with_damage */
#ifndef EGL_KHR_vg_parent_image
#define EGL_KHR_vg_parent_image 1
#define EGL_VG_PARENT_IMAGE_KHR 0x30BA
@@ -434,12 +389,6 @@ EGLAPI EGLint EGLAPIENTRY eglDupNativeFenceFDANDROID (EGLDisplay dpy, EGLSyncKHR
#define EGL_D3D_TEXTURE_2D_SHARE_HANDLE_ANGLE 0x3200
#endif /* EGL_ANGLE_d3d_share_handle_client_buffer */
#ifndef EGL_ANGLE_device_d3d
#define EGL_ANGLE_device_d3d 1
#define EGL_D3D9_DEVICE_ANGLE 0x33A0
#define EGL_D3D11_DEVICE_ANGLE 0x33A1
#endif /* EGL_ANGLE_device_d3d */
#ifndef EGL_ANGLE_query_surface_pointer
#define EGL_ANGLE_query_surface_pointer 1
typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYSURFACEPOINTERANGLEPROC) (EGLDisplay dpy, EGLSurface surface, EGLint attribute, void **value);
@@ -452,11 +401,6 @@ EGLAPI EGLBoolean EGLAPIENTRY eglQuerySurfacePointerANGLE (EGLDisplay dpy, EGLSu
#define EGL_ANGLE_surface_d3d_texture_2d_share_handle 1
#endif /* EGL_ANGLE_surface_d3d_texture_2d_share_handle */
#ifndef EGL_ANGLE_window_fixed_size
#define EGL_ANGLE_window_fixed_size 1
#define EGL_FIXED_SIZE_ANGLE 0x3201
#endif /* EGL_ANGLE_window_fixed_size */
#ifndef EGL_ARM_pixmap_multisample_discard
#define EGL_ARM_pixmap_multisample_discard 1
#define EGL_DISCARD_SAMPLES_ARM 0x3286
@@ -479,42 +423,6 @@ EGLAPI EGLBoolean EGLAPIENTRY eglQuerySurfacePointerANGLE (EGLDisplay dpy, EGLSu
#define EGL_LOSE_CONTEXT_ON_RESET_EXT 0x31BF
#endif /* EGL_EXT_create_context_robustness */
#ifndef EGL_EXT_device_base
#define EGL_EXT_device_base 1
typedef void *EGLDeviceEXT;
#define EGL_NO_DEVICE_EXT ((EGLDeviceEXT)(0))
#define EGL_BAD_DEVICE_EXT 0x322B
#define EGL_DEVICE_EXT 0x322C
typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYDEVICEATTRIBEXTPROC) (EGLDeviceEXT device, EGLint attribute, EGLAttrib *value);
typedef const char *(EGLAPIENTRYP PFNEGLQUERYDEVICESTRINGEXTPROC) (EGLDeviceEXT device, EGLint name);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYDEVICESEXTPROC) (EGLint max_devices, EGLDeviceEXT *devices, EGLint *num_devices);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYDISPLAYATTRIBEXTPROC) (EGLDisplay dpy, EGLint attribute, EGLAttrib *value);
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglQueryDeviceAttribEXT (EGLDeviceEXT device, EGLint attribute, EGLAttrib *value);
EGLAPI const char *EGLAPIENTRY eglQueryDeviceStringEXT (EGLDeviceEXT device, EGLint name);
EGLAPI EGLBoolean EGLAPIENTRY eglQueryDevicesEXT (EGLint max_devices, EGLDeviceEXT *devices, EGLint *num_devices);
EGLAPI EGLBoolean EGLAPIENTRY eglQueryDisplayAttribEXT (EGLDisplay dpy, EGLint attribute, EGLAttrib *value);
#endif
#endif /* EGL_EXT_device_base */
#ifndef EGL_EXT_device_drm
#define EGL_EXT_device_drm 1
#define EGL_DRM_DEVICE_FILE_EXT 0x3233
#endif /* EGL_EXT_device_drm */
#ifndef EGL_EXT_device_enumeration
#define EGL_EXT_device_enumeration 1
#endif /* EGL_EXT_device_enumeration */
#ifndef EGL_EXT_device_openwf
#define EGL_EXT_device_openwf 1
#define EGL_OPENWF_DEVICE_ID_EXT 0x3237
#endif /* EGL_EXT_device_openwf */
#ifndef EGL_EXT_device_query
#define EGL_EXT_device_query 1
#endif /* EGL_EXT_device_query */
#ifndef EGL_EXT_image_dma_buf_import
#define EGL_EXT_image_dma_buf_import 1
#define EGL_LINUX_DMA_BUF_EXT 0x3270
@@ -546,48 +454,6 @@ EGLAPI EGLBoolean EGLAPIENTRY eglQueryDisplayAttribEXT (EGLDisplay dpy, EGLint a
#define EGL_MULTIVIEW_VIEW_COUNT_EXT 0x3134
#endif /* EGL_EXT_multiview_window */
#ifndef EGL_EXT_output_base
#define EGL_EXT_output_base 1
typedef void *EGLOutputLayerEXT;
typedef void *EGLOutputPortEXT;
#define EGL_NO_OUTPUT_LAYER_EXT ((EGLOutputLayerEXT)0)
#define EGL_NO_OUTPUT_PORT_EXT ((EGLOutputPortEXT)0)
#define EGL_BAD_OUTPUT_LAYER_EXT 0x322D
#define EGL_BAD_OUTPUT_PORT_EXT 0x322E
#define EGL_SWAP_INTERVAL_EXT 0x322F
typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETOUTPUTLAYERSEXTPROC) (EGLDisplay dpy, const EGLAttrib *attrib_list, EGLOutputLayerEXT *layers, EGLint max_layers, EGLint *num_layers);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETOUTPUTPORTSEXTPROC) (EGLDisplay dpy, const EGLAttrib *attrib_list, EGLOutputPortEXT *ports, EGLint max_ports, EGLint *num_ports);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLOUTPUTLAYERATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint attribute, EGLAttrib value);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYOUTPUTLAYERATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint attribute, EGLAttrib *value);
typedef const char *(EGLAPIENTRYP PFNEGLQUERYOUTPUTLAYERSTRINGEXTPROC) (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint name);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLOUTPUTPORTATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputPortEXT port, EGLint attribute, EGLAttrib value);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYOUTPUTPORTATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputPortEXT port, EGLint attribute, EGLAttrib *value);
typedef const char *(EGLAPIENTRYP PFNEGLQUERYOUTPUTPORTSTRINGEXTPROC) (EGLDisplay dpy, EGLOutputPortEXT port, EGLint name);
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglGetOutputLayersEXT (EGLDisplay dpy, const EGLAttrib *attrib_list, EGLOutputLayerEXT *layers, EGLint max_layers, EGLint *num_layers);
EGLAPI EGLBoolean EGLAPIENTRY eglGetOutputPortsEXT (EGLDisplay dpy, const EGLAttrib *attrib_list, EGLOutputPortEXT *ports, EGLint max_ports, EGLint *num_ports);
EGLAPI EGLBoolean EGLAPIENTRY eglOutputLayerAttribEXT (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint attribute, EGLAttrib value);
EGLAPI EGLBoolean EGLAPIENTRY eglQueryOutputLayerAttribEXT (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint attribute, EGLAttrib *value);
EGLAPI const char *EGLAPIENTRY eglQueryOutputLayerStringEXT (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint name);
EGLAPI EGLBoolean EGLAPIENTRY eglOutputPortAttribEXT (EGLDisplay dpy, EGLOutputPortEXT port, EGLint attribute, EGLAttrib value);
EGLAPI EGLBoolean EGLAPIENTRY eglQueryOutputPortAttribEXT (EGLDisplay dpy, EGLOutputPortEXT port, EGLint attribute, EGLAttrib *value);
EGLAPI const char *EGLAPIENTRY eglQueryOutputPortStringEXT (EGLDisplay dpy, EGLOutputPortEXT port, EGLint name);
#endif
#endif /* EGL_EXT_output_base */
#ifndef EGL_EXT_output_drm
#define EGL_EXT_output_drm 1
#define EGL_DRM_CRTC_EXT 0x3234
#define EGL_DRM_PLANE_EXT 0x3235
#define EGL_DRM_CONNECTOR_EXT 0x3236
#endif /* EGL_EXT_output_drm */
#ifndef EGL_EXT_output_openwf
#define EGL_EXT_output_openwf 1
#define EGL_OPENWF_PIPELINE_ID_EXT 0x3238
#define EGL_OPENWF_PORT_ID_EXT 0x3239
#endif /* EGL_EXT_output_openwf */
#ifndef EGL_EXT_platform_base
#define EGL_EXT_platform_base 1
typedef EGLDisplay (EGLAPIENTRYP PFNEGLGETPLATFORMDISPLAYEXTPROC) (EGLenum platform, void *native_display, const EGLint *attrib_list);
@@ -600,11 +466,6 @@ EGLAPI EGLSurface EGLAPIENTRY eglCreatePlatformPixmapSurfaceEXT (EGLDisplay dpy,
#endif
#endif /* EGL_EXT_platform_base */
#ifndef EGL_EXT_platform_device
#define EGL_EXT_platform_device 1
#define EGL_PLATFORM_DEVICE_EXT 0x313F
#endif /* EGL_EXT_platform_device */
#ifndef EGL_EXT_platform_wayland
#define EGL_EXT_platform_wayland 1
#define EGL_PLATFORM_WAYLAND_EXT 0x31D8
@@ -616,19 +477,6 @@ EGLAPI EGLSurface EGLAPIENTRY eglCreatePlatformPixmapSurfaceEXT (EGLDisplay dpy,
#define EGL_PLATFORM_X11_SCREEN_EXT 0x31D6
#endif /* EGL_EXT_platform_x11 */
#ifndef EGL_EXT_protected_surface
#define EGL_EXT_protected_surface 1
#define EGL_PROTECTED_CONTENT_EXT 0x32C0
#endif /* EGL_EXT_protected_surface */
#ifndef EGL_EXT_stream_consumer_egloutput
#define EGL_EXT_stream_consumer_egloutput 1
typedef EGLBoolean (EGLAPIENTRYP PFNEGLSTREAMCONSUMEROUTPUTEXTPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLOutputLayerEXT layer);
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglStreamConsumerOutputEXT (EGLDisplay dpy, EGLStreamKHR stream, EGLOutputLayerEXT layer);
#endif
#endif /* EGL_EXT_stream_consumer_egloutput */
#ifndef EGL_EXT_swap_buffers_with_damage
#define EGL_EXT_swap_buffers_with_damage 1
typedef EGLBoolean (EGLAPIENTRYP PFNEGLSWAPBUFFERSWITHDAMAGEEXTPROC) (EGLDisplay dpy, EGLSurface surface, EGLint *rects, EGLint n_rects);
@@ -637,35 +485,6 @@ EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffersWithDamageEXT (EGLDisplay dpy, EGLSu
#endif
#endif /* EGL_EXT_swap_buffers_with_damage */
#ifndef EGL_EXT_yuv_surface
#define EGL_EXT_yuv_surface 1
#define EGL_YUV_ORDER_EXT 0x3301
#define EGL_YUV_NUMBER_OF_PLANES_EXT 0x3311
#define EGL_YUV_SUBSAMPLE_EXT 0x3312
#define EGL_YUV_DEPTH_RANGE_EXT 0x3317
#define EGL_YUV_CSC_STANDARD_EXT 0x330A
#define EGL_YUV_PLANE_BPP_EXT 0x331A
#define EGL_YUV_BUFFER_EXT 0x3300
#define EGL_YUV_ORDER_YUV_EXT 0x3302
#define EGL_YUV_ORDER_YVU_EXT 0x3303
#define EGL_YUV_ORDER_YUYV_EXT 0x3304
#define EGL_YUV_ORDER_UYVY_EXT 0x3305
#define EGL_YUV_ORDER_YVYU_EXT 0x3306
#define EGL_YUV_ORDER_VYUY_EXT 0x3307
#define EGL_YUV_ORDER_AYUV_EXT 0x3308
#define EGL_YUV_SUBSAMPLE_4_2_0_EXT 0x3313
#define EGL_YUV_SUBSAMPLE_4_2_2_EXT 0x3314
#define EGL_YUV_SUBSAMPLE_4_4_4_EXT 0x3315
#define EGL_YUV_DEPTH_RANGE_LIMITED_EXT 0x3318
#define EGL_YUV_DEPTH_RANGE_FULL_EXT 0x3319
#define EGL_YUV_CSC_STANDARD_601_EXT 0x330B
#define EGL_YUV_CSC_STANDARD_709_EXT 0x330C
#define EGL_YUV_CSC_STANDARD_2020_EXT 0x330D
#define EGL_YUV_PLANE_BPP_0_EXT 0x331B
#define EGL_YUV_PLANE_BPP_8_EXT 0x331C
#define EGL_YUV_PLANE_BPP_10_EXT 0x331D
#endif /* EGL_EXT_yuv_surface */
#ifndef EGL_HI_clientpixmap
#define EGL_HI_clientpixmap 1
struct EGLClientPixmapHI {
@@ -714,42 +533,11 @@ EGLAPI EGLBoolean EGLAPIENTRY eglExportDRMImageMESA (EGLDisplay dpy, EGLImageKHR
#endif
#endif /* EGL_MESA_drm_image */
#ifndef EGL_MESA_image_dma_buf_export
#define EGL_MESA_image_dma_buf_export 1
typedef EGLBoolean (EGLAPIENTRYP PFNEGLEXPORTDMABUFIMAGEQUERYMESAPROC) (EGLDisplay dpy, EGLImageKHR image, int *fourcc, int *num_planes, EGLuint64KHR *modifiers);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLEXPORTDMABUFIMAGEMESAPROC) (EGLDisplay dpy, EGLImageKHR image, int *fds, EGLint *strides, EGLint *offsets);
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglExportDMABUFImageQueryMESA (EGLDisplay dpy, EGLImageKHR image, int *fourcc, int *num_planes, EGLuint64KHR *modifiers);
EGLAPI EGLBoolean EGLAPIENTRY eglExportDMABUFImageMESA (EGLDisplay dpy, EGLImageKHR image, int *fds, EGLint *strides, EGLint *offsets);
#endif
#endif /* EGL_MESA_image_dma_buf_export */
#ifndef EGL_MESA_platform_gbm
#define EGL_MESA_platform_gbm 1
#define EGL_PLATFORM_GBM_MESA 0x31D7
#endif /* EGL_MESA_platform_gbm */
#ifndef EGL_NOK_swap_region
#define EGL_NOK_swap_region 1
typedef EGLBoolean (EGLAPIENTRYP PFNEGLSWAPBUFFERSREGIONNOKPROC) (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint *rects);
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffersRegionNOK (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint *rects);
#endif
#endif /* EGL_NOK_swap_region */
#ifndef EGL_NOK_swap_region2
#define EGL_NOK_swap_region2 1
typedef EGLBoolean (EGLAPIENTRYP PFNEGLSWAPBUFFERSREGION2NOKPROC) (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint *rects);
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffersRegion2NOK (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint *rects);
#endif
#endif /* EGL_NOK_swap_region2 */
#ifndef EGL_NOK_texture_from_pixmap
#define EGL_NOK_texture_from_pixmap 1
#define EGL_Y_INVERTED_NOK 0x307F
#endif /* EGL_NOK_texture_from_pixmap */
#ifndef EGL_NV_3dvision_surface
#define EGL_NV_3dvision_surface 1
#define EGL_AUTO_STEREO_NV 0x3136
@@ -768,13 +556,6 @@ EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffersRegion2NOK (EGLDisplay dpy, EGLSurfa
#define EGL_COVERAGE_SAMPLE_RESOLVE_NONE_NV 0x3133
#endif /* EGL_NV_coverage_sample_resolve */
#ifndef EGL_NV_cuda_event
#define EGL_NV_cuda_event 1
#define EGL_CUDA_EVENT_HANDLE_NV 0x323B
#define EGL_SYNC_CUDA_EVENT_NV 0x323C
#define EGL_SYNC_CUDA_EVENT_COMPLETE_NV 0x323D
#endif /* EGL_NV_cuda_event */
#ifndef EGL_NV_depth_nonlinear
#define EGL_NV_depth_nonlinear 1
#define EGL_DEPTH_ENCODING_NV 0x30E2
@@ -782,11 +563,6 @@ EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffersRegion2NOK (EGLDisplay dpy, EGLSurfa
#define EGL_DEPTH_ENCODING_NONLINEAR_NV 0x30E3
#endif /* EGL_NV_depth_nonlinear */
#ifndef EGL_NV_device_cuda
#define EGL_NV_device_cuda 1
#define EGL_CUDA_DEVICE_NV 0x323A
#endif /* EGL_NV_device_cuda */
#ifndef EGL_NV_native_query
#define EGL_NV_native_query 1
typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYNATIVEDISPLAYNVPROC) (EGLDisplay dpy, EGLNativeDisplayType *display_id);
@@ -869,16 +645,6 @@ EGLAPI EGLuint64NV EGLAPIENTRY eglGetSystemTimeNV (void);
#endif /* KHRONOS_SUPPORT_INT64 */
#endif /* EGL_NV_system_time */
#ifndef EGL_TIZEN_image_native_buffer
#define EGL_TIZEN_image_native_buffer 1
#define EGL_NATIVE_BUFFER_TIZEN 0x32A0
#endif /* EGL_TIZEN_image_native_buffer */
#ifndef EGL_TIZEN_image_native_surface
#define EGL_TIZEN_image_native_surface 1
#define EGL_NATIVE_SURFACE_TIZEN 0x32A1
#endif /* EGL_TIZEN_image_native_surface */
#include <EGL/eglmesaext.h>
#include <EGL/eglextchromium.h>

View File

@@ -34,6 +34,63 @@ extern "C" {
#include <EGL/eglplatform.h>
/* EGL_MESA_screen extension >>> PRELIMINARY <<< */
#ifndef EGL_MESA_screen_surface
#define EGL_MESA_screen_surface 1
#define EGL_BAD_SCREEN_MESA 0x4000
#define EGL_BAD_MODE_MESA 0x4001
#define EGL_SCREEN_COUNT_MESA 0x4002
#define EGL_SCREEN_POSITION_MESA 0x4003
#define EGL_SCREEN_POSITION_GRANULARITY_MESA 0x4004
#define EGL_MODE_ID_MESA 0x4005
#define EGL_REFRESH_RATE_MESA 0x4006
#define EGL_OPTIMAL_MESA 0x4007
#define EGL_INTERLACED_MESA 0x4008
#define EGL_SCREEN_BIT_MESA 0x08
typedef khronos_uint32_t EGLScreenMESA;
typedef khronos_uint32_t EGLModeMESA;
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglChooseModeMESA(EGLDisplay dpy, EGLScreenMESA screen, const EGLint *attrib_list, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
EGLAPI EGLBoolean EGLAPIENTRY eglGetModesMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
EGLAPI EGLBoolean EGLAPIENTRY eglGetModeAttribMESA(EGLDisplay dpy, EGLModeMESA mode, EGLint attribute, EGLint *value);
EGLAPI EGLBoolean EGLAPIENTRY eglGetScreensMESA(EGLDisplay dpy, EGLScreenMESA *screens, EGLint max_screens, EGLint *num_screens);
EGLAPI EGLSurface EGLAPIENTRY eglCreateScreenSurfaceMESA(EGLDisplay dpy, EGLConfig config, const EGLint *attrib_list);
EGLAPI EGLBoolean EGLAPIENTRY eglShowScreenSurfaceMESA(EGLDisplay dpy, EGLint screen, EGLSurface surface, EGLModeMESA mode);
EGLAPI EGLBoolean EGLAPIENTRY eglScreenPositionMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLint x, EGLint y);
EGLAPI EGLBoolean EGLAPIENTRY eglQueryScreenMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLint attribute, EGLint *value);
EGLAPI EGLBoolean EGLAPIENTRY eglQueryScreenSurfaceMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLSurface *surface);
EGLAPI EGLBoolean EGLAPIENTRY eglQueryScreenModeMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *mode);
EGLAPI const char * EGLAPIENTRY eglQueryModeStringMESA(EGLDisplay dpy, EGLModeMESA mode);
#endif /* EGL_EGLEXT_PROTOTYPES */
typedef EGLBoolean (EGLAPIENTRYP PFNEGLCHOOSEMODEMESA) (EGLDisplay dpy, EGLScreenMESA screen, const EGLint *attrib_list, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETMODESMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLGetModeATTRIBMESA) (EGLDisplay dpy, EGLModeMESA mode, EGLint attribute, EGLint *value);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETSCRREENSMESA) (EGLDisplay dpy, EGLScreenMESA *screens, EGLint max_screens, EGLint *num_screens);
typedef EGLSurface (EGLAPIENTRYP PFNEGLCREATESCREENSURFACEMESA) (EGLDisplay dpy, EGLConfig config, const EGLint *attrib_list);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLSHOWSCREENSURFACEMESA) (EGLDisplay dpy, EGLint screen, EGLSurface surface, EGLModeMESA mode);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLSCREENPOSIITONMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLint x, EGLint y);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYSCREENMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLint attribute, EGLint *value);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYSCREENSURFACEMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLSurface *surface);
typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYSCREENMODEMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *mode);
typedef const char * (EGLAPIENTRYP PFNEGLQUERYMODESTRINGMESA) (EGLDisplay dpy, EGLModeMESA mode);
#endif /* EGL_MESA_screen_surface */
#ifndef EGL_MESA_copy_context
#define EGL_MESA_copy_context 1
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglCopyContextMESA(EGLDisplay dpy, EGLContext source, EGLContext dest, EGLint mask);
#endif /* EGL_EGLEXT_PROTOTYPES */
typedef EGLBoolean (EGLAPIENTRYP PFNEGLCOPYCONTEXTMESA) (EGLDisplay dpy, EGLContext source, EGLContext dest, EGLint mask);
#endif /* EGL_MESA_copy_context */
#ifndef EGL_MESA_drm_display
#define EGL_MESA_drm_display 1
@@ -87,8 +144,26 @@ typedef struct wl_buffer * (EGLAPIENTRYP PFNEGLCREATEWAYLANDBUFFERFROMIMAGEWL) (
#endif
/* remnant of EGL_NOK_swap_region kept for compatibility because of a non-standard type name */
#ifndef EGL_NOK_swap_region
#define EGL_NOK_swap_region 1
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffersRegionNOK(EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint* rects);
#endif
typedef EGLBoolean (EGLAPIENTRYP PFNEGLSWAPBUFFERSREGIONNOK) (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint* rects);
#endif
#ifndef EGL_NOK_texture_from_pixmap
#define EGL_NOK_texture_from_pixmap 1
#define EGL_Y_INVERTED_NOK 0x307F
#endif /* EGL_NOK_texture_from_pixmap */
#ifndef EGL_ANDROID_image_native_buffer
#define EGL_ANDROID_image_native_buffer 1
#define EGL_NATIVE_BUFFER_ANDROID 0x3140 /* eglCreateImageKHR target */
#endif
#ifndef EGL_MESA_configless_context
#define EGL_MESA_configless_context 1

View File

@@ -2,7 +2,7 @@
#define __eglplatform_h_
/*
** Copyright (c) 2007-2013 The Khronos Group Inc.
** Copyright (c) 2007-2009 The Khronos Group Inc.
**
** Permission is hereby granted, free of charge, to any person obtaining a
** copy of this software and/or associated documentation files (the
@@ -25,7 +25,7 @@
*/
/* Platform-specific types and definitions for egl.h
* $Revision: 30994 $ on $Date: 2015-04-30 13:36:48 -0700 (Thu, 30 Apr 2015) $
* $Revision: 12306 $ on $Date: 2010-08-25 09:51:28 -0700 (Wed, 25 Aug 2010) $
*
* Adopters may modify khrplatform.h and this file to suit their platform.
* You are encouraged to submit all modifications to the Khronos group so that
@@ -95,19 +95,18 @@ typedef struct gbm_device *EGLNativeDisplayType;
typedef struct gbm_bo *EGLNativePixmapType;
typedef void *EGLNativeWindowType;
#elif defined(__ANDROID__) || defined(ANDROID)
#include <android/native_window.h>
#elif defined(ANDROID) /* Android */
struct ANativeWindow;
struct egl_native_pixmap_t;
typedef struct ANativeWindow* EGLNativeWindowType;
typedef struct egl_native_pixmap_t* EGLNativePixmapType;
typedef void* EGLNativeDisplayType;
typedef struct ANativeWindow *EGLNativeWindowType;
typedef struct egl_native_pixmap_t *EGLNativePixmapType;
typedef void *EGLNativeDisplayType;
#elif defined(__unix__) || defined(__APPLE__)
#elif defined(__unix__)
#if defined(MESA_EGL_NO_X11_HEADERS)
#ifdef MESA_EGL_NO_X11_HEADERS
typedef void *EGLNativeDisplayType;
typedef khronos_uintptr_t EGLNativePixmapType;
@@ -125,12 +124,6 @@ typedef Window EGLNativeWindowType;
#endif /* MESA_EGL_NO_X11_HEADERS */
#elif __HAIKU__
#include <kernel/image.h>
typedef void *EGLNativeDisplayType;
typedef khronos_uintptr_t EGLNativePixmapType;
typedef khronos_uintptr_t EGLNativeWindowType;
#else
#error "Platform not recognized"
#endif

View File

@@ -6,7 +6,7 @@ extern "C" {
#endif
/*
** Copyright (c) 2013-2015 The Khronos Group Inc.
** Copyright (c) 2013-2014 The Khronos Group Inc.
**
** Permission is hereby granted, free of charge, to any person obtaining a
** copy of this software and/or associated documentation files (the
@@ -33,7 +33,7 @@ extern "C" {
** used to make the header, and the header can be found at
** http://www.opengl.org/registry/
**
** Khronos $Revision: 31811 $ on $Date: 2015-08-10 17:01:11 +1000 (Mon, 10 Aug 2015) $
** Khronos $Revision: 27684 $ on $Date: 2014-08-11 01:21:35 -0700 (Mon, 11 Aug 2014) $
*/
#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__)
@@ -53,7 +53,7 @@ extern "C" {
#define GLAPI extern
#endif
#define GL_GLEXT_VERSION 20150809
#define GL_GLEXT_VERSION 20140810
/* Generated C header for:
* API: gl
@@ -1041,22 +1041,6 @@ typedef unsigned short GLhalf;
#define GL_COLOR_ATTACHMENT13 0x8CED
#define GL_COLOR_ATTACHMENT14 0x8CEE
#define GL_COLOR_ATTACHMENT15 0x8CEF
#define GL_COLOR_ATTACHMENT16 0x8CF0
#define GL_COLOR_ATTACHMENT17 0x8CF1
#define GL_COLOR_ATTACHMENT18 0x8CF2
#define GL_COLOR_ATTACHMENT19 0x8CF3
#define GL_COLOR_ATTACHMENT20 0x8CF4
#define GL_COLOR_ATTACHMENT21 0x8CF5
#define GL_COLOR_ATTACHMENT22 0x8CF6
#define GL_COLOR_ATTACHMENT23 0x8CF7
#define GL_COLOR_ATTACHMENT24 0x8CF8
#define GL_COLOR_ATTACHMENT25 0x8CF9
#define GL_COLOR_ATTACHMENT26 0x8CFA
#define GL_COLOR_ATTACHMENT27 0x8CFB
#define GL_COLOR_ATTACHMENT28 0x8CFC
#define GL_COLOR_ATTACHMENT29 0x8CFD
#define GL_COLOR_ATTACHMENT30 0x8CFE
#define GL_COLOR_ATTACHMENT31 0x8CFF
#define GL_DEPTH_ATTACHMENT 0x8D00
#define GL_STENCIL_ATTACHMENT 0x8D20
#define GL_FRAMEBUFFER 0x8D40
@@ -2060,10 +2044,6 @@ GLAPI void APIENTRY glGetDoublei_v (GLenum target, GLuint index, GLdouble *data)
#ifndef GL_VERSION_4_2
#define GL_VERSION_4_2 1
#define GL_COPY_READ_BUFFER_BINDING 0x8F36
#define GL_COPY_WRITE_BUFFER_BINDING 0x8F37
#define GL_TRANSFORM_FEEDBACK_ACTIVE 0x8E24
#define GL_TRANSFORM_FEEDBACK_PAUSED 0x8E23
#define GL_UNPACK_COMPRESSED_BLOCK_WIDTH 0x9127
#define GL_UNPACK_COMPRESSED_BLOCK_HEIGHT 0x9128
#define GL_UNPACK_COMPRESSED_BLOCK_DEPTH 0x9129
@@ -2610,6 +2590,7 @@ GLAPI void APIENTRY glBindVertexBuffers (GLuint first, GLsizei count, const GLui
#define GL_MAX_COMBINED_CLIP_AND_CULL_DISTANCES 0x82FA
#define GL_TEXTURE_TARGET 0x1006
#define GL_QUERY_TARGET 0x82EA
#define GL_TEXTURE_BINDING 0x82EB
#define GL_GUILTY_CONTEXT_RESET 0x8253
#define GL_INNOCENT_CONTEXT_RESET 0x8254
#define GL_UNKNOWN_CONTEXT_RESET 0x8255
@@ -2622,25 +2603,25 @@ GLAPI void APIENTRY glBindVertexBuffers (GLuint first, GLsizei count, const GLui
typedef void (APIENTRYP PFNGLCLIPCONTROLPROC) (GLenum origin, GLenum depth);
typedef void (APIENTRYP PFNGLCREATETRANSFORMFEEDBACKSPROC) (GLsizei n, GLuint *ids);
typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKBUFFERBASEPROC) (GLuint xfb, GLuint index, GLuint buffer);
typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKBUFFERRANGEPROC) (GLuint xfb, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size);
typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKBUFFERRANGEPROC) (GLuint xfb, GLuint index, GLuint buffer, GLintptr offset, GLsizei size);
typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKIVPROC) (GLuint xfb, GLenum pname, GLint *param);
typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKI_VPROC) (GLuint xfb, GLenum pname, GLuint index, GLint *param);
typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKI64_VPROC) (GLuint xfb, GLenum pname, GLuint index, GLint64 *param);
typedef void (APIENTRYP PFNGLCREATEBUFFERSPROC) (GLsizei n, GLuint *buffers);
typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags);
typedef void (APIENTRYP PFNGLNAMEDBUFFERDATAPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage);
typedef void (APIENTRYP PFNGLNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data);
typedef void (APIENTRYP PFNGLCOPYNAMEDBUFFERSUBDATAPROC) (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size);
typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEPROC) (GLuint buffer, GLsizei size, const void *data, GLbitfield flags);
typedef void (APIENTRYP PFNGLNAMEDBUFFERDATAPROC) (GLuint buffer, GLsizei size, const void *data, GLenum usage);
typedef void (APIENTRYP PFNGLNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizei size, const void *data);
typedef void (APIENTRYP PFNGLCOPYNAMEDBUFFERSUBDATAPROC) (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizei size);
typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERDATAPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data);
typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data);
typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizei size, GLenum format, GLenum type, const void *data);
typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFERPROC) (GLuint buffer, GLenum access);
typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access);
typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizei length, GLbitfield access);
typedef GLboolean (APIENTRYP PFNGLUNMAPNAMEDBUFFERPROC) (GLuint buffer);
typedef void (APIENTRYP PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length);
typedef void (APIENTRYP PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizei length);
typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERIVPROC) (GLuint buffer, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERI64VPROC) (GLuint buffer, GLenum pname, GLint64 *params);
typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPOINTERVPROC) (GLuint buffer, GLenum pname, void **params);
typedef void (APIENTRYP PFNGLGETNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data);
typedef void (APIENTRYP PFNGLGETNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizei size, void *data);
typedef void (APIENTRYP PFNGLCREATEFRAMEBUFFERSPROC) (GLsizei n, GLuint *framebuffers);
typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERRENDERBUFFERPROC) (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer);
typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERPARAMETERIPROC) (GLuint framebuffer, GLenum pname, GLint param);
@@ -2665,7 +2646,7 @@ typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEPROC) (GLuint re
typedef void (APIENTRYP PFNGLGETNAMEDRENDERBUFFERPARAMETERIVPROC) (GLuint renderbuffer, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLCREATETEXTURESPROC) (GLenum target, GLsizei n, GLuint *textures);
typedef void (APIENTRYP PFNGLTEXTUREBUFFERPROC) (GLuint texture, GLenum internalformat, GLuint buffer);
typedef void (APIENTRYP PFNGLTEXTUREBUFFERRANGEPROC) (GLuint texture, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size);
typedef void (APIENTRYP PFNGLTEXTUREBUFFERRANGEPROC) (GLuint texture, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizei size);
typedef void (APIENTRYP PFNGLTEXTURESTORAGE1DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width);
typedef void (APIENTRYP PFNGLTEXTURESTORAGE2DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height);
typedef void (APIENTRYP PFNGLTEXTURESTORAGE3DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth);
@@ -2713,10 +2694,6 @@ typedef void (APIENTRYP PFNGLGETVERTEXARRAYINDEXED64IVPROC) (GLuint vaobj, GLuin
typedef void (APIENTRYP PFNGLCREATESAMPLERSPROC) (GLsizei n, GLuint *samplers);
typedef void (APIENTRYP PFNGLCREATEPROGRAMPIPELINESPROC) (GLsizei n, GLuint *pipelines);
typedef void (APIENTRYP PFNGLCREATEQUERIESPROC) (GLenum target, GLsizei n, GLuint *ids);
typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTUI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTUIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
typedef void (APIENTRYP PFNGLMEMORYBARRIERBYREGIONPROC) (GLbitfield barriers);
typedef void (APIENTRYP PFNGLGETTEXTURESUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, GLsizei bufSize, void *pixels);
typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTURESUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei bufSize, void *pixels);
@@ -2745,25 +2722,25 @@ typedef void (APIENTRYP PFNGLTEXTUREBARRIERPROC) (void);
GLAPI void APIENTRY glClipControl (GLenum origin, GLenum depth);
GLAPI void APIENTRY glCreateTransformFeedbacks (GLsizei n, GLuint *ids);
GLAPI void APIENTRY glTransformFeedbackBufferBase (GLuint xfb, GLuint index, GLuint buffer);
GLAPI void APIENTRY glTransformFeedbackBufferRange (GLuint xfb, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size);
GLAPI void APIENTRY glTransformFeedbackBufferRange (GLuint xfb, GLuint index, GLuint buffer, GLintptr offset, GLsizei size);
GLAPI void APIENTRY glGetTransformFeedbackiv (GLuint xfb, GLenum pname, GLint *param);
GLAPI void APIENTRY glGetTransformFeedbacki_v (GLuint xfb, GLenum pname, GLuint index, GLint *param);
GLAPI void APIENTRY glGetTransformFeedbacki64_v (GLuint xfb, GLenum pname, GLuint index, GLint64 *param);
GLAPI void APIENTRY glCreateBuffers (GLsizei n, GLuint *buffers);
GLAPI void APIENTRY glNamedBufferStorage (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags);
GLAPI void APIENTRY glNamedBufferData (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage);
GLAPI void APIENTRY glNamedBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data);
GLAPI void APIENTRY glCopyNamedBufferSubData (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size);
GLAPI void APIENTRY glNamedBufferStorage (GLuint buffer, GLsizei size, const void *data, GLbitfield flags);
GLAPI void APIENTRY glNamedBufferData (GLuint buffer, GLsizei size, const void *data, GLenum usage);
GLAPI void APIENTRY glNamedBufferSubData (GLuint buffer, GLintptr offset, GLsizei size, const void *data);
GLAPI void APIENTRY glCopyNamedBufferSubData (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizei size);
GLAPI void APIENTRY glClearNamedBufferData (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data);
GLAPI void APIENTRY glClearNamedBufferSubData (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data);
GLAPI void APIENTRY glClearNamedBufferSubData (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizei size, GLenum format, GLenum type, const void *data);
GLAPI void *APIENTRY glMapNamedBuffer (GLuint buffer, GLenum access);
GLAPI void *APIENTRY glMapNamedBufferRange (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access);
GLAPI void *APIENTRY glMapNamedBufferRange (GLuint buffer, GLintptr offset, GLsizei length, GLbitfield access);
GLAPI GLboolean APIENTRY glUnmapNamedBuffer (GLuint buffer);
GLAPI void APIENTRY glFlushMappedNamedBufferRange (GLuint buffer, GLintptr offset, GLsizeiptr length);
GLAPI void APIENTRY glFlushMappedNamedBufferRange (GLuint buffer, GLintptr offset, GLsizei length);
GLAPI void APIENTRY glGetNamedBufferParameteriv (GLuint buffer, GLenum pname, GLint *params);
GLAPI void APIENTRY glGetNamedBufferParameteri64v (GLuint buffer, GLenum pname, GLint64 *params);
GLAPI void APIENTRY glGetNamedBufferPointerv (GLuint buffer, GLenum pname, void **params);
GLAPI void APIENTRY glGetNamedBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data);
GLAPI void APIENTRY glGetNamedBufferSubData (GLuint buffer, GLintptr offset, GLsizei size, void *data);
GLAPI void APIENTRY glCreateFramebuffers (GLsizei n, GLuint *framebuffers);
GLAPI void APIENTRY glNamedFramebufferRenderbuffer (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer);
GLAPI void APIENTRY glNamedFramebufferParameteri (GLuint framebuffer, GLenum pname, GLint param);
@@ -2788,7 +2765,7 @@ GLAPI void APIENTRY glNamedRenderbufferStorageMultisample (GLuint renderbuffer,
GLAPI void APIENTRY glGetNamedRenderbufferParameteriv (GLuint renderbuffer, GLenum pname, GLint *params);
GLAPI void APIENTRY glCreateTextures (GLenum target, GLsizei n, GLuint *textures);
GLAPI void APIENTRY glTextureBuffer (GLuint texture, GLenum internalformat, GLuint buffer);
GLAPI void APIENTRY glTextureBufferRange (GLuint texture, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size);
GLAPI void APIENTRY glTextureBufferRange (GLuint texture, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizei size);
GLAPI void APIENTRY glTextureStorage1D (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width);
GLAPI void APIENTRY glTextureStorage2D (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height);
GLAPI void APIENTRY glTextureStorage3D (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth);
@@ -2836,10 +2813,6 @@ GLAPI void APIENTRY glGetVertexArrayIndexed64iv (GLuint vaobj, GLuint index, GLe
GLAPI void APIENTRY glCreateSamplers (GLsizei n, GLuint *samplers);
GLAPI void APIENTRY glCreateProgramPipelines (GLsizei n, GLuint *pipelines);
GLAPI void APIENTRY glCreateQueries (GLenum target, GLsizei n, GLuint *ids);
GLAPI void APIENTRY glGetQueryBufferObjecti64v (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
GLAPI void APIENTRY glGetQueryBufferObjectiv (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
GLAPI void APIENTRY glGetQueryBufferObjectui64v (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
GLAPI void APIENTRY glGetQueryBufferObjectuiv (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
GLAPI void APIENTRY glMemoryBarrierByRegion (GLbitfield barriers);
GLAPI void APIENTRY glGetTextureSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, GLsizei bufSize, void *pixels);
GLAPI void APIENTRY glGetCompressedTextureSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei bufSize, void *pixels);
@@ -2875,17 +2848,6 @@ GLAPI void APIENTRY glTextureBarrier (void);
#define GL_ARB_ES3_1_compatibility 1
#endif /* GL_ARB_ES3_1_compatibility */
#ifndef GL_ARB_ES3_2_compatibility
#define GL_ARB_ES3_2_compatibility 1
#define GL_PRIMITIVE_BOUNDING_BOX_ARB 0x92BE
#define GL_MULTISAMPLE_LINE_WIDTH_RANGE_ARB 0x9381
#define GL_MULTISAMPLE_LINE_WIDTH_GRANULARITY_ARB 0x9382
typedef void (APIENTRYP PFNGLPRIMITIVEBOUNDINGBOXARBPROC) (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glPrimitiveBoundingBoxARB (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW);
#endif
#endif /* GL_ARB_ES3_2_compatibility */
#ifndef GL_ARB_ES3_compatibility
#define GL_ARB_ES3_compatibility 1
#endif /* GL_ARB_ES3_compatibility */
@@ -3017,6 +2979,8 @@ GLAPI void APIENTRY glDispatchComputeGroupSizeARB (GLuint num_groups_x, GLuint n
#ifndef GL_ARB_copy_buffer
#define GL_ARB_copy_buffer 1
#define GL_COPY_READ_BUFFER_BINDING 0x8F36
#define GL_COPY_WRITE_BUFFER_BINDING 0x8F37
#endif /* GL_ARB_copy_buffer */
#ifndef GL_ARB_copy_image
@@ -3299,10 +3263,6 @@ GLAPI GLboolean APIENTRY glIsProgramARB (GLuint program);
#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_ARB 0x8B8B
#endif /* GL_ARB_fragment_shader */
#ifndef GL_ARB_fragment_shader_interlock
#define GL_ARB_fragment_shader_interlock 1
#endif /* GL_ARB_fragment_shader_interlock */
#ifndef GL_ARB_framebuffer_no_attachments
#define GL_ARB_framebuffer_no_attachments 1
#endif /* GL_ARB_framebuffer_no_attachments */
@@ -3363,91 +3323,6 @@ GLAPI void APIENTRY glFramebufferTextureFaceARB (GLenum target, GLenum attachmen
#define GL_ARB_gpu_shader_fp64 1
#endif /* GL_ARB_gpu_shader_fp64 */
#ifndef GL_ARB_gpu_shader_int64
#define GL_ARB_gpu_shader_int64 1
#define GL_INT64_ARB 0x140E
#define GL_INT64_VEC2_ARB 0x8FE9
#define GL_INT64_VEC3_ARB 0x8FEA
#define GL_INT64_VEC4_ARB 0x8FEB
#define GL_UNSIGNED_INT64_VEC2_ARB 0x8FF5
#define GL_UNSIGNED_INT64_VEC3_ARB 0x8FF6
#define GL_UNSIGNED_INT64_VEC4_ARB 0x8FF7
typedef void (APIENTRYP PFNGLUNIFORM1I64ARBPROC) (GLint location, GLint64 x);
typedef void (APIENTRYP PFNGLUNIFORM2I64ARBPROC) (GLint location, GLint64 x, GLint64 y);
typedef void (APIENTRYP PFNGLUNIFORM3I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z);
typedef void (APIENTRYP PFNGLUNIFORM4I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w);
typedef void (APIENTRYP PFNGLUNIFORM1I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value);
typedef void (APIENTRYP PFNGLUNIFORM2I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value);
typedef void (APIENTRYP PFNGLUNIFORM3I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value);
typedef void (APIENTRYP PFNGLUNIFORM4I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value);
typedef void (APIENTRYP PFNGLUNIFORM1UI64ARBPROC) (GLint location, GLuint64 x);
typedef void (APIENTRYP PFNGLUNIFORM2UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y);
typedef void (APIENTRYP PFNGLUNIFORM3UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z);
typedef void (APIENTRYP PFNGLUNIFORM4UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w);
typedef void (APIENTRYP PFNGLUNIFORM1UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value);
typedef void (APIENTRYP PFNGLUNIFORM2UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value);
typedef void (APIENTRYP PFNGLUNIFORM3UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value);
typedef void (APIENTRYP PFNGLUNIFORM4UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value);
typedef void (APIENTRYP PFNGLGETUNIFORMI64VARBPROC) (GLuint program, GLint location, GLint64 *params);
typedef void (APIENTRYP PFNGLGETUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLuint64 *params);
typedef void (APIENTRYP PFNGLGETNUNIFORMI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLint64 *params);
typedef void (APIENTRYP PFNGLGETNUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint64 *params);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64ARBPROC) (GLuint program, GLint location, GLint64 x);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64ARBPROC) (GLuint program, GLint location, GLuint64 x);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glUniform1i64ARB (GLint location, GLint64 x);
GLAPI void APIENTRY glUniform2i64ARB (GLint location, GLint64 x, GLint64 y);
GLAPI void APIENTRY glUniform3i64ARB (GLint location, GLint64 x, GLint64 y, GLint64 z);
GLAPI void APIENTRY glUniform4i64ARB (GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w);
GLAPI void APIENTRY glUniform1i64vARB (GLint location, GLsizei count, const GLint64 *value);
GLAPI void APIENTRY glUniform2i64vARB (GLint location, GLsizei count, const GLint64 *value);
GLAPI void APIENTRY glUniform3i64vARB (GLint location, GLsizei count, const GLint64 *value);
GLAPI void APIENTRY glUniform4i64vARB (GLint location, GLsizei count, const GLint64 *value);
GLAPI void APIENTRY glUniform1ui64ARB (GLint location, GLuint64 x);
GLAPI void APIENTRY glUniform2ui64ARB (GLint location, GLuint64 x, GLuint64 y);
GLAPI void APIENTRY glUniform3ui64ARB (GLint location, GLuint64 x, GLuint64 y, GLuint64 z);
GLAPI void APIENTRY glUniform4ui64ARB (GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w);
GLAPI void APIENTRY glUniform1ui64vARB (GLint location, GLsizei count, const GLuint64 *value);
GLAPI void APIENTRY glUniform2ui64vARB (GLint location, GLsizei count, const GLuint64 *value);
GLAPI void APIENTRY glUniform3ui64vARB (GLint location, GLsizei count, const GLuint64 *value);
GLAPI void APIENTRY glUniform4ui64vARB (GLint location, GLsizei count, const GLuint64 *value);
GLAPI void APIENTRY glGetUniformi64vARB (GLuint program, GLint location, GLint64 *params);
GLAPI void APIENTRY glGetUniformui64vARB (GLuint program, GLint location, GLuint64 *params);
GLAPI void APIENTRY glGetnUniformi64vARB (GLuint program, GLint location, GLsizei bufSize, GLint64 *params);
GLAPI void APIENTRY glGetnUniformui64vARB (GLuint program, GLint location, GLsizei bufSize, GLuint64 *params);
GLAPI void APIENTRY glProgramUniform1i64ARB (GLuint program, GLint location, GLint64 x);
GLAPI void APIENTRY glProgramUniform2i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y);
GLAPI void APIENTRY glProgramUniform3i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z);
GLAPI void APIENTRY glProgramUniform4i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w);
GLAPI void APIENTRY glProgramUniform1i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value);
GLAPI void APIENTRY glProgramUniform2i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value);
GLAPI void APIENTRY glProgramUniform3i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value);
GLAPI void APIENTRY glProgramUniform4i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value);
GLAPI void APIENTRY glProgramUniform1ui64ARB (GLuint program, GLint location, GLuint64 x);
GLAPI void APIENTRY glProgramUniform2ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y);
GLAPI void APIENTRY glProgramUniform3ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z);
GLAPI void APIENTRY glProgramUniform4ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w);
GLAPI void APIENTRY glProgramUniform1ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
GLAPI void APIENTRY glProgramUniform2ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
GLAPI void APIENTRY glProgramUniform3ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
GLAPI void APIENTRY glProgramUniform4ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
#endif
#endif /* GL_ARB_gpu_shader_int64 */
#ifndef GL_ARB_half_float_pixel
#define GL_ARB_half_float_pixel 1
typedef unsigned short GLhalfARB;
@@ -3827,16 +3702,6 @@ GLAPI void APIENTRY glGetQueryObjectuivARB (GLuint id, GLenum pname, GLuint *par
#define GL_ARB_occlusion_query2 1
#endif /* GL_ARB_occlusion_query2 */
#ifndef GL_ARB_parallel_shader_compile
#define GL_ARB_parallel_shader_compile 1
#define GL_MAX_SHADER_COMPILER_THREADS_ARB 0x91B0
#define GL_COMPLETION_STATUS_ARB 0x91B1
typedef void (APIENTRYP PFNGLMAXSHADERCOMPILERTHREADSARBPROC) (GLuint count);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glMaxShaderCompilerThreadsARB (GLuint count);
#endif
#endif /* GL_ARB_parallel_shader_compile */
#ifndef GL_ARB_pipeline_statistics_query
#define GL_ARB_pipeline_statistics_query 1
#define GL_VERTICES_SUBMITTED_ARB 0x82EE
@@ -3879,10 +3744,6 @@ GLAPI void APIENTRY glPointParameterfvARB (GLenum pname, const GLfloat *params);
#define GL_COORD_REPLACE_ARB 0x8862
#endif /* GL_ARB_point_sprite */
#ifndef GL_ARB_post_depth_coverage
#define GL_ARB_post_depth_coverage 1
#endif /* GL_ARB_post_depth_coverage */
#ifndef GL_ARB_program_interface_query
#define GL_ARB_program_interface_query 1
#endif /* GL_ARB_program_interface_query */
@@ -3956,26 +3817,6 @@ GLAPI void APIENTRY glGetnMinmaxARB (GLenum target, GLboolean reset, GLenum form
#define GL_ARB_robustness_isolation 1
#endif /* GL_ARB_robustness_isolation */
#ifndef GL_ARB_sample_locations
#define GL_ARB_sample_locations 1
#define GL_SAMPLE_LOCATION_SUBPIXEL_BITS_ARB 0x933D
#define GL_SAMPLE_LOCATION_PIXEL_GRID_WIDTH_ARB 0x933E
#define GL_SAMPLE_LOCATION_PIXEL_GRID_HEIGHT_ARB 0x933F
#define GL_PROGRAMMABLE_SAMPLE_LOCATION_TABLE_SIZE_ARB 0x9340
#define GL_SAMPLE_LOCATION_ARB 0x8E50
#define GL_PROGRAMMABLE_SAMPLE_LOCATION_ARB 0x9341
#define GL_FRAMEBUFFER_PROGRAMMABLE_SAMPLE_LOCATIONS_ARB 0x9342
#define GL_FRAMEBUFFER_SAMPLE_LOCATION_PIXEL_GRID_ARB 0x9343
typedef void (APIENTRYP PFNGLFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLenum target, GLuint start, GLsizei count, const GLfloat *v);
typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v);
typedef void (APIENTRYP PFNGLEVALUATEDEPTHVALUESARBPROC) (void);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glFramebufferSampleLocationsfvARB (GLenum target, GLuint start, GLsizei count, const GLfloat *v);
GLAPI void APIENTRY glNamedFramebufferSampleLocationsfvARB (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v);
GLAPI void APIENTRY glEvaluateDepthValuesARB (void);
#endif
#endif /* GL_ARB_sample_locations */
#ifndef GL_ARB_sample_shading
#define GL_ARB_sample_shading 1
#define GL_SAMPLE_SHADING_ARB 0x8C36
@@ -4002,26 +3843,14 @@ GLAPI void APIENTRY glMinSampleShadingARB (GLfloat value);
#define GL_ARB_separate_shader_objects 1
#endif /* GL_ARB_separate_shader_objects */
#ifndef GL_ARB_shader_atomic_counter_ops
#define GL_ARB_shader_atomic_counter_ops 1
#endif /* GL_ARB_shader_atomic_counter_ops */
#ifndef GL_ARB_shader_atomic_counters
#define GL_ARB_shader_atomic_counters 1
#endif /* GL_ARB_shader_atomic_counters */
#ifndef GL_ARB_shader_ballot
#define GL_ARB_shader_ballot 1
#endif /* GL_ARB_shader_ballot */
#ifndef GL_ARB_shader_bit_encoding
#define GL_ARB_shader_bit_encoding 1
#endif /* GL_ARB_shader_bit_encoding */
#ifndef GL_ARB_shader_clock
#define GL_ARB_shader_clock 1
#endif /* GL_ARB_shader_clock */
#ifndef GL_ARB_shader_draw_parameters
#define GL_ARB_shader_draw_parameters 1
#endif /* GL_ARB_shader_draw_parameters */
@@ -4041,12 +3870,7 @@ GLAPI void APIENTRY glMinSampleShadingARB (GLfloat value);
#ifndef GL_ARB_shader_objects
#define GL_ARB_shader_objects 1
#ifdef __APPLE__
#ifdef BUILDING_MESA
/* Avoid uint <-> void* warnings */
typedef unsigned long GLhandleARB;
#else
typedef void *GLhandleARB;
#endif
#else
typedef unsigned int GLhandleARB;
#endif
@@ -4191,10 +4015,6 @@ GLAPI void APIENTRY glGetShaderSourceARB (GLhandleARB obj, GLsizei maxLength, GL
#define GL_ARB_shader_texture_lod 1
#endif /* GL_ARB_shader_texture_lod */
#ifndef GL_ARB_shader_viewport_layer_array
#define GL_ARB_shader_viewport_layer_array 1
#endif /* GL_ARB_shader_viewport_layer_array */
#ifndef GL_ARB_shading_language_100
#define GL_ARB_shading_language_100 1
#define GL_SHADING_LANGUAGE_VERSION_ARB 0x8B8C
@@ -4245,13 +4065,13 @@ GLAPI void APIENTRY glGetNamedStringivARB (GLint namelen, const GLchar *name, GL
#define GL_ARB_sparse_buffer 1
#define GL_SPARSE_STORAGE_BIT_ARB 0x0400
#define GL_SPARSE_BUFFER_PAGE_SIZE_ARB 0x82F8
typedef void (APIENTRYP PFNGLBUFFERPAGECOMMITMENTARBPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLboolean commit);
typedef void (APIENTRYP PFNGLNAMEDBUFFERPAGECOMMITMENTEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit);
typedef void (APIENTRYP PFNGLNAMEDBUFFERPAGECOMMITMENTARBPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit);
typedef void (APIENTRYP PFNGLBUFFERPAGECOMMITMENTARBPROC) (GLenum target, GLintptr offset, GLsizei size, GLboolean commit);
typedef void (APIENTRYP PFNGLNAMEDBUFFERPAGECOMMITMENTEXTPROC) (GLuint buffer, GLintptr offset, GLsizei size, GLboolean commit);
typedef void (APIENTRYP PFNGLNAMEDBUFFERPAGECOMMITMENTARBPROC) (GLuint buffer, GLintptr offset, GLsizei size, GLboolean commit);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glBufferPageCommitmentARB (GLenum target, GLintptr offset, GLsizeiptr size, GLboolean commit);
GLAPI void APIENTRY glNamedBufferPageCommitmentEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit);
GLAPI void APIENTRY glNamedBufferPageCommitmentARB (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit);
GLAPI void APIENTRY glBufferPageCommitmentARB (GLenum target, GLintptr offset, GLsizei size, GLboolean commit);
GLAPI void APIENTRY glNamedBufferPageCommitmentEXT (GLuint buffer, GLintptr offset, GLsizei size, GLboolean commit);
GLAPI void APIENTRY glNamedBufferPageCommitmentARB (GLuint buffer, GLintptr offset, GLsizei size, GLboolean commit);
#endif
#endif /* GL_ARB_sparse_buffer */
@@ -4259,7 +4079,7 @@ GLAPI void APIENTRY glNamedBufferPageCommitmentARB (GLuint buffer, GLintptr offs
#define GL_ARB_sparse_texture 1
#define GL_TEXTURE_SPARSE_ARB 0x91A6
#define GL_VIRTUAL_PAGE_SIZE_INDEX_ARB 0x91A7
#define GL_NUM_SPARSE_LEVELS_ARB 0x91AA
#define GL_MIN_SPARSE_LEVEL_ARB 0x919B
#define GL_NUM_VIRTUAL_PAGE_SIZES_ARB 0x91A8
#define GL_VIRTUAL_PAGE_SIZE_X_ARB 0x9195
#define GL_VIRTUAL_PAGE_SIZE_Y_ARB 0x9196
@@ -4268,20 +4088,12 @@ GLAPI void APIENTRY glNamedBufferPageCommitmentARB (GLuint buffer, GLintptr offs
#define GL_MAX_SPARSE_3D_TEXTURE_SIZE_ARB 0x9199
#define GL_MAX_SPARSE_ARRAY_TEXTURE_LAYERS_ARB 0x919A
#define GL_SPARSE_TEXTURE_FULL_ARRAY_CUBE_MIPMAPS_ARB 0x91A9
typedef void (APIENTRYP PFNGLTEXPAGECOMMITMENTARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit);
typedef void (APIENTRYP PFNGLTEXPAGECOMMITMENTARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glTexPageCommitmentARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit);
GLAPI void APIENTRY glTexPageCommitmentARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident);
#endif
#endif /* GL_ARB_sparse_texture */
#ifndef GL_ARB_sparse_texture2
#define GL_ARB_sparse_texture2 1
#endif /* GL_ARB_sparse_texture2 */
#ifndef GL_ARB_sparse_texture_clamp
#define GL_ARB_sparse_texture_clamp 1
#endif /* GL_ARB_sparse_texture_clamp */
#ifndef GL_ARB_stencil_texturing
#define GL_ARB_stencil_texturing 1
#endif /* GL_ARB_stencil_texturing */
@@ -4434,12 +4246,6 @@ GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, void
#define GL_DOT3_RGBA_ARB 0x86AF
#endif /* GL_ARB_texture_env_dot3 */
#ifndef GL_ARB_texture_filter_minmax
#define GL_ARB_texture_filter_minmax 1
#define GL_TEXTURE_REDUCTION_MODE_ARB 0x9366
#define GL_WEIGHTED_AVERAGE_ARB 0x9367
#endif /* GL_ARB_texture_filter_minmax */
#ifndef GL_ARB_texture_float
#define GL_ARB_texture_float 1
#define GL_TEXTURE_RED_TYPE_ARB 0x8C10
@@ -4538,6 +4344,8 @@ GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, void
#ifndef GL_ARB_transform_feedback2
#define GL_ARB_transform_feedback2 1
#define GL_TRANSFORM_FEEDBACK_PAUSED 0x8E23
#define GL_TRANSFORM_FEEDBACK_ACTIVE 0x8E24
#endif /* GL_ARB_transform_feedback2 */
#ifndef GL_ARB_transform_feedback3
@@ -4934,11 +4742,6 @@ GLAPI void APIENTRY glBlendBarrierKHR (void);
#define GL_KHR_debug 1
#endif /* GL_KHR_debug */
#ifndef GL_KHR_no_error
#define GL_KHR_no_error 1
#define GL_CONTEXT_FLAG_NO_ERROR_BIT_KHR 0x00000008
#endif /* GL_KHR_no_error */
#ifndef GL_KHR_robust_buffer_access_behavior
#define GL_KHR_robust_buffer_access_behavior 1
#endif /* GL_KHR_robust_buffer_access_behavior */
@@ -5081,6 +4884,7 @@ typedef void (APIENTRYP PFNGLPOINTPARAMETERXVOESPROC) (GLenum pname, const GLfix
typedef void (APIENTRYP PFNGLPOINTSIZEXOESPROC) (GLfixed size);
typedef void (APIENTRYP PFNGLPOLYGONOFFSETXOESPROC) (GLfixed factor, GLfixed units);
typedef void (APIENTRYP PFNGLROTATEXOESPROC) (GLfixed angle, GLfixed x, GLfixed y, GLfixed z);
typedef void (APIENTRYP PFNGLSAMPLECOVERAGEOESPROC) (GLfixed value, GLboolean invert);
typedef void (APIENTRYP PFNGLSCALEXOESPROC) (GLfixed x, GLfixed y, GLfixed z);
typedef void (APIENTRYP PFNGLTEXENVXOESPROC) (GLenum target, GLenum pname, GLfixed param);
typedef void (APIENTRYP PFNGLTEXENVXVOESPROC) (GLenum target, GLenum pname, const GLfixed *params);
@@ -5185,6 +4989,7 @@ GLAPI void APIENTRY glPointParameterxvOES (GLenum pname, const GLfixed *params);
GLAPI void APIENTRY glPointSizexOES (GLfixed size);
GLAPI void APIENTRY glPolygonOffsetxOES (GLfixed factor, GLfixed units);
GLAPI void APIENTRY glRotatexOES (GLfixed angle, GLfixed x, GLfixed y, GLfixed z);
GLAPI void APIENTRY glSampleCoverageOES (GLfixed value, GLboolean invert);
GLAPI void APIENTRY glScalexOES (GLfixed x, GLfixed y, GLfixed z);
GLAPI void APIENTRY glTexEnvxOES (GLenum target, GLenum pname, GLfixed param);
GLAPI void APIENTRY glTexEnvxvOES (GLenum target, GLenum pname, const GLfixed *params);
@@ -6898,7 +6703,7 @@ typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBLFORMATEXTPROC) (GLuint vaob
typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBBINDINGEXTPROC) (GLuint vaobj, GLuint attribindex, GLuint bindingindex);
typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXBINDINGDIVISOREXTPROC) (GLuint vaobj, GLuint bindingindex, GLuint divisor);
typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBLOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset);
typedef void (APIENTRYP PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit);
typedef void (APIENTRYP PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident);
typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBDIVISOREXTPROC) (GLuint vaobj, GLuint index, GLuint divisor);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glMatrixLoadfEXT (GLenum mode, const GLfloat *m);
@@ -7154,7 +6959,7 @@ GLAPI void APIENTRY glVertexArrayVertexAttribLFormatEXT (GLuint vaobj, GLuint at
GLAPI void APIENTRY glVertexArrayVertexAttribBindingEXT (GLuint vaobj, GLuint attribindex, GLuint bindingindex);
GLAPI void APIENTRY glVertexArrayVertexBindingDivisorEXT (GLuint vaobj, GLuint bindingindex, GLuint divisor);
GLAPI void APIENTRY glVertexArrayVertexAttribLOffsetEXT (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset);
GLAPI void APIENTRY glTexturePageCommitmentEXT (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit);
GLAPI void APIENTRY glTexturePageCommitmentEXT (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident);
GLAPI void APIENTRY glVertexArrayVertexAttribDivisorEXT (GLuint vaobj, GLuint index, GLuint divisor);
#endif
#endif /* GL_EXT_direct_state_access */
@@ -7680,19 +7485,6 @@ GLAPI void APIENTRY glPolygonOffsetEXT (GLfloat factor, GLfloat bias);
#endif
#endif /* GL_EXT_polygon_offset */
#ifndef GL_EXT_polygon_offset_clamp
#define GL_EXT_polygon_offset_clamp 1
#define GL_POLYGON_OFFSET_CLAMP_EXT 0x8E1B
typedef void (APIENTRYP PFNGLPOLYGONOFFSETCLAMPEXTPROC) (GLfloat factor, GLfloat units, GLfloat clamp);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glPolygonOffsetClampEXT (GLfloat factor, GLfloat units, GLfloat clamp);
#endif
#endif /* GL_EXT_polygon_offset_clamp */
#ifndef GL_EXT_post_depth_coverage
#define GL_EXT_post_depth_coverage 1
#endif /* GL_EXT_post_depth_coverage */
#ifndef GL_EXT_provoking_vertex
#define GL_EXT_provoking_vertex 1
#define GL_QUADS_FOLLOW_PROVOKING_VERTEX_CONVENTION_EXT 0x8E4C
@@ -7705,20 +7497,6 @@ GLAPI void APIENTRY glProvokingVertexEXT (GLenum mode);
#endif
#endif /* GL_EXT_provoking_vertex */
#ifndef GL_EXT_raster_multisample
#define GL_EXT_raster_multisample 1
#define GL_RASTER_MULTISAMPLE_EXT 0x9327
#define GL_RASTER_SAMPLES_EXT 0x9328
#define GL_MAX_RASTER_SAMPLES_EXT 0x9329
#define GL_RASTER_FIXED_SAMPLE_LOCATIONS_EXT 0x932A
#define GL_MULTISAMPLE_RASTERIZATION_ALLOWED_EXT 0x932B
#define GL_EFFECTIVE_RASTER_SAMPLES_EXT 0x932C
typedef void (APIENTRYP PFNGLRASTERSAMPLESEXTPROC) (GLuint samples, GLboolean fixedsamplelocations);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glRasterSamplesEXT (GLuint samples, GLboolean fixedsamplelocations);
#endif
#endif /* GL_EXT_raster_multisample */
#ifndef GL_EXT_rescale_normal
#define GL_EXT_rescale_normal 1
#define GL_RESCALE_NORMAL_EXT 0x803A
@@ -7873,10 +7651,6 @@ GLAPI void APIENTRY glMemoryBarrierEXT (GLbitfield barriers);
#define GL_SHARED_TEXTURE_PALETTE_EXT 0x81FB
#endif /* GL_EXT_shared_texture_palette */
#ifndef GL_EXT_sparse_texture2
#define GL_EXT_sparse_texture2 1
#endif /* GL_EXT_sparse_texture2 */
#ifndef GL_EXT_stencil_clear_tag
#define GL_EXT_stencil_clear_tag 1
#define GL_STENCIL_TAG_BITS_EXT 0x88F2
@@ -8089,10 +7863,6 @@ GLAPI void APIENTRY glTexBufferEXT (GLenum target, GLenum internalformat, GLuint
#define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF
#endif /* GL_EXT_texture_filter_anisotropic */
#ifndef GL_EXT_texture_filter_minmax
#define GL_EXT_texture_filter_minmax 1
#endif /* GL_EXT_texture_filter_minmax */
#ifndef GL_EXT_texture_integer
#define GL_EXT_texture_integer 1
#define GL_RGBA32UI_EXT 0x8D70
@@ -8818,14 +8588,6 @@ GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum sfactorRGB, GLenum dfactorRG
#define GL_INTEL_fragment_shader_ordering 1
#endif /* GL_INTEL_fragment_shader_ordering */
#ifndef GL_INTEL_framebuffer_CMAA
#define GL_INTEL_framebuffer_CMAA 1
typedef void (APIENTRYP PFNGLAPPLYFRAMEBUFFERATTACHMENTCMAAINTELPROC) (void);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glApplyFramebufferAttachmentCMAAINTEL (void);
#endif
#endif /* GL_INTEL_framebuffer_CMAA */
#ifndef GL_INTEL_map_texture
#define GL_INTEL_map_texture 1
#define GL_TEXTURE_MEMORY_LAYOUT_INTEL 0x83FF
@@ -9130,65 +8892,6 @@ GLAPI void APIENTRY glBlendBarrierNV (void);
#define GL_NV_blend_square 1
#endif /* GL_NV_blend_square */
#ifndef GL_NV_command_list
#define GL_NV_command_list 1
#define GL_TERMINATE_SEQUENCE_COMMAND_NV 0x0000
#define GL_NOP_COMMAND_NV 0x0001
#define GL_DRAW_ELEMENTS_COMMAND_NV 0x0002
#define GL_DRAW_ARRAYS_COMMAND_NV 0x0003
#define GL_DRAW_ELEMENTS_STRIP_COMMAND_NV 0x0004
#define GL_DRAW_ARRAYS_STRIP_COMMAND_NV 0x0005
#define GL_DRAW_ELEMENTS_INSTANCED_COMMAND_NV 0x0006
#define GL_DRAW_ARRAYS_INSTANCED_COMMAND_NV 0x0007
#define GL_ELEMENT_ADDRESS_COMMAND_NV 0x0008
#define GL_ATTRIBUTE_ADDRESS_COMMAND_NV 0x0009
#define GL_UNIFORM_ADDRESS_COMMAND_NV 0x000A
#define GL_BLEND_COLOR_COMMAND_NV 0x000B
#define GL_STENCIL_REF_COMMAND_NV 0x000C
#define GL_LINE_WIDTH_COMMAND_NV 0x000D
#define GL_POLYGON_OFFSET_COMMAND_NV 0x000E
#define GL_ALPHA_REF_COMMAND_NV 0x000F
#define GL_VIEWPORT_COMMAND_NV 0x0010
#define GL_SCISSOR_COMMAND_NV 0x0011
#define GL_FRONT_FACE_COMMAND_NV 0x0012
typedef void (APIENTRYP PFNGLCREATESTATESNVPROC) (GLsizei n, GLuint *states);
typedef void (APIENTRYP PFNGLDELETESTATESNVPROC) (GLsizei n, const GLuint *states);
typedef GLboolean (APIENTRYP PFNGLISSTATENVPROC) (GLuint state);
typedef void (APIENTRYP PFNGLSTATECAPTURENVPROC) (GLuint state, GLenum mode);
typedef GLuint (APIENTRYP PFNGLGETCOMMANDHEADERNVPROC) (GLenum tokenID, GLuint size);
typedef GLushort (APIENTRYP PFNGLGETSTAGEINDEXNVPROC) (GLenum shadertype);
typedef void (APIENTRYP PFNGLDRAWCOMMANDSNVPROC) (GLenum primitiveMode, GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, GLuint count);
typedef void (APIENTRYP PFNGLDRAWCOMMANDSADDRESSNVPROC) (GLenum primitiveMode, const GLuint64 *indirects, const GLsizei *sizes, GLuint count);
typedef void (APIENTRYP PFNGLDRAWCOMMANDSSTATESNVPROC) (GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count);
typedef void (APIENTRYP PFNGLDRAWCOMMANDSSTATESADDRESSNVPROC) (const GLuint64 *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count);
typedef void (APIENTRYP PFNGLCREATECOMMANDLISTSNVPROC) (GLsizei n, GLuint *lists);
typedef void (APIENTRYP PFNGLDELETECOMMANDLISTSNVPROC) (GLsizei n, const GLuint *lists);
typedef GLboolean (APIENTRYP PFNGLISCOMMANDLISTNVPROC) (GLuint list);
typedef void (APIENTRYP PFNGLLISTDRAWCOMMANDSSTATESCLIENTNVPROC) (GLuint list, GLuint segment, const void **indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count);
typedef void (APIENTRYP PFNGLCOMMANDLISTSEGMENTSNVPROC) (GLuint list, GLuint segments);
typedef void (APIENTRYP PFNGLCOMPILECOMMANDLISTNVPROC) (GLuint list);
typedef void (APIENTRYP PFNGLCALLCOMMANDLISTNVPROC) (GLuint list);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glCreateStatesNV (GLsizei n, GLuint *states);
GLAPI void APIENTRY glDeleteStatesNV (GLsizei n, const GLuint *states);
GLAPI GLboolean APIENTRY glIsStateNV (GLuint state);
GLAPI void APIENTRY glStateCaptureNV (GLuint state, GLenum mode);
GLAPI GLuint APIENTRY glGetCommandHeaderNV (GLenum tokenID, GLuint size);
GLAPI GLushort APIENTRY glGetStageIndexNV (GLenum shadertype);
GLAPI void APIENTRY glDrawCommandsNV (GLenum primitiveMode, GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, GLuint count);
GLAPI void APIENTRY glDrawCommandsAddressNV (GLenum primitiveMode, const GLuint64 *indirects, const GLsizei *sizes, GLuint count);
GLAPI void APIENTRY glDrawCommandsStatesNV (GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count);
GLAPI void APIENTRY glDrawCommandsStatesAddressNV (const GLuint64 *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count);
GLAPI void APIENTRY glCreateCommandListsNV (GLsizei n, GLuint *lists);
GLAPI void APIENTRY glDeleteCommandListsNV (GLsizei n, const GLuint *lists);
GLAPI GLboolean APIENTRY glIsCommandListNV (GLuint list);
GLAPI void APIENTRY glListDrawCommandsStatesClientNV (GLuint list, GLuint segment, const void **indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count);
GLAPI void APIENTRY glCommandListSegmentsNV (GLuint list, GLuint segments);
GLAPI void APIENTRY glCompileCommandListNV (GLuint list);
GLAPI void APIENTRY glCallCommandListNV (GLuint list);
#endif
#endif /* GL_NV_command_list */
#ifndef GL_NV_compute_program5
#define GL_NV_compute_program5 1
#define GL_COMPUTE_PROGRAM_NV 0x90FB
@@ -9209,29 +8912,6 @@ GLAPI void APIENTRY glEndConditionalRenderNV (void);
#endif
#endif /* GL_NV_conditional_render */
#ifndef GL_NV_conservative_raster
#define GL_NV_conservative_raster 1
#define GL_CONSERVATIVE_RASTERIZATION_NV 0x9346
#define GL_SUBPIXEL_PRECISION_BIAS_X_BITS_NV 0x9347
#define GL_SUBPIXEL_PRECISION_BIAS_Y_BITS_NV 0x9348
#define GL_MAX_SUBPIXEL_PRECISION_BIAS_BITS_NV 0x9349
typedef void (APIENTRYP PFNGLSUBPIXELPRECISIONBIASNVPROC) (GLuint xbits, GLuint ybits);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glSubpixelPrecisionBiasNV (GLuint xbits, GLuint ybits);
#endif
#endif /* GL_NV_conservative_raster */
#ifndef GL_NV_conservative_raster_dilate
#define GL_NV_conservative_raster_dilate 1
#define GL_CONSERVATIVE_RASTER_DILATE_NV 0x9379
#define GL_CONSERVATIVE_RASTER_DILATE_RANGE_NV 0x937A
#define GL_CONSERVATIVE_RASTER_DILATE_GRANULARITY_NV 0x937B
typedef void (APIENTRYP PFNGLCONSERVATIVERASTERPARAMETERFNVPROC) (GLenum pname, GLfloat value);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glConservativeRasterParameterfNV (GLenum pname, GLfloat value);
#endif
#endif /* GL_NV_conservative_raster_dilate */
#ifndef GL_NV_copy_depth_to_color
#define GL_NV_copy_depth_to_color 1
#define GL_DEPTH_STENCIL_TO_RGBA_NV 0x886E
@@ -9374,11 +9054,6 @@ GLAPI void APIENTRY glSetFenceNV (GLuint fence, GLenum condition);
#endif
#endif /* GL_NV_fence */
#ifndef GL_NV_fill_rectangle
#define GL_NV_fill_rectangle 1
#define GL_FILL_RECTANGLE_NV 0x933C
#endif /* GL_NV_fill_rectangle */
#ifndef GL_NV_float_buffer
#define GL_NV_float_buffer 1
#define GL_FLOAT_R_NV 0x8880
@@ -9405,16 +9080,6 @@ GLAPI void APIENTRY glSetFenceNV (GLuint fence, GLenum condition);
#define GL_EYE_PLANE_ABSOLUTE_NV 0x855C
#endif /* GL_NV_fog_distance */
#ifndef GL_NV_fragment_coverage_to_color
#define GL_NV_fragment_coverage_to_color 1
#define GL_FRAGMENT_COVERAGE_TO_COLOR_NV 0x92DD
#define GL_FRAGMENT_COVERAGE_COLOR_NV 0x92DE
typedef void (APIENTRYP PFNGLFRAGMENTCOVERAGECOLORNVPROC) (GLuint color);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glFragmentCoverageColorNV (GLuint color);
#endif
#endif /* GL_NV_fragment_coverage_to_color */
#ifndef GL_NV_fragment_program
#define GL_NV_fragment_program 1
#define GL_MAX_FRAGMENT_PROGRAM_LOCAL_PARAMETERS_NV 0x8868
@@ -9456,30 +9121,6 @@ GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint id, GLsizei len, cons
#define GL_NV_fragment_program_option 1
#endif /* GL_NV_fragment_program_option */
#ifndef GL_NV_fragment_shader_interlock
#define GL_NV_fragment_shader_interlock 1
#endif /* GL_NV_fragment_shader_interlock */
#ifndef GL_NV_framebuffer_mixed_samples
#define GL_NV_framebuffer_mixed_samples 1
#define GL_COVERAGE_MODULATION_TABLE_NV 0x9331
#define GL_COLOR_SAMPLES_NV 0x8E20
#define GL_DEPTH_SAMPLES_NV 0x932D
#define GL_STENCIL_SAMPLES_NV 0x932E
#define GL_MIXED_DEPTH_SAMPLES_SUPPORTED_NV 0x932F
#define GL_MIXED_STENCIL_SAMPLES_SUPPORTED_NV 0x9330
#define GL_COVERAGE_MODULATION_NV 0x9332
#define GL_COVERAGE_MODULATION_TABLE_SIZE_NV 0x9333
typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONTABLENVPROC) (GLsizei n, const GLfloat *v);
typedef void (APIENTRYP PFNGLGETCOVERAGEMODULATIONTABLENVPROC) (GLsizei bufsize, GLfloat *v);
typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONNVPROC) (GLenum components);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glCoverageModulationTableNV (GLsizei n, const GLfloat *v);
GLAPI void APIENTRY glGetCoverageModulationTableNV (GLsizei bufsize, GLfloat *v);
GLAPI void APIENTRY glCoverageModulationNV (GLenum components);
#endif
#endif /* GL_NV_framebuffer_mixed_samples */
#ifndef GL_NV_framebuffer_multisample_coverage
#define GL_NV_framebuffer_multisample_coverage 1
#define GL_RENDERBUFFER_COVERAGE_SAMPLES_NV 0x8CAB
@@ -9511,10 +9152,6 @@ GLAPI void APIENTRY glFramebufferTextureFaceEXT (GLenum target, GLenum attachmen
#define GL_NV_geometry_shader4 1
#endif /* GL_NV_geometry_shader4 */
#ifndef GL_NV_geometry_shader_passthrough
#define GL_NV_geometry_shader_passthrough 1
#endif /* GL_NV_geometry_shader_passthrough */
#ifndef GL_NV_gpu_program4
#define GL_NV_gpu_program4 1
#define GL_MIN_PROGRAM_TEXEL_OFFSET_NV 0x8904
@@ -9687,18 +9324,6 @@ GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint index, GLsizei n, const GLhalfN
#endif
#endif /* GL_NV_half_float */
#ifndef GL_NV_internalformat_sample_query
#define GL_NV_internalformat_sample_query 1
#define GL_MULTISAMPLES_NV 0x9371
#define GL_SUPERSAMPLE_SCALE_X_NV 0x9372
#define GL_SUPERSAMPLE_SCALE_Y_NV 0x9373
#define GL_CONFORMANT_NV 0x9374
typedef void (APIENTRYP PFNGLGETINTERNALFORMATSAMPLEIVNVPROC) (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei bufSize, GLint *params);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei bufSize, GLint *params);
#endif
#endif /* GL_NV_internalformat_sample_query */
#ifndef GL_NV_light_max_exponent
#define GL_NV_light_max_exponent 1
#define GL_MAX_SHININESS_NV 0x8504
@@ -9707,6 +9332,7 @@ GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum interna
#ifndef GL_NV_multisample_coverage
#define GL_NV_multisample_coverage 1
#define GL_COLOR_SAMPLES_NV 0x8E20
#endif /* GL_NV_multisample_coverage */
#ifndef GL_NV_multisample_filter_hint
@@ -9819,11 +9445,13 @@ GLAPI void APIENTRY glProgramBufferParametersIuivNV (GLenum target, GLuint bindi
#define GL_SKIP_MISSING_GLYPH_NV 0x90A9
#define GL_USE_MISSING_GLYPH_NV 0x90AA
#define GL_PATH_ERROR_POSITION_NV 0x90AB
#define GL_PATH_FOG_GEN_MODE_NV 0x90AC
#define GL_ACCUM_ADJACENT_PAIRS_NV 0x90AD
#define GL_ADJACENT_PAIRS_NV 0x90AE
#define GL_FIRST_TO_REST_NV 0x90AF
#define GL_PATH_GEN_MODE_NV 0x90B0
#define GL_PATH_GEN_COEFF_NV 0x90B1
#define GL_PATH_GEN_COLOR_FORMAT_NV 0x90B2
#define GL_PATH_GEN_COMPONENTS_NV 0x90B3
#define GL_PATH_STENCIL_FUNC_NV 0x90B7
#define GL_PATH_STENCIL_REF_NV 0x90B8
@@ -9892,6 +9520,8 @@ GLAPI void APIENTRY glProgramBufferParametersIuivNV (GLenum target, GLuint bindi
#define GL_FONT_UNDERLINE_POSITION_BIT_NV 0x04000000
#define GL_FONT_UNDERLINE_THICKNESS_BIT_NV 0x08000000
#define GL_FONT_HAS_KERNING_BIT_NV 0x10000000
#define GL_PRIMARY_COLOR_NV 0x852C
#define GL_SECONDARY_COLOR_NV 0x852D
#define GL_ROUNDED_RECT_NV 0xE8
#define GL_RELATIVE_ROUNDED_RECT_NV 0xE9
#define GL_ROUNDED_RECT2_NV 0xEA
@@ -9915,10 +9545,6 @@ GLAPI void APIENTRY glProgramBufferParametersIuivNV (GLenum target, GLuint bindi
#define GL_EYE_LINEAR_NV 0x2400
#define GL_OBJECT_LINEAR_NV 0x2401
#define GL_CONSTANT_NV 0x8576
#define GL_PATH_FOG_GEN_MODE_NV 0x90AC
#define GL_PRIMARY_COLOR_NV 0x852C
#define GL_SECONDARY_COLOR_NV 0x852D
#define GL_PATH_GEN_COLOR_FORMAT_NV 0x90B2
#define GL_PATH_PROJECTION_NV 0x1701
#define GL_PATH_MODELVIEW_NV 0x1700
#define GL_PATH_MODELVIEW_STACK_DEPTH_NV 0x0BA3
@@ -9956,6 +9582,9 @@ typedef void (APIENTRYP PFNGLSTENCILSTROKEPATHNVPROC) (GLuint path, GLint refere
typedef void (APIENTRYP PFNGLSTENCILFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues);
typedef void (APIENTRYP PFNGLSTENCILSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues);
typedef void (APIENTRYP PFNGLPATHCOVERDEPTHFUNCNVPROC) (GLenum func);
typedef void (APIENTRYP PFNGLPATHCOLORGENNVPROC) (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs);
typedef void (APIENTRYP PFNGLPATHTEXGENNVPROC) (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs);
typedef void (APIENTRYP PFNGLPATHFOGGENNVPROC) (GLenum genMode);
typedef void (APIENTRYP PFNGLCOVERFILLPATHNVPROC) (GLuint path, GLenum coverMode);
typedef void (APIENTRYP PFNGLCOVERSTROKEPATHNVPROC) (GLuint path, GLenum coverMode);
typedef void (APIENTRYP PFNGLCOVERFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues);
@@ -9968,6 +9597,10 @@ typedef void (APIENTRYP PFNGLGETPATHDASHARRAYNVPROC) (GLuint path, GLfloat *dash
typedef void (APIENTRYP PFNGLGETPATHMETRICSNVPROC) (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics);
typedef void (APIENTRYP PFNGLGETPATHMETRICRANGENVPROC) (GLbitfield metricQueryMask, GLuint firstPathName, GLsizei numPaths, GLsizei stride, GLfloat *metrics);
typedef void (APIENTRYP PFNGLGETPATHSPACINGNVPROC) (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing);
typedef void (APIENTRYP PFNGLGETPATHCOLORGENIVNVPROC) (GLenum color, GLenum pname, GLint *value);
typedef void (APIENTRYP PFNGLGETPATHCOLORGENFVNVPROC) (GLenum color, GLenum pname, GLfloat *value);
typedef void (APIENTRYP PFNGLGETPATHTEXGENIVNVPROC) (GLenum texCoordSet, GLenum pname, GLint *value);
typedef void (APIENTRYP PFNGLGETPATHTEXGENFVNVPROC) (GLenum texCoordSet, GLenum pname, GLfloat *value);
typedef GLboolean (APIENTRYP PFNGLISPOINTINFILLPATHNVPROC) (GLuint path, GLuint mask, GLfloat x, GLfloat y);
typedef GLboolean (APIENTRYP PFNGLISPOINTINSTROKEPATHNVPROC) (GLuint path, GLfloat x, GLfloat y);
typedef GLfloat (APIENTRYP PFNGLGETPATHLENGTHNVPROC) (GLuint path, GLsizei startSegment, GLsizei numSegments);
@@ -9987,13 +9620,6 @@ typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXARRAYNVPROC) (GLuint firstPathName,
typedef GLenum (APIENTRYP PFNGLPATHMEMORYGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale);
typedef void (APIENTRYP PFNGLPROGRAMPATHFRAGMENTINPUTGENNVPROC) (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs);
typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEFVNVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params);
typedef void (APIENTRYP PFNGLPATHCOLORGENNVPROC) (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs);
typedef void (APIENTRYP PFNGLPATHTEXGENNVPROC) (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs);
typedef void (APIENTRYP PFNGLPATHFOGGENNVPROC) (GLenum genMode);
typedef void (APIENTRYP PFNGLGETPATHCOLORGENIVNVPROC) (GLenum color, GLenum pname, GLint *value);
typedef void (APIENTRYP PFNGLGETPATHCOLORGENFVNVPROC) (GLenum color, GLenum pname, GLfloat *value);
typedef void (APIENTRYP PFNGLGETPATHTEXGENIVNVPROC) (GLenum texCoordSet, GLenum pname, GLint *value);
typedef void (APIENTRYP PFNGLGETPATHTEXGENFVNVPROC) (GLenum texCoordSet, GLenum pname, GLfloat *value);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI GLuint APIENTRY glGenPathsNV (GLsizei range);
GLAPI void APIENTRY glDeletePathsNV (GLuint path, GLsizei range);
@@ -10021,6 +9647,9 @@ GLAPI void APIENTRY glStencilStrokePathNV (GLuint path, GLint reference, GLuint
GLAPI void APIENTRY glStencilFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues);
GLAPI void APIENTRY glStencilStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues);
GLAPI void APIENTRY glPathCoverDepthFuncNV (GLenum func);
GLAPI void APIENTRY glPathColorGenNV (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs);
GLAPI void APIENTRY glPathTexGenNV (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs);
GLAPI void APIENTRY glPathFogGenNV (GLenum genMode);
GLAPI void APIENTRY glCoverFillPathNV (GLuint path, GLenum coverMode);
GLAPI void APIENTRY glCoverStrokePathNV (GLuint path, GLenum coverMode);
GLAPI void APIENTRY glCoverFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues);
@@ -10033,6 +9662,10 @@ GLAPI void APIENTRY glGetPathDashArrayNV (GLuint path, GLfloat *dashArray);
GLAPI void APIENTRY glGetPathMetricsNV (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics);
GLAPI void APIENTRY glGetPathMetricRangeNV (GLbitfield metricQueryMask, GLuint firstPathName, GLsizei numPaths, GLsizei stride, GLfloat *metrics);
GLAPI void APIENTRY glGetPathSpacingNV (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing);
GLAPI void APIENTRY glGetPathColorGenivNV (GLenum color, GLenum pname, GLint *value);
GLAPI void APIENTRY glGetPathColorGenfvNV (GLenum color, GLenum pname, GLfloat *value);
GLAPI void APIENTRY glGetPathTexGenivNV (GLenum texCoordSet, GLenum pname, GLint *value);
GLAPI void APIENTRY glGetPathTexGenfvNV (GLenum texCoordSet, GLenum pname, GLfloat *value);
GLAPI GLboolean APIENTRY glIsPointInFillPathNV (GLuint path, GLuint mask, GLfloat x, GLfloat y);
GLAPI GLboolean APIENTRY glIsPointInStrokePathNV (GLuint path, GLfloat x, GLfloat y);
GLAPI GLfloat APIENTRY glGetPathLengthNV (GLuint path, GLsizei startSegment, GLsizei numSegments);
@@ -10052,21 +9685,9 @@ GLAPI GLenum APIENTRY glPathGlyphIndexArrayNV (GLuint firstPathName, GLenum font
GLAPI GLenum APIENTRY glPathMemoryGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale);
GLAPI void APIENTRY glProgramPathFragmentInputGenNV (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs);
GLAPI void APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params);
GLAPI void APIENTRY glPathColorGenNV (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs);
GLAPI void APIENTRY glPathTexGenNV (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs);
GLAPI void APIENTRY glPathFogGenNV (GLenum genMode);
GLAPI void APIENTRY glGetPathColorGenivNV (GLenum color, GLenum pname, GLint *value);
GLAPI void APIENTRY glGetPathColorGenfvNV (GLenum color, GLenum pname, GLfloat *value);
GLAPI void APIENTRY glGetPathTexGenivNV (GLenum texCoordSet, GLenum pname, GLint *value);
GLAPI void APIENTRY glGetPathTexGenfvNV (GLenum texCoordSet, GLenum pname, GLfloat *value);
#endif
#endif /* GL_NV_path_rendering */
#ifndef GL_NV_path_rendering_shared_edge
#define GL_NV_path_rendering_shared_edge 1
#define GL_SHARED_EDGE_NV 0xC0
#endif /* GL_NV_path_rendering_shared_edge */
#ifndef GL_NV_pixel_data_range
#define GL_NV_pixel_data_range 1
#define GL_WRITE_PIXEL_DATA_RANGE_NV 0x8878
@@ -10224,30 +9845,6 @@ GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum stage, GLenum pname,
#endif
#endif /* GL_NV_register_combiners2 */
#ifndef GL_NV_sample_locations
#define GL_NV_sample_locations 1
#define GL_SAMPLE_LOCATION_SUBPIXEL_BITS_NV 0x933D
#define GL_SAMPLE_LOCATION_PIXEL_GRID_WIDTH_NV 0x933E
#define GL_SAMPLE_LOCATION_PIXEL_GRID_HEIGHT_NV 0x933F
#define GL_PROGRAMMABLE_SAMPLE_LOCATION_TABLE_SIZE_NV 0x9340
#define GL_SAMPLE_LOCATION_NV 0x8E50
#define GL_PROGRAMMABLE_SAMPLE_LOCATION_NV 0x9341
#define GL_FRAMEBUFFER_PROGRAMMABLE_SAMPLE_LOCATIONS_NV 0x9342
#define GL_FRAMEBUFFER_SAMPLE_LOCATION_PIXEL_GRID_NV 0x9343
typedef void (APIENTRYP PFNGLFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLenum target, GLuint start, GLsizei count, const GLfloat *v);
typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v);
typedef void (APIENTRYP PFNGLRESOLVEDEPTHVALUESNVPROC) (void);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glFramebufferSampleLocationsfvNV (GLenum target, GLuint start, GLsizei count, const GLfloat *v);
GLAPI void APIENTRY glNamedFramebufferSampleLocationsfvNV (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v);
GLAPI void APIENTRY glResolveDepthValuesNV (void);
#endif
#endif /* GL_NV_sample_locations */
#ifndef GL_NV_sample_mask_override_coverage
#define GL_NV_sample_mask_override_coverage 1
#endif /* GL_NV_sample_mask_override_coverage */
#ifndef GL_NV_shader_atomic_counters
#define GL_NV_shader_atomic_counters 1
#endif /* GL_NV_shader_atomic_counters */
@@ -10256,10 +9853,6 @@ GLAPI void APIENTRY glResolveDepthValuesNV (void);
#define GL_NV_shader_atomic_float 1
#endif /* GL_NV_shader_atomic_float */
#ifndef GL_NV_shader_atomic_fp16_vector
#define GL_NV_shader_atomic_fp16_vector 1
#endif /* GL_NV_shader_atomic_fp16_vector */
#ifndef GL_NV_shader_atomic_int64
#define GL_NV_shader_atomic_int64 1
#endif /* GL_NV_shader_atomic_int64 */
@@ -10583,13 +10176,6 @@ GLAPI void APIENTRY glDrawTransformFeedbackNV (GLenum mode, GLuint id);
#endif
#endif /* GL_NV_transform_feedback2 */
#ifndef GL_NV_uniform_buffer_unified_memory
#define GL_NV_uniform_buffer_unified_memory 1
#define GL_UNIFORM_BUFFER_UNIFIED_NV 0x936E
#define GL_UNIFORM_BUFFER_ADDRESS_NV 0x936F
#define GL_UNIFORM_BUFFER_LENGTH_NV 0x9370
#endif /* GL_NV_uniform_buffer_unified_memory */
#ifndef GL_NV_vdpau_interop
#define GL_NV_vdpau_interop 1
typedef GLintptr GLvdpauSurfaceNV;
@@ -11085,10 +10671,6 @@ GLAPI void APIENTRY glVideoCaptureStreamParameterdvNV (GLuint video_capture_slot
#endif
#endif /* GL_NV_video_capture */
#ifndef GL_NV_viewport_array2
#define GL_NV_viewport_array2 1
#endif /* GL_NV_viewport_array2 */
#ifndef GL_OML_interlace
#define GL_OML_interlace 1
#define GL_INTERLACE_OML 0x8980
@@ -11111,21 +10693,6 @@ GLAPI void APIENTRY glVideoCaptureStreamParameterdvNV (GLuint video_capture_slot
#define GL_FORMAT_SUBSAMPLE_244_244_OML 0x8983
#endif /* GL_OML_subsample */
#ifndef GL_OVR_multiview
#define GL_OVR_multiview 1
#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_NUM_VIEWS_OVR 0x9630
#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_BASE_VIEW_INDEX_OVR 0x9632
#define GL_MAX_VIEWS_OVR 0x9631
typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREMULTIVIEWOVRPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glFramebufferTextureMultiviewOVR (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews);
#endif
#endif /* GL_OVR_multiview */
#ifndef GL_OVR_multiview2
#define GL_OVR_multiview2 1
#endif /* GL_OVR_multiview2 */
#ifndef GL_PGI_misc_hints
#define GL_PGI_misc_hints 1
#define GL_PREFER_DOUBLEBUFFER_HINT_PGI 0x1A1F8
@@ -11682,10 +11249,10 @@ GLAPI void APIENTRY glReferencePlaneSGIX (const GLdouble *equation);
#ifndef GL_SGIX_resample
#define GL_SGIX_resample 1
#define GL_PACK_RESAMPLE_SGIX 0x842E
#define GL_UNPACK_RESAMPLE_SGIX 0x842F
#define GL_RESAMPLE_REPLICATE_SGIX 0x8433
#define GL_RESAMPLE_ZERO_FILL_SGIX 0x8434
#define GL_PACK_RESAMPLE_SGIX 0x842C
#define GL_UNPACK_RESAMPLE_SGIX 0x842D
#define GL_RESAMPLE_REPLICATE_SGIX 0x842E
#define GL_RESAMPLE_ZERO_FILL_SGIX 0x842F
#define GL_RESAMPLE_DECIMATE_SGIX 0x8430
#endif /* GL_SGIX_resample */

View File

@@ -368,6 +368,18 @@ extern Bool glXDrawableAttribARB(Display *dpy, GLXDrawable draw, const int *attr
#endif /* GLX_ARB_render_texture */
/*
* Remove this when glxext.h is updated.
*/
#ifndef GLX_NV_float_buffer
#define GLX_NV_float_buffer 1
#define GLX_FLOAT_COMPONENTS_NV 0x20B0
#endif /* GLX_NV_float_buffer */
/*
* #?. GLX_MESA_swap_frame_usage
*/
@@ -403,6 +415,86 @@ typedef int (*PFNGLXGETSWAPINTERVALMESAPROC)(void);
#endif /* GLX_MESA_swap_control */
/*
* #?. GLX_EXT_texture_from_pixmap
* XXX not finished?
*/
#ifndef GLX_EXT_texture_from_pixmap
#define GLX_EXT_texture_from_pixmap 1
#define GLX_BIND_TO_TEXTURE_RGB_EXT 0x20D0
#define GLX_BIND_TO_TEXTURE_RGBA_EXT 0x20D1
#define GLX_BIND_TO_MIPMAP_TEXTURE_EXT 0x20D2
#define GLX_BIND_TO_TEXTURE_TARGETS_EXT 0x20D3
#define GLX_Y_INVERTED_EXT 0x20D4
#define GLX_TEXTURE_FORMAT_EXT 0x20D5
#define GLX_TEXTURE_TARGET_EXT 0x20D6
#define GLX_MIPMAP_TEXTURE_EXT 0x20D7
#define GLX_TEXTURE_FORMAT_NONE_EXT 0x20D8
#define GLX_TEXTURE_FORMAT_RGB_EXT 0x20D9
#define GLX_TEXTURE_FORMAT_RGBA_EXT 0x20DA
#define GLX_TEXTURE_1D_BIT_EXT 0x00000001
#define GLX_TEXTURE_2D_BIT_EXT 0x00000002
#define GLX_TEXTURE_RECTANGLE_BIT_EXT 0x00000004
#define GLX_TEXTURE_1D_EXT 0x20DB
#define GLX_TEXTURE_2D_EXT 0x20DC
#define GLX_TEXTURE_RECTANGLE_EXT 0x20DD
#define GLX_FRONT_LEFT_EXT 0x20DE
#define GLX_FRONT_RIGHT_EXT 0x20DF
#define GLX_BACK_LEFT_EXT 0x20E0
#define GLX_BACK_RIGHT_EXT 0x20E1
#define GLX_FRONT_EXT GLX_FRONT_LEFT_EXT
#define GLX_BACK_EXT GLX_BACK_LEFT_EXT
#define GLX_AUX0_EXT 0x20E2
#define GLX_AUX1_EXT 0x20E3
#define GLX_AUX2_EXT 0x20E4
#define GLX_AUX3_EXT 0x20E5
#define GLX_AUX4_EXT 0x20E6
#define GLX_AUX5_EXT 0x20E7
#define GLX_AUX6_EXT 0x20E8
#define GLX_AUX7_EXT 0x20E9
#define GLX_AUX8_EXT 0x20EA
#define GLX_AUX9_EXT 0x20EB
extern void glXBindTexImageEXT(Display *dpy, GLXDrawable drawable, int buffer, const int *attrib_list);
extern void glXReleaseTexImageEXT(Display *dpy, GLXDrawable drawable, int buffer);
#endif /* GLX_EXT_texture_from_pixmap */
#ifndef GLX_MESA_query_renderer
#define GLX_MESA_query_renderer 1
#define GLX_RENDERER_VENDOR_ID_MESA 0x8183
#define GLX_RENDERER_DEVICE_ID_MESA 0x8184
#define GLX_RENDERER_VERSION_MESA 0x8185
#define GLX_RENDERER_ACCELERATED_MESA 0x8186
#define GLX_RENDERER_VIDEO_MEMORY_MESA 0x8187
#define GLX_RENDERER_UNIFIED_MEMORY_ARCHITECTURE_MESA 0x8188
#define GLX_RENDERER_PREFERRED_PROFILE_MESA 0x8189
#define GLX_RENDERER_OPENGL_CORE_PROFILE_VERSION_MESA 0x818A
#define GLX_RENDERER_OPENGL_COMPATIBILITY_PROFILE_VERSION_MESA 0x818B
#define GLX_RENDERER_OPENGL_ES_PROFILE_VERSION_MESA 0x818C
#define GLX_RENDERER_OPENGL_ES2_PROFILE_VERSION_MESA 0x818D
#define GLX_RENDERER_ID_MESA 0x818E
Bool glXQueryRendererIntegerMESA(Display *dpy, int screen, int renderer, int attribute, unsigned int *value);
Bool glXQueryCurrentRendererIntegerMESA(int attribute, unsigned int *value);
const char *glXQueryRendererStringMESA(Display *dpy, int screen, int renderer, int attribute);
const char *glXQueryCurrentRendererStringMESA(int attribute);
typedef Bool (*PFNGLXQUERYRENDERERINTEGERMESAPROC) (Display *dpy, int screen, int renderer, int attribute, unsigned int *value);
typedef Bool (*PFNGLXQUERYCURRENTRENDERERINTEGERMESAPROC) (int attribute, unsigned int *value);
typedef const char *(*PFNGLXQUERYRENDERERSTRINGMESAPROC) (Display *dpy, int screen, int renderer, int attribute);
typedef const char *(*PFNGLXQUERYCURRENTRENDERERSTRINGMESAPROC) (int attribute);
#endif /* GLX_MESA_query_renderer */
/*** Should these go here, or in another header? */
/*
** GLX Events

View File

@@ -40,7 +40,14 @@
#ifndef DRI_INTERFACE_H
#define DRI_INTERFACE_H
#ifdef HAVE_LIBDRM
/* For archs with no drm.h */
#if defined(__APPLE__) || defined(__CYGWIN__) || defined(__GNU__)
#ifndef __NOT_HAVE_DRM_H
#define __NOT_HAVE_DRM_H
#endif
#endif
#ifndef __NOT_HAVE_DRM_H
#include <drm.h>
#else
typedef unsigned int drm_context_t;
@@ -78,7 +85,6 @@ typedef struct __DRIdri2ExtensionRec __DRIdri2Extension;
typedef struct __DRIdri2LoaderExtensionRec __DRIdri2LoaderExtension;
typedef struct __DRI2flushExtensionRec __DRI2flushExtension;
typedef struct __DRI2throttleExtensionRec __DRI2throttleExtension;
typedef struct __DRI2fenceExtensionRec __DRI2fenceExtension;
typedef struct __DRIimageLoaderExtensionRec __DRIimageLoaderExtension;
@@ -273,7 +279,6 @@ struct __DRItexBufferExtensionRec {
#define __DRI2_FLUSH_DRAWABLE (1 << 0) /* the drawable should be flushed. */
#define __DRI2_FLUSH_CONTEXT (1 << 1) /* glFlush should be called */
#define __DRI2_FLUSH_INVALIDATE_ANCILLARY (1 << 2)
enum __DRI2throttleReason {
__DRI2_THROTTLE_SWAPBUFFER,
@@ -333,65 +338,6 @@ struct __DRI2throttleExtensionRec {
enum __DRI2throttleReason reason);
};
/**
* Extension for fences / synchronization objects.
*/
#define __DRI2_FENCE "DRI2_Fence"
#define __DRI2_FENCE_VERSION 1
#define __DRI2_FENCE_TIMEOUT_INFINITE 0xffffffffffffffffllu
#define __DRI2_FENCE_FLAG_FLUSH_COMMANDS (1 << 0)
struct __DRI2fenceExtensionRec {
__DRIextension base;
/**
* Create and insert a fence into the command stream of the context.
*/
void *(*create_fence)(__DRIcontext *ctx);
/**
* Get a fence associated with the OpenCL event object.
* This can be NULL, meaning that OpenCL interoperability is not supported.
*/
void *(*get_fence_from_cl_event)(__DRIscreen *screen, intptr_t cl_event);
/**
* Destroy a fence.
*/
void (*destroy_fence)(__DRIscreen *screen, void *fence);
/**
* This function waits and doesn't return until the fence is signalled
* or the timeout expires. It returns true if the fence has been signaled.
*
* \param ctx the context where commands are flushed
* \param fence the fence
* \param flags a combination of __DRI2_FENCE_FLAG_xxx flags
* \param timeout the timeout in ns or __DRI2_FENCE_TIMEOUT_INFINITE
*/
GLboolean (*client_wait_sync)(__DRIcontext *ctx, void *fence,
unsigned flags, uint64_t timeout);
/**
* This function enqueues a wait command into the command stream of
* the context and then returns. When the execution reaches the wait
* command, no further execution will be done in the context until
* the fence is signaled. This is a no-op if the device doesn't support
* parallel execution of contexts.
*
* \param ctx the context where the waiting is done
* \param fence the fence
* \param flags a combination of __DRI2_FENCE_FLAG_xxx flags that make
* sense with this function (right now there are none)
*/
void (*server_wait_sync)(__DRIcontext *ctx, void *fence, unsigned flags);
};
/*@}*/
/**
@@ -495,7 +441,7 @@ struct __DRIdamageExtensionRec {
* SWRast Loader extension.
*/
#define __DRI_SWRAST_LOADER "DRI_SWRastLoader"
#define __DRI_SWRAST_LOADER_VERSION 3
#define __DRI_SWRAST_LOADER_VERSION 2
struct __DRIswrastLoaderExtensionRec {
__DRIextension base;
@@ -528,15 +474,6 @@ struct __DRIswrastLoaderExtensionRec {
void (*putImage2)(__DRIdrawable *drawable, int op,
int x, int y, int width, int height, int stride,
char *data, void *loaderPrivate);
/**
* Put image to drawable
*
* \since 3
*/
void (*getImage2)(__DRIdrawable *readable,
int x, int y, int width, int height, int stride,
char *data, void *loaderPrivate);
};
/**
@@ -1068,7 +1005,7 @@ struct __DRIdri2ExtensionRec {
* extensions.
*/
#define __DRI_IMAGE "DRI_IMAGE"
#define __DRI_IMAGE_VERSION 11
#define __DRI_IMAGE_VERSION 10
/**
* These formats correspond to the similarly named MESA_FORMAT_*
@@ -1103,15 +1040,12 @@ struct __DRIdri2ExtensionRec {
/**
* Four CC formats that matches with WL_DRM_FORMAT_* from wayland_drm.h,
* GBM_FORMAT_* from gbm.h, and DRM_FORMAT_* from drm_fourcc.h. Used with
* createImageFromNames.
* Four CC formats that matches with WL_DRM_FORMAT_* from wayland_drm.h
* and GBM_FORMAT_* from gbm.h, used with createImageFromNames.
*
* \since 5
*/
#define __DRI_IMAGE_FOURCC_R8 0x20203852
#define __DRI_IMAGE_FOURCC_GR88 0x38385247
#define __DRI_IMAGE_FOURCC_RGB565 0x36314752
#define __DRI_IMAGE_FOURCC_ARGB8888 0x34325241
#define __DRI_IMAGE_FOURCC_XRGB8888 0x34325258
@@ -1146,8 +1080,6 @@ struct __DRIdri2ExtensionRec {
#define __DRI_IMAGE_COMPONENTS_Y_U_V 0x3003
#define __DRI_IMAGE_COMPONENTS_Y_UV 0x3004
#define __DRI_IMAGE_COMPONENTS_Y_XUXV 0x3005
#define __DRI_IMAGE_COMPONENTS_R 0x3006
#define __DRI_IMAGE_COMPONENTS_RG 0x3007
/**
@@ -1164,8 +1096,6 @@ struct __DRIdri2ExtensionRec {
#define __DRI_IMAGE_ATTRIB_FD 0x2007 /* available in versions
* 7+. Each query will return a
* new fd. */
#define __DRI_IMAGE_ATTRIB_FOURCC 0x2008 /* available in versions 11 */
#define __DRI_IMAGE_ATTRIB_NUM_PLANES 0x2009 /* available in versions 11 */
enum __DRIYUVColorSpace {
__DRI_YUV_COLOR_SPACE_UNDEFINED = 0,
@@ -1187,8 +1117,7 @@ enum __DRIChromaSiting {
};
/**
* \name Reasons that __DRIimageExtensionRec::createImageFromTexture or
* __DRIimageExtensionRec::createImageFromDmaBufs might fail
* \name Reasons that __DRIimageExtensionRec::createImageFromTexture might fail
*/
/*@{*/
/** Success! */
@@ -1197,14 +1126,11 @@ enum __DRIChromaSiting {
/** Memory allocation failure */
#define __DRI_IMAGE_ERROR_BAD_ALLOC 1
/** Client requested an invalid attribute */
/** Client requested an invalid attribute for a texture object */
#define __DRI_IMAGE_ERROR_BAD_MATCH 2
/** Client requested an invalid texture object */
#define __DRI_IMAGE_ERROR_BAD_PARAMETER 3
/** Client requested an invalid pitch and/or offset */
#define __DRI_IMAGE_ERROR_BAD_ACCESS 4
/*@}*/
/**
@@ -1455,11 +1381,6 @@ typedef struct __DRIDriverVtableExtensionRec {
#define __DRI2_RENDERER_OPENGL_COMPATIBILITY_PROFILE_VERSION 0x0008
#define __DRI2_RENDERER_OPENGL_ES_PROFILE_VERSION 0x0009
#define __DRI2_RENDERER_OPENGL_ES2_PROFILE_VERSION 0x000a
#define __DRI2_RENDERER_HAS_TEXTURE_3D 0x000b
/* Whether there is an sRGB format support for every supported 32-bit UNORM
* color format.
*/
#define __DRI2_RENDERER_HAS_FRAMEBUFFER_SRGB 0x000c
typedef struct __DRI2rendererQueryExtensionRec __DRI2rendererQueryExtension;
struct __DRI2rendererQueryExtensionRec {

View File

@@ -41,8 +41,10 @@
* OSMesaGetIntegerv - return OSMesa state parameters
*
*
* The limits on the width and height of an image buffer can be retrieved
* via OSMesaGetIntegerv(OSMESA_MAX_WIDTH/OSMESA_MAX_HEIGHT).
* The limits on the width and height of an image buffer are MAX_WIDTH and
* MAX_HEIGHT as defined in Mesa/src/config.h. Defaults are 1280 and 1024.
* You can increase them as needed but beware that many temporary arrays in
* Mesa are dimensioned by MAX_WIDTH or MAX_HEIGHT.
*/
@@ -58,8 +60,8 @@ extern "C" {
#include <GL/gl.h>
#define OSMESA_MAJOR_VERSION 11
#define OSMESA_MINOR_VERSION 2
#define OSMESA_MAJOR_VERSION 10
#define OSMESA_MINOR_VERSION 0
#define OSMESA_PATCH_VERSION 0
@@ -95,18 +97,6 @@ extern "C" {
#define OSMESA_MAX_WIDTH 0x24 /* new in 4.0 */
#define OSMESA_MAX_HEIGHT 0x25 /* new in 4.0 */
/*
* Accepted in OSMesaCreateContextAttrib's attribute list.
*/
#define OSMESA_DEPTH_BITS 0x30
#define OSMESA_STENCIL_BITS 0x31
#define OSMESA_ACCUM_BITS 0x32
#define OSMESA_PROFILE 0x33
#define OSMESA_CORE_PROFILE 0x34
#define OSMESA_COMPAT_PROFILE 0x35
#define OSMESA_CONTEXT_MAJOR_VERSION 0x36
#define OSMESA_CONTEXT_MINOR_VERSION 0x37
typedef struct osmesa_context *OSMesaContext;
@@ -139,35 +129,6 @@ OSMesaCreateContextExt( GLenum format, GLint depthBits, GLint stencilBits,
GLint accumBits, OSMesaContext sharelist);
/*
* Create an Off-Screen Mesa rendering context with attribute list.
* The list is composed of (attribute, value) pairs and terminated with
* attribute==0. Supported Attributes:
*
* Attributes Values
* --------------------------------------------------------------------------
* OSMESA_FORMAT OSMESA_RGBA*, OSMESA_BGRA, OSMESA_ARGB, etc.
* OSMESA_DEPTH_BITS 0*, 16, 24, 32
* OSMESA_STENCIL_BITS 0*, 8
* OSMESA_ACCUM_BITS 0*, 16
* OSMESA_PROFILE OSMESA_COMPAT_PROFILE*, OSMESA_CORE_PROFILE
* OSMESA_CONTEXT_MAJOR_VERSION 1*, 2, 3
* OSMESA_CONTEXT_MINOR_VERSION 0+
*
* Note: * = default value
*
* We return a context version >= what's specified by OSMESA_CONTEXT_MAJOR/
* MINOR_VERSION for the given profile. For example, if you request a GL 1.4
* compat profile, you might get a GL 3.0 compat profile.
* Otherwise, null is returned if the version/profile is not supported.
*
* New in Mesa 11.2
*/
GLAPI OSMesaContext GLAPIENTRY
OSMesaCreateContextAttribs( const int *attribList, OSMesaContext sharelist );
/*
* Destroy an Off-Screen Mesa rendering context.
*

140
include/GL/wmesa.h Normal file
View File

@@ -0,0 +1,140 @@
/*
* Mesa 3-D graphics library
* Copyright (C) 1995-1998 Brian Paul
*
* This library is free software; you can redistribute it and/or
* modify it under the terms of the GNU Library General Public
* License as published by the Free Software Foundation; either
* version 2 of the License, or (at your option) any later version.
*
* This library is distributed in the hope that it will be useful,
* but WITHOUT ANY WARRANTY; without even the implied warranty of
* MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
* Library General Public License for more details.
*
* You should have received a copy of the GNU Library General Public
* License along with this library; if not, write to the Free
* Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
*
*/
/*
* Windows driver by: Mark E. Peterson (markp@ic.mankato.mn.us)
* Updated by Li Wei (liwei@aiar.xjtu.edu.cn)
*
*
***************************************************************
* WMesa *
* version 2.3 *
* *
* By *
* Li Wei *
* Institute of Artificial Intelligence & Robotics *
* Xi'an Jiaotong University *
* Email: liwei@aiar.xjtu.edu.cn *
* Web page: http://sun.aiar.xjtu.edu.cn *
* *
* July 7th, 1997 *
***************************************************************
*/
#ifndef WMESA_H
#define WMESA_H
#ifdef __cplusplus
extern "C" {
#endif
#include "GL/gl.h"
#if defined(_MSV_VER) && !defined(__GNUC__)
# pragma warning (disable:4273)
# pragma warning( disable : 4244 ) /* '=' : conversion from 'const double ' to 'float ', possible loss of data */
# pragma warning( disable : 4018 ) /* '<' : signed/unsigned mismatch */
# pragma warning( disable : 4305 ) /* '=' : truncation from 'const double ' to 'float ' */
# pragma warning( disable : 4013 ) /* 'function' undefined; assuming extern returning int */
# pragma warning( disable : 4761 ) /* integral size mismatch in argument; conversion supplied */
# pragma warning( disable : 4273 ) /* 'identifier' : inconsistent DLL linkage. dllexport assumed */
# if (MESA_WARNQUIET>1)
# pragma warning( disable : 4146 ) /* unary minus operator applied to unsigned type, result still unsigned */
# endif
#endif
/*
* This is the WMesa context 'handle':
*/
typedef struct wmesa_context *WMesaContext;
/*
* Create a new WMesaContext for rendering into a window. You must
* have already created the window of correct visual type and with an
* appropriate colormap.
*
* Input:
* hDC - Windows device or memory context
* Pal - Palette to use
* rgb_flag - GL_TRUE = RGB mode,
* GL_FALSE = color index mode
* db_flag - GL_TRUE = double-buffered,
* GL_FALSE = single buffered
* alpha_flag - GL_TRUE = create software alpha buffer,
* GL_FALSE = no software alpha buffer
*
* Note: Indexed mode requires double buffering under Windows.
*
* Return: a WMesa_context or NULL if error.
*/
extern WMesaContext WMesaCreateContext(HDC hDC,HPALETTE* pPal,
GLboolean rgb_flag,
GLboolean db_flag,
GLboolean alpha_flag);
/*
* Destroy a rendering context as returned by WMesaCreateContext()
*/
extern void WMesaDestroyContext( WMesaContext ctx );
/*
* Make the specified context the current one.
*/
extern void WMesaMakeCurrent( WMesaContext ctx, HDC hdc );
/*
* Return a handle to the current context.
*/
extern WMesaContext WMesaGetCurrentContext( void );
/*
* Swap the front and back buffers for the current context. No action
* taken if the context is not double buffered.
*/
extern void WMesaSwapBuffers(HDC hdc);
/*
* In indexed color mode we need to know when the palette changes.
*/
extern void WMesaPaletteChange(HPALETTE Pal);
extern void WMesaMove(void);
void WMesaShareLists(WMesaContext ctx_to_share, WMesaContext ctx);
#ifdef __cplusplus
}
#endif
#endif

File diff suppressed because it is too large Load Diff

View File

@@ -26,7 +26,7 @@
/* Khronos platform-specific types and definitions.
*
* $Revision: 23298 $ on $Date: 2013-09-30 17:07:13 -0700 (Mon, 30 Sep 2013) $
* $Revision: 9356 $ on $Date: 2009-10-21 02:52:25 -0700 (Wed, 21 Oct 2009) $
*
* Adopters may modify this file to suit their platform. Adopters are
* encouraged to submit platform specific modifications to the Khronos
@@ -106,9 +106,9 @@
#elif defined (__SYMBIAN32__)
# define KHRONOS_APICALL IMPORT_C
#elif (defined(__GNUC__) && (__GNUC__ * 100 + __GNUC_MINOR__) >= 303) \
|| (defined(__SUNPRO_C) && (__SUNPRO_C >= 0x590))
|| (defined(__SUNPRO_C) && (__SUNPRO_C >= 0x590))
/* KHRONOS_APIATTRIBUTES is not used by the client API headers yet */
# define KHRONOS_APICALL __attribute__((visibility("default")))
# define KHRONOS_APICALL __attribute__((visibility("default")))
#else
# define KHRONOS_APICALL
#endif
@@ -229,23 +229,10 @@ typedef signed char khronos_int8_t;
typedef unsigned char khronos_uint8_t;
typedef signed short int khronos_int16_t;
typedef unsigned short int khronos_uint16_t;
/*
* Types that differ between LLP64 and LP64 architectures - in LLP64,
* pointers are 64 bits, but 'long' is still 32 bits. Win64 appears
* to be the only LLP64 architecture in current use.
*/
#ifdef _WIN64
typedef signed long long int khronos_intptr_t;
typedef unsigned long long int khronos_uintptr_t;
typedef signed long long int khronos_ssize_t;
typedef unsigned long long int khronos_usize_t;
#else
typedef signed long int khronos_intptr_t;
typedef unsigned long int khronos_uintptr_t;
typedef signed long int khronos_ssize_t;
typedef unsigned long int khronos_usize_t;
#endif
#if KHRONOS_SUPPORT_FLOAT
/*

746
include/VG/openvg.h Normal file
View File

@@ -0,0 +1,746 @@
/* $Revision: 9203 $ on $Date:: 2009-10-07 02:21:52 -0700 #$ */
/*------------------------------------------------------------------------
*
* OpenVG 1.1 Reference Implementation
* -------------------------------------
*
* Copyright (c) 2008 The Khronos Group Inc.
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and /or associated documentation files
* (the "Materials "), to deal in the Materials without restriction,
* including without limitation the rights to use, copy, modify, merge,
* publish, distribute, sublicense, and/or sell copies of the Materials,
* and to permit persons to whom the Materials are furnished to do so,
* subject to the following conditions:
*
* The above copyright notice and this permission notice shall be included
* in all copies or substantial portions of the Materials.
*
* THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
* IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
* DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
* OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
* THE USE OR OTHER DEALINGS IN THE MATERIALS.
*
*//**
* \file
* \brief OpenVG 1.1 API.
*//*-------------------------------------------------------------------*/
#ifndef _OPENVG_H
#define _OPENVG_H
#include <VG/vgplatform.h>
#ifdef __cplusplus
extern "C" {
#endif
#define OPENVG_VERSION_1_0 1
#define OPENVG_VERSION_1_0_1 1
#define OPENVG_VERSION_1_1 2
#ifndef VG_MAXSHORT
#define VG_MAXSHORT 0x7FFF
#endif
#ifndef VG_MAXINT
#define VG_MAXINT 0x7FFFFFFF
#endif
#ifndef VG_MAX_ENUM
#define VG_MAX_ENUM 0x7FFFFFFF
#endif
typedef VGuint VGHandle;
typedef VGHandle VGPath;
typedef VGHandle VGImage;
typedef VGHandle VGMaskLayer;
typedef VGHandle VGFont;
typedef VGHandle VGPaint;
#define VG_INVALID_HANDLE ((VGHandle)0)
typedef enum {
VG_FALSE = 0,
VG_TRUE = 1,
VG_BOOLEAN_FORCE_SIZE = VG_MAX_ENUM
} VGboolean;
typedef enum {
VG_NO_ERROR = 0,
VG_BAD_HANDLE_ERROR = 0x1000,
VG_ILLEGAL_ARGUMENT_ERROR = 0x1001,
VG_OUT_OF_MEMORY_ERROR = 0x1002,
VG_PATH_CAPABILITY_ERROR = 0x1003,
VG_UNSUPPORTED_IMAGE_FORMAT_ERROR = 0x1004,
VG_UNSUPPORTED_PATH_FORMAT_ERROR = 0x1005,
VG_IMAGE_IN_USE_ERROR = 0x1006,
VG_NO_CONTEXT_ERROR = 0x1007,
VG_ERROR_CODE_FORCE_SIZE = VG_MAX_ENUM
} VGErrorCode;
typedef enum {
/* Mode settings */
VG_MATRIX_MODE = 0x1100,
VG_FILL_RULE = 0x1101,
VG_IMAGE_QUALITY = 0x1102,
VG_RENDERING_QUALITY = 0x1103,
VG_BLEND_MODE = 0x1104,
VG_IMAGE_MODE = 0x1105,
/* Scissoring rectangles */
VG_SCISSOR_RECTS = 0x1106,
/* Color Transformation */
VG_COLOR_TRANSFORM = 0x1170,
VG_COLOR_TRANSFORM_VALUES = 0x1171,
/* Stroke parameters */
VG_STROKE_LINE_WIDTH = 0x1110,
VG_STROKE_CAP_STYLE = 0x1111,
VG_STROKE_JOIN_STYLE = 0x1112,
VG_STROKE_MITER_LIMIT = 0x1113,
VG_STROKE_DASH_PATTERN = 0x1114,
VG_STROKE_DASH_PHASE = 0x1115,
VG_STROKE_DASH_PHASE_RESET = 0x1116,
/* Edge fill color for VG_TILE_FILL tiling mode */
VG_TILE_FILL_COLOR = 0x1120,
/* Color for vgClear */
VG_CLEAR_COLOR = 0x1121,
/* Glyph origin */
VG_GLYPH_ORIGIN = 0x1122,
/* Enable/disable alpha masking and scissoring */
VG_MASKING = 0x1130,
VG_SCISSORING = 0x1131,
/* Pixel layout information */
VG_PIXEL_LAYOUT = 0x1140,
VG_SCREEN_LAYOUT = 0x1141,
/* Source format selection for image filters */
VG_FILTER_FORMAT_LINEAR = 0x1150,
VG_FILTER_FORMAT_PREMULTIPLIED = 0x1151,
/* Destination write enable mask for image filters */
VG_FILTER_CHANNEL_MASK = 0x1152,
/* Implementation limits (read-only) */
VG_MAX_SCISSOR_RECTS = 0x1160,
VG_MAX_DASH_COUNT = 0x1161,
VG_MAX_KERNEL_SIZE = 0x1162,
VG_MAX_SEPARABLE_KERNEL_SIZE = 0x1163,
VG_MAX_COLOR_RAMP_STOPS = 0x1164,
VG_MAX_IMAGE_WIDTH = 0x1165,
VG_MAX_IMAGE_HEIGHT = 0x1166,
VG_MAX_IMAGE_PIXELS = 0x1167,
VG_MAX_IMAGE_BYTES = 0x1168,
VG_MAX_FLOAT = 0x1169,
VG_MAX_GAUSSIAN_STD_DEVIATION = 0x116A,
VG_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGParamType;
typedef enum {
VG_RENDERING_QUALITY_NONANTIALIASED = 0x1200,
VG_RENDERING_QUALITY_FASTER = 0x1201,
VG_RENDERING_QUALITY_BETTER = 0x1202, /* Default */
VG_RENDERING_QUALITY_FORCE_SIZE = VG_MAX_ENUM
} VGRenderingQuality;
typedef enum {
VG_PIXEL_LAYOUT_UNKNOWN = 0x1300,
VG_PIXEL_LAYOUT_RGB_VERTICAL = 0x1301,
VG_PIXEL_LAYOUT_BGR_VERTICAL = 0x1302,
VG_PIXEL_LAYOUT_RGB_HORIZONTAL = 0x1303,
VG_PIXEL_LAYOUT_BGR_HORIZONTAL = 0x1304,
VG_PIXEL_LAYOUT_FORCE_SIZE = VG_MAX_ENUM
} VGPixelLayout;
typedef enum {
VG_MATRIX_PATH_USER_TO_SURFACE = 0x1400,
VG_MATRIX_IMAGE_USER_TO_SURFACE = 0x1401,
VG_MATRIX_FILL_PAINT_TO_USER = 0x1402,
VG_MATRIX_STROKE_PAINT_TO_USER = 0x1403,
VG_MATRIX_GLYPH_USER_TO_SURFACE = 0x1404,
VG_MATRIX_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGMatrixMode;
typedef enum {
VG_CLEAR_MASK = 0x1500,
VG_FILL_MASK = 0x1501,
VG_SET_MASK = 0x1502,
VG_UNION_MASK = 0x1503,
VG_INTERSECT_MASK = 0x1504,
VG_SUBTRACT_MASK = 0x1505,
VG_MASK_OPERATION_FORCE_SIZE = VG_MAX_ENUM
} VGMaskOperation;
#define VG_PATH_FORMAT_STANDARD 0
typedef enum {
VG_PATH_DATATYPE_S_8 = 0,
VG_PATH_DATATYPE_S_16 = 1,
VG_PATH_DATATYPE_S_32 = 2,
VG_PATH_DATATYPE_F = 3,
VG_PATH_DATATYPE_FORCE_SIZE = VG_MAX_ENUM
} VGPathDatatype;
typedef enum {
VG_ABSOLUTE = 0,
VG_RELATIVE = 1,
VG_PATH_ABS_REL_FORCE_SIZE = VG_MAX_ENUM
} VGPathAbsRel;
typedef enum {
VG_CLOSE_PATH = ( 0 << 1),
VG_MOVE_TO = ( 1 << 1),
VG_LINE_TO = ( 2 << 1),
VG_HLINE_TO = ( 3 << 1),
VG_VLINE_TO = ( 4 << 1),
VG_QUAD_TO = ( 5 << 1),
VG_CUBIC_TO = ( 6 << 1),
VG_SQUAD_TO = ( 7 << 1),
VG_SCUBIC_TO = ( 8 << 1),
VG_SCCWARC_TO = ( 9 << 1),
VG_SCWARC_TO = (10 << 1),
VG_LCCWARC_TO = (11 << 1),
VG_LCWARC_TO = (12 << 1),
VG_PATH_SEGMENT_FORCE_SIZE = VG_MAX_ENUM
} VGPathSegment;
typedef enum {
VG_MOVE_TO_ABS = VG_MOVE_TO | VG_ABSOLUTE,
VG_MOVE_TO_REL = VG_MOVE_TO | VG_RELATIVE,
VG_LINE_TO_ABS = VG_LINE_TO | VG_ABSOLUTE,
VG_LINE_TO_REL = VG_LINE_TO | VG_RELATIVE,
VG_HLINE_TO_ABS = VG_HLINE_TO | VG_ABSOLUTE,
VG_HLINE_TO_REL = VG_HLINE_TO | VG_RELATIVE,
VG_VLINE_TO_ABS = VG_VLINE_TO | VG_ABSOLUTE,
VG_VLINE_TO_REL = VG_VLINE_TO | VG_RELATIVE,
VG_QUAD_TO_ABS = VG_QUAD_TO | VG_ABSOLUTE,
VG_QUAD_TO_REL = VG_QUAD_TO | VG_RELATIVE,
VG_CUBIC_TO_ABS = VG_CUBIC_TO | VG_ABSOLUTE,
VG_CUBIC_TO_REL = VG_CUBIC_TO | VG_RELATIVE,
VG_SQUAD_TO_ABS = VG_SQUAD_TO | VG_ABSOLUTE,
VG_SQUAD_TO_REL = VG_SQUAD_TO | VG_RELATIVE,
VG_SCUBIC_TO_ABS = VG_SCUBIC_TO | VG_ABSOLUTE,
VG_SCUBIC_TO_REL = VG_SCUBIC_TO | VG_RELATIVE,
VG_SCCWARC_TO_ABS = VG_SCCWARC_TO | VG_ABSOLUTE,
VG_SCCWARC_TO_REL = VG_SCCWARC_TO | VG_RELATIVE,
VG_SCWARC_TO_ABS = VG_SCWARC_TO | VG_ABSOLUTE,
VG_SCWARC_TO_REL = VG_SCWARC_TO | VG_RELATIVE,
VG_LCCWARC_TO_ABS = VG_LCCWARC_TO | VG_ABSOLUTE,
VG_LCCWARC_TO_REL = VG_LCCWARC_TO | VG_RELATIVE,
VG_LCWARC_TO_ABS = VG_LCWARC_TO | VG_ABSOLUTE,
VG_LCWARC_TO_REL = VG_LCWARC_TO | VG_RELATIVE,
VG_PATH_COMMAND_FORCE_SIZE = VG_MAX_ENUM
} VGPathCommand;
typedef enum {
VG_PATH_CAPABILITY_APPEND_FROM = (1 << 0),
VG_PATH_CAPABILITY_APPEND_TO = (1 << 1),
VG_PATH_CAPABILITY_MODIFY = (1 << 2),
VG_PATH_CAPABILITY_TRANSFORM_FROM = (1 << 3),
VG_PATH_CAPABILITY_TRANSFORM_TO = (1 << 4),
VG_PATH_CAPABILITY_INTERPOLATE_FROM = (1 << 5),
VG_PATH_CAPABILITY_INTERPOLATE_TO = (1 << 6),
VG_PATH_CAPABILITY_PATH_LENGTH = (1 << 7),
VG_PATH_CAPABILITY_POINT_ALONG_PATH = (1 << 8),
VG_PATH_CAPABILITY_TANGENT_ALONG_PATH = (1 << 9),
VG_PATH_CAPABILITY_PATH_BOUNDS = (1 << 10),
VG_PATH_CAPABILITY_PATH_TRANSFORMED_BOUNDS = (1 << 11),
VG_PATH_CAPABILITY_ALL = (1 << 12) - 1,
VG_PATH_CAPABILITIES_FORCE_SIZE = VG_MAX_ENUM
} VGPathCapabilities;
typedef enum {
VG_PATH_FORMAT = 0x1600,
VG_PATH_DATATYPE = 0x1601,
VG_PATH_SCALE = 0x1602,
VG_PATH_BIAS = 0x1603,
VG_PATH_NUM_SEGMENTS = 0x1604,
VG_PATH_NUM_COORDS = 0x1605,
VG_PATH_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGPathParamType;
typedef enum {
VG_CAP_BUTT = 0x1700,
VG_CAP_ROUND = 0x1701,
VG_CAP_SQUARE = 0x1702,
VG_CAP_STYLE_FORCE_SIZE = VG_MAX_ENUM
} VGCapStyle;
typedef enum {
VG_JOIN_MITER = 0x1800,
VG_JOIN_ROUND = 0x1801,
VG_JOIN_BEVEL = 0x1802,
VG_JOIN_STYLE_FORCE_SIZE = VG_MAX_ENUM
} VGJoinStyle;
typedef enum {
VG_EVEN_ODD = 0x1900,
VG_NON_ZERO = 0x1901,
VG_FILL_RULE_FORCE_SIZE = VG_MAX_ENUM
} VGFillRule;
typedef enum {
VG_STROKE_PATH = (1 << 0),
VG_FILL_PATH = (1 << 1),
VG_PAINT_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGPaintMode;
typedef enum {
/* Color paint parameters */
VG_PAINT_TYPE = 0x1A00,
VG_PAINT_COLOR = 0x1A01,
VG_PAINT_COLOR_RAMP_SPREAD_MODE = 0x1A02,
VG_PAINT_COLOR_RAMP_PREMULTIPLIED = 0x1A07,
VG_PAINT_COLOR_RAMP_STOPS = 0x1A03,
/* Linear gradient paint parameters */
VG_PAINT_LINEAR_GRADIENT = 0x1A04,
/* Radial gradient paint parameters */
VG_PAINT_RADIAL_GRADIENT = 0x1A05,
/* Pattern paint parameters */
VG_PAINT_PATTERN_TILING_MODE = 0x1A06,
VG_PAINT_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGPaintParamType;
typedef enum {
VG_PAINT_TYPE_COLOR = 0x1B00,
VG_PAINT_TYPE_LINEAR_GRADIENT = 0x1B01,
VG_PAINT_TYPE_RADIAL_GRADIENT = 0x1B02,
VG_PAINT_TYPE_PATTERN = 0x1B03,
VG_PAINT_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGPaintType;
typedef enum {
VG_COLOR_RAMP_SPREAD_PAD = 0x1C00,
VG_COLOR_RAMP_SPREAD_REPEAT = 0x1C01,
VG_COLOR_RAMP_SPREAD_REFLECT = 0x1C02,
VG_COLOR_RAMP_SPREAD_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGColorRampSpreadMode;
typedef enum {
VG_TILE_FILL = 0x1D00,
VG_TILE_PAD = 0x1D01,
VG_TILE_REPEAT = 0x1D02,
VG_TILE_REFLECT = 0x1D03,
VG_TILING_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGTilingMode;
typedef enum {
/* RGB{A,X} channel ordering */
VG_sRGBX_8888 = 0,
VG_sRGBA_8888 = 1,
VG_sRGBA_8888_PRE = 2,
VG_sRGB_565 = 3,
VG_sRGBA_5551 = 4,
VG_sRGBA_4444 = 5,
VG_sL_8 = 6,
VG_lRGBX_8888 = 7,
VG_lRGBA_8888 = 8,
VG_lRGBA_8888_PRE = 9,
VG_lL_8 = 10,
VG_A_8 = 11,
VG_BW_1 = 12,
VG_A_1 = 13,
VG_A_4 = 14,
/* {A,X}RGB channel ordering */
VG_sXRGB_8888 = 0 | (1 << 6),
VG_sARGB_8888 = 1 | (1 << 6),
VG_sARGB_8888_PRE = 2 | (1 << 6),
VG_sARGB_1555 = 4 | (1 << 6),
VG_sARGB_4444 = 5 | (1 << 6),
VG_lXRGB_8888 = 7 | (1 << 6),
VG_lARGB_8888 = 8 | (1 << 6),
VG_lARGB_8888_PRE = 9 | (1 << 6),
/* BGR{A,X} channel ordering */
VG_sBGRX_8888 = 0 | (1 << 7),
VG_sBGRA_8888 = 1 | (1 << 7),
VG_sBGRA_8888_PRE = 2 | (1 << 7),
VG_sBGR_565 = 3 | (1 << 7),
VG_sBGRA_5551 = 4 | (1 << 7),
VG_sBGRA_4444 = 5 | (1 << 7),
VG_lBGRX_8888 = 7 | (1 << 7),
VG_lBGRA_8888 = 8 | (1 << 7),
VG_lBGRA_8888_PRE = 9 | (1 << 7),
/* {A,X}BGR channel ordering */
VG_sXBGR_8888 = 0 | (1 << 6) | (1 << 7),
VG_sABGR_8888 = 1 | (1 << 6) | (1 << 7),
VG_sABGR_8888_PRE = 2 | (1 << 6) | (1 << 7),
VG_sABGR_1555 = 4 | (1 << 6) | (1 << 7),
VG_sABGR_4444 = 5 | (1 << 6) | (1 << 7),
VG_lXBGR_8888 = 7 | (1 << 6) | (1 << 7),
VG_lABGR_8888 = 8 | (1 << 6) | (1 << 7),
VG_lABGR_8888_PRE = 9 | (1 << 6) | (1 << 7),
VG_IMAGE_FORMAT_FORCE_SIZE = VG_MAX_ENUM
} VGImageFormat;
typedef enum {
VG_IMAGE_QUALITY_NONANTIALIASED = (1 << 0),
VG_IMAGE_QUALITY_FASTER = (1 << 1),
VG_IMAGE_QUALITY_BETTER = (1 << 2),
VG_IMAGE_QUALITY_FORCE_SIZE = VG_MAX_ENUM
} VGImageQuality;
typedef enum {
VG_IMAGE_FORMAT = 0x1E00,
VG_IMAGE_WIDTH = 0x1E01,
VG_IMAGE_HEIGHT = 0x1E02,
VG_IMAGE_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGImageParamType;
typedef enum {
VG_DRAW_IMAGE_NORMAL = 0x1F00,
VG_DRAW_IMAGE_MULTIPLY = 0x1F01,
VG_DRAW_IMAGE_STENCIL = 0x1F02,
VG_IMAGE_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGImageMode;
typedef enum {
VG_RED = (1 << 3),
VG_GREEN = (1 << 2),
VG_BLUE = (1 << 1),
VG_ALPHA = (1 << 0),
VG_IMAGE_CHANNEL_FORCE_SIZE = VG_MAX_ENUM
} VGImageChannel;
typedef enum {
VG_BLEND_SRC = 0x2000,
VG_BLEND_SRC_OVER = 0x2001,
VG_BLEND_DST_OVER = 0x2002,
VG_BLEND_SRC_IN = 0x2003,
VG_BLEND_DST_IN = 0x2004,
VG_BLEND_MULTIPLY = 0x2005,
VG_BLEND_SCREEN = 0x2006,
VG_BLEND_DARKEN = 0x2007,
VG_BLEND_LIGHTEN = 0x2008,
VG_BLEND_ADDITIVE = 0x2009,
VG_BLEND_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGBlendMode;
typedef enum {
VG_FONT_NUM_GLYPHS = 0x2F00,
VG_FONT_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGFontParamType;
typedef enum {
VG_IMAGE_FORMAT_QUERY = 0x2100,
VG_PATH_DATATYPE_QUERY = 0x2101,
VG_HARDWARE_QUERY_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGHardwareQueryType;
typedef enum {
VG_HARDWARE_ACCELERATED = 0x2200,
VG_HARDWARE_UNACCELERATED = 0x2201,
VG_HARDWARE_QUERY_RESULT_FORCE_SIZE = VG_MAX_ENUM
} VGHardwareQueryResult;
typedef enum {
VG_VENDOR = 0x2300,
VG_RENDERER = 0x2301,
VG_VERSION = 0x2302,
VG_EXTENSIONS = 0x2303,
VG_STRING_ID_FORCE_SIZE = VG_MAX_ENUM
} VGStringID;
/* Function Prototypes */
#ifndef VG_API_CALL
# error VG_API_CALL must be defined
#endif
#ifndef VG_API_ENTRY
# error VG_API_ENTRY must be defined
#endif
#ifndef VG_API_EXIT
# error VG_API_EXIT must be defined
#endif
VG_API_CALL VGErrorCode VG_API_ENTRY vgGetError(void) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgFlush(void) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgFinish(void) VG_API_EXIT;
/* Getters and Setters */
VG_API_CALL void VG_API_ENTRY vgSetf (VGParamType type, VGfloat value) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSeti (VGParamType type, VGint value) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetfv(VGParamType type, VGint count,
const VGfloat * values) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetiv(VGParamType type, VGint count,
const VGint * values) VG_API_EXIT;
VG_API_CALL VGfloat VG_API_ENTRY vgGetf(VGParamType type) VG_API_EXIT;
VG_API_CALL VGint VG_API_ENTRY vgGeti(VGParamType type) VG_API_EXIT;
VG_API_CALL VGint VG_API_ENTRY vgGetVectorSize(VGParamType type) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetfv(VGParamType type, VGint count, VGfloat * values) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetiv(VGParamType type, VGint count, VGint * values) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetParameterf(VGHandle object,
VGint paramType,
VGfloat value) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetParameteri(VGHandle object,
VGint paramType,
VGint value) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetParameterfv(VGHandle object,
VGint paramType,
VGint count, const VGfloat * values) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetParameteriv(VGHandle object,
VGint paramType,
VGint count, const VGint * values) VG_API_EXIT;
VG_API_CALL VGfloat VG_API_ENTRY vgGetParameterf(VGHandle object,
VGint paramType) VG_API_EXIT;
VG_API_CALL VGint VG_API_ENTRY vgGetParameteri(VGHandle object,
VGint paramType);
VG_API_CALL VGint VG_API_ENTRY vgGetParameterVectorSize(VGHandle object,
VGint paramType) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetParameterfv(VGHandle object,
VGint paramType,
VGint count, VGfloat * values) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetParameteriv(VGHandle object,
VGint paramType,
VGint count, VGint * values) VG_API_EXIT;
/* Matrix Manipulation */
VG_API_CALL void VG_API_ENTRY vgLoadIdentity(void) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgLoadMatrix(const VGfloat * m) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetMatrix(VGfloat * m) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgMultMatrix(const VGfloat * m) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgTranslate(VGfloat tx, VGfloat ty) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgScale(VGfloat sx, VGfloat sy) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgShear(VGfloat shx, VGfloat shy) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgRotate(VGfloat angle) VG_API_EXIT;
/* Masking and Clearing */
VG_API_CALL void VG_API_ENTRY vgMask(VGHandle mask, VGMaskOperation operation,
VGint x, VGint y,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgRenderToMask(VGPath path,
VGbitfield paintModes,
VGMaskOperation operation) VG_API_EXIT;
VG_API_CALL VGMaskLayer VG_API_ENTRY vgCreateMaskLayer(VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDestroyMaskLayer(VGMaskLayer maskLayer) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgFillMaskLayer(VGMaskLayer maskLayer,
VGint x, VGint y,
VGint width, VGint height,
VGfloat value) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgCopyMask(VGMaskLayer maskLayer,
VGint dx, VGint dy,
VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgClear(VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
/* Paths */
VG_API_CALL VGPath VG_API_ENTRY vgCreatePath(VGint pathFormat,
VGPathDatatype datatype,
VGfloat scale, VGfloat bias,
VGint segmentCapacityHint,
VGint coordCapacityHint,
VGbitfield capabilities) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgClearPath(VGPath path, VGbitfield capabilities) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDestroyPath(VGPath path) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgRemovePathCapabilities(VGPath path,
VGbitfield capabilities) VG_API_EXIT;
VG_API_CALL VGbitfield VG_API_ENTRY vgGetPathCapabilities(VGPath path) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgAppendPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgAppendPathData(VGPath dstPath,
VGint numSegments,
const VGubyte * pathSegments,
const void * pathData) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgModifyPathCoords(VGPath dstPath, VGint startIndex,
VGint numSegments,
const void * pathData) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgTransformPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT;
VG_API_CALL VGboolean VG_API_ENTRY vgInterpolatePath(VGPath dstPath,
VGPath startPath,
VGPath endPath,
VGfloat amount) VG_API_EXIT;
VG_API_CALL VGfloat VG_API_ENTRY vgPathLength(VGPath path,
VGint startSegment, VGint numSegments) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgPointAlongPath(VGPath path,
VGint startSegment, VGint numSegments,
VGfloat distance,
VGfloat * x, VGfloat * y,
VGfloat * tangentX, VGfloat * tangentY) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgPathBounds(VGPath path,
VGfloat * minX, VGfloat * minY,
VGfloat * width, VGfloat * height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgPathTransformedBounds(VGPath path,
VGfloat * minX, VGfloat * minY,
VGfloat * width, VGfloat * height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDrawPath(VGPath path, VGbitfield paintModes) VG_API_EXIT;
/* Paint */
VG_API_CALL VGPaint VG_API_ENTRY vgCreatePaint(void) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDestroyPaint(VGPaint paint) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetPaint(VGPaint paint, VGbitfield paintModes) VG_API_EXIT;
VG_API_CALL VGPaint VG_API_ENTRY vgGetPaint(VGPaintMode paintMode) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetColor(VGPaint paint, VGuint rgba) VG_API_EXIT;
VG_API_CALL VGuint VG_API_ENTRY vgGetColor(VGPaint paint) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgPaintPattern(VGPaint paint, VGImage pattern) VG_API_EXIT;
/* Images */
VG_API_CALL VGImage VG_API_ENTRY vgCreateImage(VGImageFormat format,
VGint width, VGint height,
VGbitfield allowedQuality) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDestroyImage(VGImage image) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgClearImage(VGImage image,
VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgImageSubData(VGImage image,
const void * data, VGint dataStride,
VGImageFormat dataFormat,
VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetImageSubData(VGImage image,
void * data, VGint dataStride,
VGImageFormat dataFormat,
VGint x, VGint y,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL VGImage VG_API_ENTRY vgChildImage(VGImage parent,
VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
VG_API_CALL VGImage VG_API_ENTRY vgGetParent(VGImage image) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgCopyImage(VGImage dst, VGint dx, VGint dy,
VGImage src, VGint sx, VGint sy,
VGint width, VGint height,
VGboolean dither) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDrawImage(VGImage image) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetPixels(VGint dx, VGint dy,
VGImage src, VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgWritePixels(const void * data, VGint dataStride,
VGImageFormat dataFormat,
VGint dx, VGint dy,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetPixels(VGImage dst, VGint dx, VGint dy,
VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgReadPixels(void * data, VGint dataStride,
VGImageFormat dataFormat,
VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgCopyPixels(VGint dx, VGint dy,
VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
/* Text */
VG_API_CALL VGFont VG_API_ENTRY vgCreateFont(VGint glyphCapacityHint) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDestroyFont(VGFont font) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetGlyphToPath(VGFont font,
VGuint glyphIndex,
VGPath path,
VGboolean isHinted,
const VGfloat glyphOrigin [2],
const VGfloat escapement[2]) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetGlyphToImage(VGFont font,
VGuint glyphIndex,
VGImage image,
const VGfloat glyphOrigin [2],
const VGfloat escapement[2]) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgClearGlyph(VGFont font,VGuint glyphIndex) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDrawGlyph(VGFont font,
VGuint glyphIndex,
VGbitfield paintModes,
VGboolean allowAutoHinting) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDrawGlyphs(VGFont font,
VGint glyphCount,
const VGuint *glyphIndices,
const VGfloat *adjustments_x,
const VGfloat *adjustments_y,
VGbitfield paintModes,
VGboolean allowAutoHinting) VG_API_EXIT;
/* Image Filters */
VG_API_CALL void VG_API_ENTRY vgColorMatrix(VGImage dst, VGImage src,
const VGfloat * matrix) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgConvolve(VGImage dst, VGImage src,
VGint kernelWidth, VGint kernelHeight,
VGint shiftX, VGint shiftY,
const VGshort * kernel,
VGfloat scale,
VGfloat bias,
VGTilingMode tilingMode) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSeparableConvolve(VGImage dst, VGImage src,
VGint kernelWidth,
VGint kernelHeight,
VGint shiftX, VGint shiftY,
const VGshort * kernelX,
const VGshort * kernelY,
VGfloat scale,
VGfloat bias,
VGTilingMode tilingMode) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGaussianBlur(VGImage dst, VGImage src,
VGfloat stdDeviationX,
VGfloat stdDeviationY,
VGTilingMode tilingMode) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgLookup(VGImage dst, VGImage src,
const VGubyte * redLUT,
const VGubyte * greenLUT,
const VGubyte * blueLUT,
const VGubyte * alphaLUT,
VGboolean outputLinear,
VGboolean outputPremultiplied) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgLookupSingle(VGImage dst, VGImage src,
const VGuint * lookupTable,
VGImageChannel sourceChannel,
VGboolean outputLinear,
VGboolean outputPremultiplied) VG_API_EXIT;
/* Hardware Queries */
VG_API_CALL VGHardwareQueryResult VG_API_ENTRY vgHardwareQuery(VGHardwareQueryType key,
VGint setting) VG_API_EXIT;
/* Renderer and Extension Information */
VG_API_CALL const VGubyte * VG_API_ENTRY vgGetString(VGStringID name) VG_API_EXIT;
#ifdef __cplusplus
} /* extern "C" */
#endif
#endif /* _OPENVG_H */

233
include/VG/vgext.h Normal file
View File

@@ -0,0 +1,233 @@
/* $Revision: 6810 $ on $Date:: 2008-10-29 07:31:37 -0700 #$ */
/*------------------------------------------------------------------------
*
* VG extensions Reference Implementation
* -------------------------------------
*
* Copyright (c) 2008 The Khronos Group Inc.
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and /or associated documentation files
* (the "Materials "), to deal in the Materials without restriction,
* including without limitation the rights to use, copy, modify, merge,
* publish, distribute, sublicense, and/or sell copies of the Materials,
* and to permit persons to whom the Materials are furnished to do so,
* subject to the following conditions:
*
* The above copyright notice and this permission notice shall be included
* in all copies or substantial portions of the Materials.
*
* THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
* IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
* DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
* OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
* THE USE OR OTHER DEALINGS IN THE MATERIALS.
*
*//**
* \file
* \brief VG extensions
*//*-------------------------------------------------------------------*/
#ifndef _VGEXT_H
#define _VGEXT_H
#ifdef __cplusplus
extern "C" {
#endif
#include <VG/openvg.h>
#include <VG/vgu.h>
#ifndef VG_API_ENTRYP
# define VG_API_ENTRYP VG_API_ENTRY*
#endif
#ifndef VGU_API_ENTRYP
# define VGU_API_ENTRYP VGU_API_ENTRY*
#endif
/*-------------------------------------------------------------------------------
* KHR extensions
*------------------------------------------------------------------------------*/
typedef enum {
#ifndef VG_KHR_iterative_average_blur
VG_MAX_AVERAGE_BLUR_DIMENSION_KHR = 0x116B,
VG_AVERAGE_BLUR_DIMENSION_RESOLUTION_KHR = 0x116C,
VG_MAX_AVERAGE_BLUR_ITERATIONS_KHR = 0x116D,
#endif
VG_PARAM_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM
} VGParamTypeKHR;
#ifndef VG_KHR_EGL_image
#define VG_KHR_EGL_image 1
/* VGEGLImageKHR is an opaque handle to an EGLImage */
typedef void* VGeglImageKHR;
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL VGImage VG_API_ENTRY vgCreateEGLImageTargetKHR(VGeglImageKHR image);
#endif
typedef VGImage (VG_API_ENTRYP PFNVGCREATEEGLIMAGETARGETKHRPROC) (VGeglImageKHR image);
#endif
#ifndef VG_KHR_iterative_average_blur
#define VG_KHR_iterative_average_blur 1
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL void vgIterativeAverageBlurKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
#endif
typedef void (VG_API_ENTRYP PFNVGITERATIVEAVERAGEBLURKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
#endif
#ifndef VG_KHR_advanced_blending
#define VG_KHR_advanced_blending 1
typedef enum {
VG_BLEND_OVERLAY_KHR = 0x2010,
VG_BLEND_HARDLIGHT_KHR = 0x2011,
VG_BLEND_SOFTLIGHT_SVG_KHR = 0x2012,
VG_BLEND_SOFTLIGHT_KHR = 0x2013,
VG_BLEND_COLORDODGE_KHR = 0x2014,
VG_BLEND_COLORBURN_KHR = 0x2015,
VG_BLEND_DIFFERENCE_KHR = 0x2016,
VG_BLEND_SUBTRACT_KHR = 0x2017,
VG_BLEND_INVERT_KHR = 0x2018,
VG_BLEND_EXCLUSION_KHR = 0x2019,
VG_BLEND_LINEARDODGE_KHR = 0x201a,
VG_BLEND_LINEARBURN_KHR = 0x201b,
VG_BLEND_VIVIDLIGHT_KHR = 0x201c,
VG_BLEND_LINEARLIGHT_KHR = 0x201d,
VG_BLEND_PINLIGHT_KHR = 0x201e,
VG_BLEND_HARDMIX_KHR = 0x201f,
VG_BLEND_CLEAR_KHR = 0x2020,
VG_BLEND_DST_KHR = 0x2021,
VG_BLEND_SRC_OUT_KHR = 0x2022,
VG_BLEND_DST_OUT_KHR = 0x2023,
VG_BLEND_SRC_ATOP_KHR = 0x2024,
VG_BLEND_DST_ATOP_KHR = 0x2025,
VG_BLEND_XOR_KHR = 0x2026,
VG_BLEND_MODE_KHR_FORCE_SIZE= VG_MAX_ENUM
} VGBlendModeKHR;
#endif
#ifndef VG_KHR_parametric_filter
#define VG_KHR_parametric_filter 1
typedef enum {
VG_PF_OBJECT_VISIBLE_FLAG_KHR = (1 << 0),
VG_PF_KNOCKOUT_FLAG_KHR = (1 << 1),
VG_PF_OUTER_FLAG_KHR = (1 << 2),
VG_PF_INNER_FLAG_KHR = (1 << 3),
VG_PF_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM
} VGPfTypeKHR;
typedef enum {
VGU_IMAGE_IN_USE_ERROR = 0xF010,
VGU_ERROR_CODE_KHR_FORCE_SIZE = VG_MAX_ENUM
} VGUErrorCodeKHR;
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL void VG_API_ENTRY vgParametricFilterKHR(VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguDropShadowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA) ;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
#endif
typedef void (VG_API_ENTRYP PFNVGPARAMETRICFILTERKHRPROC) (VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUDROPSHADOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
#endif
/*-------------------------------------------------------------------------------
* NDS extensions
*------------------------------------------------------------------------------*/
#ifndef VG_NDS_paint_generation
#define VG_NDS_paint_generation 1
typedef enum {
VG_PAINT_COLOR_RAMP_LINEAR_NDS = 0x1A10,
VG_COLOR_MATRIX_NDS = 0x1A11,
VG_PAINT_COLOR_TRANSFORM_LINEAR_NDS = 0x1A12,
VG_PAINT_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGPaintParamTypeNds;
typedef enum {
VG_DRAW_IMAGE_COLOR_MATRIX_NDS = 0x1F10,
VG_IMAGE_MODE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGImageModeNds;
#endif
#ifndef VG_NDS_projective_geometry
#define VG_NDS_projective_geometry 1
typedef enum {
VG_CLIP_MODE_NDS = 0x1180,
VG_CLIP_LINES_NDS = 0x1181,
VG_MAX_CLIP_LINES_NDS = 0x1182,
VG_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGParamTypeNds;
typedef enum {
VG_CLIPMODE_NONE_NDS = 0x3000,
VG_CLIPMODE_CLIP_CLOSED_NDS = 0x3001,
VG_CLIPMODE_CLIP_OPEN_NDS = 0x3002,
VG_CLIPMODE_CULL_NDS = 0x3003,
VG_CLIPMODE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGClipModeNds;
typedef enum {
VG_RQUAD_TO_NDS = ( 13 << 1 ),
VG_RCUBIC_TO_NDS = ( 14 << 1 ),
VG_PATH_SEGMENT_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGPathSegmentNds;
typedef enum {
VG_RQUAD_TO_ABS_NDS = (VG_RQUAD_TO_NDS | VG_ABSOLUTE),
VG_RQUAD_TO_REL_NDS = (VG_RQUAD_TO_NDS | VG_RELATIVE),
VG_RCUBIC_TO_ABS_NDS = (VG_RCUBIC_TO_NDS | VG_ABSOLUTE),
VG_RCUBIC_TO_REL_NDS = (VG_RCUBIC_TO_NDS | VG_RELATIVE),
VG_PATH_COMMAND_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGPathCommandNds;
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL void VG_API_ENTRY vgProjectiveMatrixNDS(VGboolean enable) ;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguTransformClipLineNDS(const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
#endif
typedef void (VG_API_ENTRYP PFNVGPROJECTIVEMATRIXNDSPROC) (VGboolean enable) ;
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUTRANSFORMCLIPLINENDSPROC) (const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
#endif
#ifdef __cplusplus
} /* extern "C" */
#endif
#endif /* _VGEXT_H */

92
include/VG/vgplatform.h Normal file
View File

@@ -0,0 +1,92 @@
/* $Revision: 6810 $ on $Date:: 2008-10-29 07:31:37 -0700 #$ */
/*------------------------------------------------------------------------
*
* VG platform specific header Reference Implementation
* ----------------------------------------------------
*
* Copyright (c) 2008 The Khronos Group Inc.
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and /or associated documentation files
* (the "Materials "), to deal in the Materials without restriction,
* including without limitation the rights to use, copy, modify, merge,
* publish, distribute, sublicense, and/or sell copies of the Materials,
* and to permit persons to whom the Materials are furnished to do so,
* subject to the following conditions:
*
* The above copyright notice and this permission notice shall be included
* in all copies or substantial portions of the Materials.
*
* THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
* IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
* DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
* OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
* THE USE OR OTHER DEALINGS IN THE MATERIALS.
*
*//**
* \file
* \brief VG platform specific header
*//*-------------------------------------------------------------------*/
#ifndef _VGPLATFORM_H
#define _VGPLATFORM_H
#include <KHR/khrplatform.h>
#ifdef __cplusplus
extern "C" {
#endif
#ifndef VG_API_CALL
#if defined(OPENVG_STATIC_LIBRARY)
# define VG_API_CALL
#else
# define VG_API_CALL KHRONOS_APICALL
#endif /* defined OPENVG_STATIC_LIBRARY */
#endif /* ifndef VG_API_CALL */
#ifndef VGU_API_CALL
#if defined(OPENVG_STATIC_LIBRARY)
# define VGU_API_CALL
#else
# define VGU_API_CALL KHRONOS_APICALL
#endif /* defined OPENVG_STATIC_LIBRARY */
#endif /* ifndef VGU_API_CALL */
#ifndef VG_API_ENTRY
#define VG_API_ENTRY
#endif
#ifndef VG_API_EXIT
#define VG_API_EXIT
#endif
#ifndef VGU_API_ENTRY
#define VGU_API_ENTRY
#endif
#ifndef VGU_API_EXIT
#define VGU_API_EXIT
#endif
typedef float VGfloat;
typedef signed char VGbyte;
typedef unsigned char VGubyte;
typedef signed short VGshort;
typedef signed int VGint;
typedef unsigned int VGuint;
typedef unsigned int VGbitfield;
#ifndef VG_VGEXT_PROTOTYPES
#define VG_VGEXT_PROTOTYPES
#endif
#ifdef __cplusplus
} /* extern "C" */
#endif
#endif /* _VGPLATFORM_H */

Some files were not shown because too many files have changed in this diff Show More