Add release notes for the 10.5.6 release

Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>

.dir-locals.el

@@ -5,7 +5,6 @@
   (c-file-style . "stroustrup")
   (fill-column . 78)
   (eval . (progn
-	    (c-set-offset 'case-label '0)
 	    (c-set-offset 'innamespace '0)
 	    (c-set-offset 'inline-open '0)))
   )

.gitignore

@@ -45,4 +45,3 @@ manifest.txt
 .libs/
 Makefile
 Makefile.in
-.install-mesa-links

.travis.yml

@@ -1,101 +0,0 @@
-language: c
-
-sudo: false
-
-cache:
-  directories:
-    - $HOME/.ccache
-
-addons:
-  apt:
-    packages:
-      - libdrm-dev
-      - libudev-dev
-      - x11proto-xf86vidmode-dev
-      - libexpat1-dev
-      - libxcb-dri2-0-dev
-      - libx11-xcb-dev
-      - llvm-3.4-dev
-      - scons
-
-env:
-  global:
-    - XORG_RELEASES=http://xorg.freedesktop.org/releases/individual
-    - XCB_RELEASES=http://xcb.freedesktop.org/dist
-    - XORGMACROS_VERSION=util-macros-1.19.0
-    - GLPROTO_VERSION=glproto-1.4.17
-    - DRI2PROTO_VERSION=dri2proto-2.8
-    - DRI3PROTO_VERSION=dri3proto-1.0
-    - PRESENTPROTO_VERSION=presentproto-1.0
-    - LIBPCIACCESS_VERSION=libpciaccess-0.13.4
-    - LIBDRM_VERSION=libdrm-2.4.65
-    - XCBPROTO_VERSION=xcb-proto-1.11
-    - LIBXCB_VERSION=libxcb-1.11
-    - LIBXSHMFENCE_VERSION=libxshmfence-1.2
-    - PKG_CONFIG_PATH=$HOME/prefix/lib/pkgconfig
-  matrix:
-    - BUILD=make
-    - BUILD=scons
-
-install:
-  - export PATH="/usr/lib/ccache:$PATH"
-  - pip install --user mako
-
-  # Install dependencies where we require specific versions (or where
-  # disallowed by Travis CI's package whitelisting).
-
-  - wget $XORG_RELEASES/util/$XORGMACROS_VERSION.tar.bz2
-  - tar -jxvf $XORGMACROS_VERSION.tar.bz2
-  - (cd $XORGMACROS_VERSION && ./configure --prefix=$HOME/prefix && make install)
-
-  - wget $XORG_RELEASES/proto/$GLPROTO_VERSION.tar.bz2
-  - tar -jxvf $GLPROTO_VERSION.tar.bz2
-  - (cd $GLPROTO_VERSION && ./configure --prefix=$HOME/prefix && make install)
-
-  - wget $XORG_RELEASES/proto/$DRI2PROTO_VERSION.tar.bz2
-  - tar -jxvf $DRI2PROTO_VERSION.tar.bz2
-  - (cd $DRI2PROTO_VERSION && ./configure --prefix=$HOME/prefix && make install)
-
-  - wget $XORG_RELEASES/proto/$DRI3PROTO_VERSION.tar.bz2
-  - tar -jxvf $DRI3PROTO_VERSION.tar.bz2
-  - (cd $DRI3PROTO_VERSION && ./configure --prefix=$HOME/prefix && make install)
-
-  - wget $XORG_RELEASES/proto/$PRESENTPROTO_VERSION.tar.bz2
-  - tar -jxvf $PRESENTPROTO_VERSION.tar.bz2
-  - (cd $PRESENTPROTO_VERSION && ./configure --prefix=$HOME/prefix && make install)
-
-  - wget $XCB_RELEASES/$XCBPROTO_VERSION.tar.bz2
-  - tar -jxvf $XCBPROTO_VERSION.tar.bz2
-  - (cd $XCBPROTO_VERSION && ./configure --prefix=$HOME/prefix && make install)
-
-  - wget $XCB_RELEASES/$LIBXCB_VERSION.tar.bz2
-  - tar -jxvf $LIBXCB_VERSION.tar.bz2
-  - (cd $LIBXCB_VERSION && ./configure --prefix=$HOME/prefix && make install)
-
-  - wget $XORG_RELEASES/lib/$LIBPCIACCESS_VERSION.tar.bz2
-  - tar -jxvf $LIBPCIACCESS_VERSION.tar.bz2
-  - (cd $LIBPCIACCESS_VERSION && ./configure --prefix=$HOME/prefix && make install)
-
-  - wget http://dri.freedesktop.org/libdrm/$LIBDRM_VERSION.tar.bz2
-  - tar -jxvf $LIBDRM_VERSION.tar.bz2
-  - (cd $LIBDRM_VERSION && ./configure --prefix=$HOME/prefix && make install)
-
-  - wget $XORG_RELEASES/lib/$LIBXSHMFENCE_VERSION.tar.bz2
-  - tar -jxvf $LIBXSHMFENCE_VERSION.tar.bz2
-  - (cd $LIBXSHMFENCE_VERSION && ./configure --prefix=$HOME/prefix && make install)
-
-# Disabled LLVM (and therefore r300 and r600) because the build fails
-# with "undefined reference to `clock_gettime'" and "undefined
-# reference to `setupterm'" in llvmpipe.
-script:
-  - if test "x$BUILD" = xmake; then
-      ./autogen.sh --enable-debug
-        --disable-gallium-llvm
-        --with-egl-platforms=x11,drm
-        --with-dri-drivers=i915,i965,radeon,r200,swrast,nouveau
-        --with-gallium-drivers=svga,swrast,vc4,virgl
-        ;
-      make && make check;
-    elif test x$BUILD = xscons; then
-      scons;
-    fi

Android.common.mk

@@ -21,25 +21,27 @@
 # FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER
 # DEALINGS IN THE SOFTWARE.
 
+# use c99 compiler by default
+ifeq ($(LOCAL_CC),)
 ifeq ($(LOCAL_IS_HOST_MODULE),true)
-LOCAL_CFLAGS += -D_GNU_SOURCE
+LOCAL_CC := $(HOST_CC) -std=c99
+else
+LOCAL_CC := $(TARGET_CC) -std=c99
+endif
 endif
 
 LOCAL_C_INCLUDES += \
 	$(MESA_TOP)/src \
 	$(MESA_TOP)/include
 
-MESA_VERSION := $(shell cat $(MESA_TOP)/VERSION)
+MESA_VERSION=$(shell cat $(MESA_TOP)/VERSION)
 # define ANDROID_VERSION (e.g., 4.0.x => 0x0400)
 LOCAL_CFLAGS += \
-	-Wno-unused-parameter \
-	-Wno-date-time \
 	-DPACKAGE_VERSION=\"$(MESA_VERSION)\" \
 	-DPACKAGE_BUGREPORT=\"https://bugs.freedesktop.org/enter_bug.cgi?product=Mesa\" \
 	-DANDROID_VERSION=0x0$(MESA_ANDROID_MAJOR_VERSION)0$(MESA_ANDROID_MINOR_VERSION)
 
 LOCAL_CFLAGS += \
-	-D__STDC_LIMIT_MACROS \
 	-DHAVE___BUILTIN_EXPECT \
 	-DHAVE___BUILTIN_FFS \
 	-DHAVE___BUILTIN_FFSLL \
@@ -54,32 +56,19 @@ LOCAL_CFLAGS += \
 	-DHAVE___BUILTIN_CLZLL \
 	-DHAVE___BUILTIN_UNREACHABLE \
 	-DHAVE_PTHREAD=1 \
-	-DHAVE_DLOPEN \
 	-fvisibility=hidden \
 	-Wno-sign-compare
 
-# mesa requires at least c99 compiler
-LOCAL_CONLYFLAGS += \
-	-std=c99
-
 ifeq ($(strip $(MESA_ENABLE_ASM)),true)
 ifeq ($(TARGET_ARCH),x86)
 LOCAL_CFLAGS += \
 	-DUSE_X86_ASM \
+	-DHAVE_DLOPEN \
 
 endif
 endif
 
-ifeq ($(MESA_ENABLE_LLVM),true)
-LOCAL_CFLAGS += \
-	-DHAVE_LLVM=0x0305 -DMESA_LLVM_VERSION_PATCH=2 \
-	-D__STDC_CONSTANT_MACROS \
-	-D__STDC_FORMAT_MACROS \
-	-D__STDC_LIMIT_MACROS
-endif
-
 LOCAL_CPPFLAGS += \
-	$(if $(filter true,$(MESA_LOLLIPOP_BUILD)),-D_USING_LIBCXX) \
 	-Wno-error=non-virtual-dtor \
 	-Wno-non-virtual-dtor
 
@@ -89,6 +78,3 @@ LOCAL_CPPFLAGS += \
 ifeq ($(strip $(LOCAL_MODULE_TAGS)),)
 LOCAL_MODULE_TAGS := optional
 endif
-
-# Quiet down the build system and remove any .h files from the sources
-LOCAL_SRC_FILES := $(patsubst %.h, , $(LOCAL_SRC_FILES))

Android.mk

@@ -24,7 +24,7 @@
 # BOARD_GPU_DRIVERS should be defined.  The valid values are
 #
 #   classic drivers: i915 i965
-#   gallium drivers: swrast freedreno i915g ilo nouveau r300g r600g radeonsi vc4 virgl vmwgfx
+#   gallium drivers: swrast freedreno i915g ilo nouveau r300g r600g radeonsi vmwgfx
 #
 # The main target is libGLES_mesa.  For each classic driver enabled, a DRI
 # module will also be built.  DRI modules will be loaded by libGLES_mesa.
@@ -34,23 +34,14 @@ MESA_TOP := $(call my-dir)
 MESA_ANDROID_MAJOR_VERSION := $(word 1, $(subst ., , $(PLATFORM_VERSION)))
 MESA_ANDROID_MINOR_VERSION := $(word 2, $(subst ., , $(PLATFORM_VERSION)))
 MESA_ANDROID_VERSION := $(MESA_ANDROID_MAJOR_VERSION).$(MESA_ANDROID_MINOR_VERSION)
-ifeq ($(filter 1 2 3 4,$(MESA_ANDROID_MAJOR_VERSION)),)
-MESA_LOLLIPOP_BUILD := true
-else
-define local-generated-sources-dir
-$(call local-intermediates-dir)
-endef
-endif
-
-MESA_DRI_MODULE_REL_PATH := dri
-MESA_DRI_MODULE_PATH := $(TARGET_OUT_SHARED_LIBRARIES)/$(MESA_DRI_MODULE_REL_PATH)
-MESA_DRI_MODULE_UNSTRIPPED_PATH := $(TARGET_OUT_SHARED_LIBRARIES_UNSTRIPPED)/$(MESA_DRI_MODULE_REL_PATH)
 
 MESA_COMMON_MK := $(MESA_TOP)/Android.common.mk
 MESA_PYTHON2 := python
 
+DRM_GRALLOC_TOP := hardware/drm_gralloc
+
 classic_drivers := i915 i965
-gallium_drivers := swrast freedreno i915g ilo nouveau r300g r600g radeonsi vmwgfx vc4 virgl
+gallium_drivers := swrast freedreno i915g ilo nouveau r300g r600g radeonsi vmwgfx
 
 MESA_GPU_DRIVERS := $(strip $(BOARD_GPU_DRIVERS))
 
@@ -82,25 +73,28 @@ else
 MESA_BUILD_GALLIUM := false
 endif
 
-MESA_ENABLE_LLVM := $(if $(filter radeonsi,$(MESA_GPU_DRIVERS)),true,false)
-
 # add subdirectories
 ifneq ($(strip $(MESA_GPU_DRIVERS)),)
 
 SUBDIRS := \
 	src/loader \
 	src/mapi \
-	src/compiler \
-	src/compiler/glsl \
+	src/glsl \
 	src/mesa \
 	src/util \
-	src/egl \
+	src/egl/main
+
+ifeq ($(strip $(MESA_BUILD_CLASSIC)),true)
+SUBDIRS += \
+	src/egl/drivers/dri2 \
 	src/mesa/drivers/dri
+endif
 
 ifeq ($(strip $(MESA_BUILD_GALLIUM)),true)
 SUBDIRS += src/gallium
 endif
 
-include $(call all-named-subdir-makefiles,$(SUBDIRS))
+mkfiles := $(patsubst %,$(MESA_TOP)/%/Android.mk,$(SUBDIRS))
+include $(mkfiles)
 
 endif

CleanSpec.mk

@@ -5,12 +5,3 @@ $(call add-clean-step, rm -rf $(PRODUCT_OUT)/obj/SHARED_LIBRARIES/libGLES_mesa_i
 $(call add-clean-step, rm -rf $(OUT_DIR)/host/$(HOST_OS)-$(HOST_ARCH)/obj/EXECUTABLES/mesa_*_intermediates)
 $(call add-clean-step, rm -rf $(OUT_DIR)/host/$(HOST_OS)-$(HOST_ARCH)/obj/EXECUTABLES/glsl_compiler_intermediates)
 $(call add-clean-step, rm -rf $(OUT_DIR)/host/$(HOST_OS)-$(HOST_ARCH)/obj/STATIC_LIBRARIES/libmesa_glsl_utils_intermediates)
-
-$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/STATIC_LIBRARIES/libmesa_*_intermediates)
-$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/SHARED_LIBRARIES/i9?5_dri_intermediates)
-$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/SHARED_LIBRARIES/libglapi_intermediates)
-$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/SHARED_LIBRARIES/libGLES_mesa_intermediates)
-$(call add-clean-step, rm -rf $(HOST_OUT_release)/*/EXECUTABLES/mesa_*_intermediates)
-$(call add-clean-step, rm -rf $(HOST_OUT_release)/*/EXECUTABLES/glsl_compiler_intermediates)
-$(call add-clean-step, rm -rf $(HOST_OUT_release)/*/STATIC_LIBRARIES/libmesa_*_intermediates)
-$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/SHARED_LIBRARIES/*_dri_intermediates)

Makefile.am

@@ -24,21 +24,15 @@ SUBDIRS = src
 AM_DISTCHECK_CONFIGURE_FLAGS = \
 	--enable-dri3 \
 	--enable-gallium-tests \
-	--enable-gallium-osmesa \
 	--enable-gbm \
 	--enable-gles1 \
 	--enable-gles2 \
 	--enable-glx-tls \
-	--enable-nine \
-	--enable-opencl \
 	--enable-va \
 	--enable-vdpau \
 	--enable-xa \
 	--enable-xvmc \
-	--disable-llvm-shared-libs \
-	--with-egl-platforms=x11,wayland,drm,surfaceless \
-	--with-dri-drivers=i915,i965,nouveau,radeon,r200,swrast \
-	--with-gallium-drivers=i915,ilo,nouveau,r300,r600,radeonsi,freedreno,svga,swrast,vc4,virgl
+	--with-egl-platforms=x11,wayland,drm
 
 ACLOCAL_AMFLAGS = -I m4
 
@@ -50,14 +44,13 @@ EXTRA_DIST = \
 	scons \
 	SConstruct
 
-noinst_HEADERS = \
-	include/c99_alloca.h \
-	include/c99_compat.h \
-	include/c99_math.h \
-	include/c11 \
-	include/D3D9 \
-	include/HaikuGL \
-	include/no_extern_c.h \
+noinst_HEADERS =					\
+	include/c99_compat.h				\
+	include/c99					\
+	include/c11					\
+	include/D3D9					\
+	include/VG					\
+	include/HaikuGL					\
 	include/pci_ids
 
 # We list some directories in EXTRA_DIST, but don't actually want to include

VERSION

@@ -1 +1 @@
-11.2.2
+10.5.6

appveyor.yml

@@ -1,73 +0,0 @@
-# http://www.appveyor.com/docs/appveyor-yml
-#
-# To setup AppVeyor for your own personal repositories do the following:
-# - Sign up
-# - Add a new project
-# - Select Git and fill in the Git clone URL
-# - Setup a Git hook as explained in
-#   https://github.com/appveyor/webhooks#installing-git-hook
-# - Check 'Settings > General > Skip branches without appveyor.yml'
-# - Check 'Settings > General > Rolling builds'
-# - Setup the global or project notifications to your liking
-#
-# Note that kicking (or restarting) a build via the web UI will not work, as it
-# will fail to find appveyor.yml .  The Git hook is the most practical way to
-# kick a build.
-#
-# See also:
-# - http://help.appveyor.com/discussions/problems/2209-node-grunt-build-specify-a-project-or-solution-file-the-directory-does-not-contain-a-project-or-solution-file
-# - http://help.appveyor.com/discussions/questions/1184-build-config-vs-appveyoryaml
-
-version: '{build}'
-
-branches:
-  except:
-  - /^travis.*$/
-
-# Don't download the full Mesa history to speed up cloning.  However the clone
-# depth must not be too small, otherwise builds might fail when lots of patches
-# are committed in succession, because the desired commit is not found on the
-# truncated history.
-#
-# See also:
-# - https://www.appveyor.com/blog/2014/06/04/shallow-clone-for-git-repositories
-clone_depth: 100
-
-cache:
-- win_flex_bison-2.4.5.zip
-- llvm-3.3.1-msvc2013-mtd.7z
-
-environment:
-  WINFLEXBISON_ARCHIVE: win_flex_bison-2.4.5.zip
-  LLVM_ARCHIVE: llvm-3.3.1-msvc2013-mtd.7z
-
-install:
-# Check pip
-- python --version
-- python -m pip --version
-# Install Mako
-- python -m pip install --egg Mako
-# Install SCons
-- python -m pip install --egg scons==2.4.1
-- scons --version
-# Install flex/bison
-- if not exist "%WINFLEXBISON_ARCHIVE%" appveyor DownloadFile "http://downloads.sourceforge.net/project/winflexbison/%WINFLEXBISON_ARCHIVE%"
-- 7z x -y -owinflexbison\ "%WINFLEXBISON_ARCHIVE%" > nul
-- set Path=%CD%\winflexbison;%Path%
-- win_flex --version
-- win_bison --version
-# Download and extract LLVM
-- if not exist "%LLVM_ARCHIVE%" appveyor DownloadFile "https://people.freedesktop.org/~jrfonseca/llvm/%LLVM_ARCHIVE%"
-- 7z x -y "%LLVM_ARCHIVE%" > nul
-- mkdir llvm\bin
-- set LLVM=%CD%\llvm
-
-build_script:
-- scons -j%NUMBER_OF_PROCESSORS% MSVC_VERSION=12.0 llvm=1
-
-
-# It's possible to setup notification here, as described in
-# http://www.appveyor.com/docs/notifications#appveyor-yml-configuration , but
-# doing so would cause the notification settings to be replicated across all
-# repos, which is most likely undesired.  So it's better to rely on the
-# Appveyor global/project notification settings.

autogen.sh

@@ -6,8 +6,8 @@ test -z "$srcdir" && srcdir=.
 ORIGDIR=`pwd`
 cd "$srcdir"
 
-autoreconf --force --verbose --install || exit 1
-cd "$ORIGDIR" || exit $?
+autoreconf -v --install || exit 1
+cd $ORIGDIR || exit $?
 
 if test -z "$NOCONFIGURE"; then
     "$srcdir"/configure "$@"

bin/.cherry-ignore

@@ -1,5 +1,26 @@
-# Remove duplicate commit due to vulkan branch merge
-9e64a2a8e4821dd637daac54ba83895a490d4790 mesa: Fix generation of git_sha1.h.tmp for gitlinks
+# Cherry-picked without -x
+# nir: resolve nir.h dependency list (fix make distcheck)
+556fc4b84df99a1cd4b18c11fb16f7854a948b2a 
 
-# The functions/extension in question landed after the branchpoint.
-be5010c4b8635d0292404ac58ed0436ba6637579 glapi: fix parameter type for GetSamplerParameterIuivEXT() in es_EXT.xml
+# nir: add missing header to the sources list
+72e602905dd9d86450a936d5a22bf21758844b38
+
+# configure: rework wayland_scanner handling(fix make distcheck)
+153539bd9d4445b504110958306f00632222f840
+
+# auxiliary/vl: bring back the VL code for the dri targets
+c39dbfdd0f764b1aaa7319b4694e7335692993dd
+
+# mesa: rename format_info.c to format_info.h
+3f6c28f2a976e35128b7a4a513cfa60af00301e1
+# mesa: fix dependency tracking of generated sources
+d22391cb165af4ed2f9a9e5d6233072a432cc969
+# mesa: drop Makefile from get_hash.h dependency list
+2c0f72d5389a9838cc4fbf4cc4f4291aa56c7845
+# mapi: fix *glapi dependency tracking
+fe5fddd7e2df74233a2a02ae021418485f39d11c
+# xmlpool: make sure we ship options.h
+8d8ca64c28170ec7e9ffa01638bcf8fd30a96088
+
+# The optimisations mentioned are not available in 10.5
+627c68308683abbd6e563a09af6013a33938a790 i965/fs: in MAD optimizations, switch last argument to be immediate

bin/bugzilla_mesa.sh

@@ -15,14 +15,17 @@
 # $ DRYRUN=yes bin/bugzilla_mesa.sh mesa-9.0.2..mesa-9.0.3 | wc -l
 
 
-# regex pattern: trim before bug number
-trim_before='s/.*show_bug.cgi?id=\([0-9]*\).*/\1/'
+# regex pattern: trim before url
+trim_before='s/.*\(http\)/\1/'
 
-# regex pattern: reconstruct the url
-use_after='s,^,https://bugs.freedesktop.org/show_bug.cgi?id=,'
+# regex pattern: trim after url
+trim_after='s/\(show_bug.cgi?id=[0-9]*\).*/\1/'
+
+# regex pattern: always use https
+use_https='s/http:/https:/'
 
 # extract fdo urls from commit log
-urls=$(git log $* | grep 'bugs.freedesktop.org/show_bug' | sed -e $trim_before | sort -n -u | sed -e $use_after)
+urls=$(git log $* | grep 'bugs.freedesktop.org/show_bug' | sed -e $trim_before -e $trim_after -e $use_https | sort | uniq)
 
 # if DRYRUN is set to "yes", simply print the URLs and don't fetch the
 # details from fdo bugzilla.

bin/get-extra-pick-list.sh

@@ -1,35 +0,0 @@
-#!/bin/sh
-
-# Script for generating a list of candidates which fix commits that have been
-# previously cherry-picked to a stable branch.
-#
-# Usage examples:
-#
-# $ bin/get-extra-pick-list.sh
-# $ bin/get-extra-pick-list.sh > picklist
-# $ bin/get-extra-pick-list.sh | tee picklist
-
-# Use the last branchpoint as our limit for the search
-# XXX: there should be a better way for this
-latest_branchpoint=`git branch | grep \* | cut -c 3-`-branchpoint
-
-# Grep for commits with "cherry picked from commit" in the commit message.
-git log --reverse --grep="cherry picked from commit" $latest_branchpoint..HEAD |\
-	grep "cherry picked from commit" |\
-	sed -e 's/^[[:space:]]*(cherry picked from commit[[:space:]]*//' -e 's/)//' |\
-	cut -c -8 |\
-while read sha
-do
-	# Check if the original commit is referenced in master
-	git log -n1 --pretty=oneline --grep=$sha $latest_branchpoint..origin/master |\
-		cut -c -8 |\
-	while read candidate
-	do
-		# Check if the potential fix, hasn't landed in branch yet.
-		found=`git log -n1 --pretty=oneline --reverse --grep=$candidate $latest_branchpoint..HEAD |wc -l`
-		if test $found = 0
-		then
-			echo Commit $candidate might need to be picked, as it references $sha
-		fi
-	done
-done

common.py

@@ -26,28 +26,28 @@ else:
     target_platform = host_platform
 
 _machine_map = {
-    'x86': 'x86',
-    'i386': 'x86',
-    'i486': 'x86',
-    'i586': 'x86',
-    'i686': 'x86',
-    'BePC': 'x86',
-    'Intel': 'x86',
-    'ppc': 'ppc',
-    'BeBox': 'ppc',
-    'BeMac': 'ppc',
-    'AMD64': 'x86_64',
-    'x86_64': 'x86_64',
-    'sparc': 'sparc',
-    'sun4u': 'sparc',
+	'x86': 'x86',
+	'i386': 'x86',
+	'i486': 'x86',
+	'i586': 'x86',
+	'i686': 'x86',
+	'BePC': 'x86',
+	'Intel': 'x86',
+	'ppc' : 'ppc',
+	'BeBox': 'ppc',
+	'BeMac': 'ppc',
+	'AMD64': 'x86_64',
+	'x86_64': 'x86_64',
+	'sparc': 'sparc',
+	'sun4u': 'sparc',
 }
 
 
 # find host_machine value
 if 'PROCESSOR_ARCHITECTURE' in os.environ:
-    host_machine = os.environ['PROCESSOR_ARCHITECTURE']
+	host_machine = os.environ['PROCESSOR_ARCHITECTURE']
 else:
-    host_machine = _platform.machine()
+	host_machine = _platform.machine()
 host_machine = _machine_map.get(host_machine, 'generic')
 
 default_machine = host_machine
@@ -65,8 +65,7 @@ else:
     default_llvm = 'no'
     try:
         if target_platform != 'windows' and \
-           subprocess.call(['llvm-config', '--version'],
-                           stdout=subprocess.PIPE) == 0:
+           subprocess.call(['llvm-config', '--version'], stdout=subprocess.PIPE) == 0:
             default_llvm = 'yes'
     except:
         pass
@@ -76,38 +75,30 @@ else:
 # Common options
 
 def AddOptions(opts):
-    try:
-        from SCons.Variables.BoolVariable import BoolVariable as BoolOption
-    except ImportError:
-        from SCons.Options.BoolOption import BoolOption
-    try:
-        from SCons.Variables.EnumVariable import EnumVariable as EnumOption
-    except ImportError:
-        from SCons.Options.EnumOption import EnumOption
-    opts.Add(EnumOption('build', 'build type', 'debug',
-                        allowed_values=('debug', 'checked', 'profile',
-                                        'release')))
-    opts.Add(BoolOption('verbose', 'verbose output', 'no'))
-    opts.Add(EnumOption('machine', 'use machine-specific assembly code',
-                        default_machine,
-                        allowed_values=('generic', 'ppc', 'x86', 'x86_64')))
-    opts.Add(EnumOption('platform', 'target platform', host_platform,
-                        allowed_values=('cygwin', 'darwin', 'freebsd', 'haiku',
-                                        'linux', 'sunos', 'windows')))
-    opts.Add(BoolOption('embedded', 'embedded build', 'no'))
-    opts.Add(BoolOption('analyze',
-                        'enable static code analysis where available', 'no'))
-    opts.Add('toolchain', 'compiler toolchain', default_toolchain)
-    opts.Add(BoolOption('gles', 'EXPERIMENTAL: enable OpenGL ES support',
-                        'no'))
-    opts.Add(BoolOption('llvm', 'use LLVM', default_llvm))
-    opts.Add(BoolOption('openmp', 'EXPERIMENTAL: compile with openmp (swrast)',
-                        'no'))
-    opts.Add(BoolOption('debug', 'DEPRECATED: debug build', 'yes'))
-    opts.Add(BoolOption('profile', 'DEPRECATED: profile build', 'no'))
-    opts.Add(BoolOption('quiet', 'DEPRECATED: profile build', 'yes'))
-    opts.Add(BoolOption('texture_float',
-                        'enable floating-point textures and renderbuffers',
-                        'no'))
-    if host_platform == 'windows':
-        opts.Add('MSVC_VERSION', 'Microsoft Visual C/C++ version')
+	try:
+		from SCons.Variables.BoolVariable import BoolVariable as BoolOption
+	except ImportError:
+		from SCons.Options.BoolOption import BoolOption
+	try:
+		from SCons.Variables.EnumVariable import EnumVariable as EnumOption
+	except ImportError:
+		from SCons.Options.EnumOption import EnumOption
+	opts.Add(EnumOption('build', 'build type', 'debug',
+	                  allowed_values=('debug', 'checked', 'profile', 'release')))
+	opts.Add(BoolOption('verbose', 'verbose output', 'no'))
+	opts.Add(EnumOption('machine', 'use machine-specific assembly code', default_machine,
+											 allowed_values=('generic', 'ppc', 'x86', 'x86_64')))
+	opts.Add(EnumOption('platform', 'target platform', host_platform,
+											 allowed_values=('cygwin', 'darwin', 'freebsd', 'haiku', 'linux', 'sunos', 'windows')))
+	opts.Add(BoolOption('embedded', 'embedded build', 'no'))
+	opts.Add(BoolOption('analyze', 'enable static code analysis where available', 'no'))
+	opts.Add('toolchain', 'compiler toolchain', default_toolchain)
+	opts.Add(BoolOption('gles', 'EXPERIMENTAL: enable OpenGL ES support', 'no'))
+	opts.Add(BoolOption('llvm', 'use LLVM', default_llvm))
+	opts.Add(BoolOption('openmp', 'EXPERIMENTAL: compile with openmp (swrast)', 'no'))
+	opts.Add(BoolOption('debug', 'DEPRECATED: debug build', 'yes'))
+	opts.Add(BoolOption('profile', 'DEPRECATED: profile build', 'no'))
+	opts.Add(BoolOption('quiet', 'DEPRECATED: profile build', 'yes'))
+	opts.Add(BoolOption('texture_float', 'enable floating-point textures and renderbuffers', 'no'))
+	if host_platform == 'windows':
+		opts.Add('MSVC_VERSION', 'Microsoft Visual C/C++ version')

docs/GL3.txt

@@ -21,23 +21,23 @@ Feature                                               Status
 GL 3.0, GLSL 1.30 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe
 
   glBindFragDataLocation, glGetFragDataLocation         DONE
-  Conditional rendering (GL_NV_conditional_render)      DONE ()
-  Map buffer subranges (GL_ARB_map_buffer_range)        DONE ()
-  Clamping controls (GL_ARB_color_buffer_float)         DONE ()
-  Float textures, renderbuffers (GL_ARB_texture_float)  DONE ()
+  Conditional rendering (GL_NV_conditional_render)      DONE (r300, swrast)
+  Map buffer subranges (GL_ARB_map_buffer_range)        DONE (r300, swrast)
+  Clamping controls (GL_ARB_color_buffer_float)         DONE (r300)
+  Float textures, renderbuffers (GL_ARB_texture_float)  DONE (r300)
   GL_EXT_packed_float                                   DONE ()
-  GL_EXT_texture_shared_exponent                        DONE ()
+  GL_EXT_texture_shared_exponent                        DONE (swrast)
   Float depth buffers (GL_ARB_depth_buffer_float)       DONE ()
-  Framebuffer objects (GL_ARB_framebuffer_object)       DONE ()
+  Framebuffer objects (GL_ARB_framebuffer_object)       DONE (r300, swrast)
   GL_ARB_half_float_pixel                               DONE (all drivers)
-  GL_ARB_half_float_vertex                              DONE ()
+  GL_ARB_half_float_vertex                              DONE (r300, swrast)
   GL_EXT_texture_integer                                DONE ()
   GL_EXT_texture_array                                  DONE ()
-  Per-buffer blend and masks (GL_EXT_draw_buffers2)     DONE ()
-  GL_EXT_texture_compression_rgtc                       DONE ()
-  GL_ARB_texture_rg                                     DONE ()
+  Per-buffer blend and masks (GL_EXT_draw_buffers2)     DONE (swrast)
+  GL_EXT_texture_compression_rgtc                       DONE (r300, swrast)
+  GL_ARB_texture_rg                                     DONE (r300, swrast)
   Transform feedback (GL_EXT_transform_feedback)        DONE ()
-  Vertex array objects (GL_ARB_vertex_array_object)     DONE ()
+  Vertex array objects (GL_ARB_vertex_array_object)     DONE (all drivers)
   sRGB framebuffer format (GL_EXT_framebuffer_sRGB)     DONE ()
   glClearBuffer commands                                DONE
   glGetStringi command                                  DONE
@@ -45,7 +45,7 @@ GL 3.0, GLSL 1.30 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, soft
   glVertexAttribI commands                              DONE
   Depth format cube textures                            DONE ()
   GLX_ARB_create_context (GLX 1.4 is required)          DONE
-  Multisample anti-aliasing                             DONE (llvmpipe (*), softpipe (*))
+  Multisample anti-aliasing                             DONE (llvmpipe (*), softpipe (*), r300)
 
 (*) llvmpipe and softpipe have fake Multisample anti-aliasing support
 
@@ -53,28 +53,28 @@ GL 3.0, GLSL 1.30 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, soft
 GL 3.1, GLSL 1.40 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe
 
   Forward compatible context support/deprecations       DONE ()
-  Instanced drawing (GL_ARB_draw_instanced)             DONE ()
-  Buffer copying (GL_ARB_copy_buffer)                   DONE ()
-  Primitive restart (GL_NV_primitive_restart)           DONE ()
+  Instanced drawing (GL_ARB_draw_instanced)             DONE (swrast)
+  Buffer copying (GL_ARB_copy_buffer)                   DONE (r300, swrast)
+  Primitive restart (GL_NV_primitive_restart)           DONE (r300)
   16 vertex texture image units                         DONE ()
   Texture buffer objs (GL_ARB_texture_buffer_object)    DONE for OpenGL 3.1 contexts ()
-  Rectangular textures (GL_ARB_texture_rectangle)       DONE ()
-  Uniform buffer objs (GL_ARB_uniform_buffer_object)    DONE ()
-  Signed normalized textures (GL_EXT_texture_snorm)     DONE ()
+  Rectangular textures (GL_ARB_texture_rectangle)       DONE (r300, swrast)
+  Uniform buffer objs (GL_ARB_uniform_buffer_object)    DONE (swrast)
+  Signed normalized textures (GL_EXT_texture_snorm)     DONE (r300)
 
 
 GL 3.2, GLSL 1.50 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe
 
   Core/compatibility profiles                           DONE
   Geometry shaders                                      DONE ()
-  BGRA vertex order (GL_ARB_vertex_array_bgra)          DONE ()
-  Base vertex offset(GL_ARB_draw_elements_base_vertex)  DONE ()
-  Frag shader coord (GL_ARB_fragment_coord_conventions) DONE ()
-  Provoking vertex (GL_ARB_provoking_vertex)            DONE ()
+  BGRA vertex order (GL_ARB_vertex_array_bgra)          DONE (r300, swrast)
+  Base vertex offset(GL_ARB_draw_elements_base_vertex)  DONE (r300, swrast)
+  Frag shader coord (GL_ARB_fragment_coord_conventions) DONE (r300, swrast)
+  Provoking vertex (GL_ARB_provoking_vertex)            DONE (r300, swrast)
   Seamless cubemaps (GL_ARB_seamless_cube_map)          DONE ()
   Multisample textures (GL_ARB_texture_multisample)     DONE ()
-  Frag depth clamp (GL_ARB_depth_clamp)                 DONE ()
-  Fence objects (GL_ARB_sync)                           DONE ()
+  Frag depth clamp (GL_ARB_depth_clamp)                 DONE (swrast)
+  Fence objects (GL_ARB_sync)                           DONE (r300, swrast)
   GLX_ARB_create_context_profile                        DONE
 
 
@@ -82,182 +82,149 @@ GL 3.3, GLSL 3.30 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, soft
 
   GL_ARB_blend_func_extended                            DONE ()
   GL_ARB_explicit_attrib_location                       DONE (all drivers that support GLSL)
-  GL_ARB_occlusion_query2                               DONE ()
+  GL_ARB_occlusion_query2                               DONE (r300, swrast)
   GL_ARB_sampler_objects                                DONE (all drivers)
   GL_ARB_shader_bit_encoding                            DONE ()
   GL_ARB_texture_rgb10_a2ui                             DONE ()
-  GL_ARB_texture_swizzle                                DONE ()
+  GL_ARB_texture_swizzle                                DONE (r300, swrast)
   GL_ARB_timer_query                                    DONE ()
-  GL_ARB_instanced_arrays                               DONE ()
+  GL_ARB_instanced_arrays                               DONE (r300)
   GL_ARB_vertex_type_2_10_10_10_rev                     DONE ()
 
 
-GL 4.0, GLSL 4.00 --- all DONE: nvc0, r600, radeonsi
+GL 4.0, GLSL 4.00:
 
-  GL_ARB_draw_buffers_blend                            DONE (i965, nv50, llvmpipe, softpipe)
-  GL_ARB_draw_indirect                                 DONE (i965, llvmpipe, softpipe)
-  GL_ARB_gpu_shader5                                   DONE (i965)
+  GL_ARB_draw_buffers_blend                            DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
+  GL_ARB_draw_indirect                                 DONE (i965, nvc0, radeonsi, llvmpipe, softpipe)
+  GL_ARB_gpu_shader5                                   DONE (i965, nvc0)
   - 'precise' qualifier                                DONE
-  - Dynamically uniform sampler array indices          DONE (softpipe)
-  - Dynamically uniform UBO array indices              DONE ()
+  - Dynamically uniform sampler array indices          DONE (r600)
+  - Dynamically uniform UBO array indices              DONE (r600)
   - Implicit signed -> unsigned conversions            DONE
   - Fused multiply-add                                 DONE ()
-  - Packing/bitfield/conversion functions              DONE (softpipe)
-  - Enhanced textureGather                             DONE (softpipe)
-  - Geometry shader instancing                         DONE (llvmpipe, softpipe)
+  - Packing/bitfield/conversion functions              DONE (r600)
+  - Enhanced textureGather                             DONE (r600, radeonsi)
+  - Geometry shader instancing                         DONE (r600)
   - Geometry shader multiple streams                   DONE ()
-  - Enhanced per-sample shading                        DONE ()
-  - Interpolation functions                            DONE ()
+  - Enhanced per-sample shading                        DONE (r600)
+  - Interpolation functions                            DONE (r600)
   - New overload resolution rules                      DONE
-  GL_ARB_gpu_shader_fp64                               DONE (llvmpipe, softpipe)
-  GL_ARB_sample_shading                                DONE (i965, nv50)
-  GL_ARB_shader_subroutine                             DONE (i965, nv50, llvmpipe, softpipe)
-  GL_ARB_tessellation_shader                           DONE (i965)
-  GL_ARB_texture_buffer_object_rgb32                   DONE (i965, llvmpipe, softpipe)
-  GL_ARB_texture_cube_map_array                        DONE (i965, nv50, llvmpipe, softpipe)
-  GL_ARB_texture_gather                                DONE (i965, nv50, llvmpipe, softpipe)
-  GL_ARB_texture_query_lod                             DONE (i965, nv50, softpipe)
-  GL_ARB_transform_feedback2                           DONE (i965, nv50, llvmpipe, softpipe)
-  GL_ARB_transform_feedback3                           DONE (i965, nv50, llvmpipe, softpipe)
+  GL_ARB_gpu_shader_fp64                               started (Dave)
+  GL_ARB_sample_shading                                DONE (i965, nv50, nvc0, r600, radeonsi)
+  GL_ARB_shader_subroutine                             not started
+  GL_ARB_tessellation_shader                           started (Chris, Ilia)
+  GL_ARB_texture_buffer_object_rgb32                   DONE (i965, nvc0, r600, radeonsi, llvmpipe, softpipe)
+  GL_ARB_texture_cube_map_array                        DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
+  GL_ARB_texture_gather                                DONE (i965, nv50, nvc0, r600, radeonsi)
+  GL_ARB_texture_query_lod                             DONE (i965, nv50, nvc0, r600, radeonsi)
+  GL_ARB_transform_feedback2                           DONE (i965, nv50, nvc0, r600, radeonsi)
+  GL_ARB_transform_feedback3                           DONE (i965, nv50, nvc0, r600, radeonsi)
 
 
-GL 4.1, GLSL 4.10 --- all DONE: nvc0, r600, radeonsi
+GL 4.1, GLSL 4.10:
 
-  GL_ARB_ES2_compatibility                             DONE (i965, nv50, llvmpipe, softpipe)
+  GL_ARB_ES2_compatibility                             DONE (i965, nv50, nvc0, r300, r600, radeonsi, llvmpipe, softpipe)
   GL_ARB_get_program_binary                            DONE (0 binary formats)
   GL_ARB_separate_shader_objects                       DONE (all drivers)
-  GL_ARB_shader_precision                              DONE (all drivers that support GLSL 4.10)
-  GL_ARB_vertex_attrib_64bit                           DONE (llvmpipe, softpipe)
-  GL_ARB_viewport_array                                DONE (i965, nv50, llvmpipe, softpipe)
+  GL_ARB_shader_precision                              started (Micah)
+  GL_ARB_vertex_attrib_64bit                           started (Dave)
+  GL_ARB_viewport_array                                DONE (i965, nv50, nvc0, r600, llvmpipe)
 
 
 GL 4.2, GLSL 4.20:
 
   GL_ARB_texture_compression_bptc                      DONE (i965, nvc0, r600, radeonsi)
   GL_ARB_compressed_texture_pixel_storage              DONE (all drivers)
-  GL_ARB_shader_atomic_counters                        DONE (i965, nvc0)
+  GL_ARB_shader_atomic_counters                        DONE (i965)
   GL_ARB_texture_storage                               DONE (all drivers)
-  GL_ARB_transform_feedback_instanced                  DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
+  GL_ARB_transform_feedback_instanced                  DONE (i965, nv50, nvc0, r600, radeonsi)
   GL_ARB_base_instance                                 DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_shader_image_load_store                       DONE (i965)
+  GL_ARB_shader_image_load_store                       in progress (curro)
   GL_ARB_conservative_depth                            DONE (all drivers that support GLSL 1.30)
   GL_ARB_shading_language_420pack                      DONE (all drivers that support GLSL 1.30)
-  GL_ARB_shading_language_packing                      DONE (all drivers)
-  GL_ARB_internalformat_query                          DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
+  GL_ARB_internalformat_query                          DONE (i965, nv50, nvc0, r300, r600, radeonsi, llvmpipe, softpipe)
   GL_ARB_map_buffer_alignment                          DONE (all drivers)
 
 
 GL 4.3, GLSL 4.30:
 
-  GL_ARB_arrays_of_arrays                              DONE (all drivers that support GLSL 1.30)
+  GL_ARB_arrays_of_arrays                              started (Timothy)
   GL_ARB_ES3_compatibility                             DONE (all drivers that support GLSL 3.30)
   GL_ARB_clear_buffer_object                           DONE (all drivers)
-  GL_ARB_compute_shader                                DONE (i965)
-  GL_ARB_copy_image                                    DONE (i965, nv50, nvc0, r600, radeonsi)
+  GL_ARB_compute_shader                                in progress (jljusten)
+  GL_ARB_copy_image                                    DONE (i965)
   GL_KHR_debug                                         DONE (all drivers)
   GL_ARB_explicit_uniform_location                     DONE (all drivers that support GLSL)
-  GL_ARB_fragment_layer_viewport                       DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe)
-  GL_ARB_framebuffer_no_attachments                    DONE (i965)
-  GL_ARB_internalformat_query2                         in progress (elima)
+  GL_ARB_fragment_layer_viewport                       DONE (nv50, nvc0, r600, llvmpipe)
+  GL_ARB_framebuffer_no_attachments                    not started
+  GL_ARB_internalformat_query2                         not started
   GL_ARB_invalidate_subdata                            DONE (all drivers)
-  GL_ARB_multi_draw_indirect                           DONE (i965, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_program_interface_query                       DONE (all drivers)
+  GL_ARB_multi_draw_indirect                           DONE (i965, nvc0, radeonsi, llvmpipe, softpipe)
+  GL_ARB_program_interface_query                       not started
   GL_ARB_robust_buffer_access_behavior                 not started
-  GL_ARB_shader_image_size                             DONE (i965)
-  GL_ARB_shader_storage_buffer_object                  DONE (i965, nvc0)
+  GL_ARB_shader_image_size                             not started
+  GL_ARB_shader_storage_buffer_object                  not started
   GL_ARB_stencil_texturing                             DONE (i965/gen8+, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
   GL_ARB_texture_buffer_range                          DONE (nv50, nvc0, i965, r600, radeonsi, llvmpipe)
   GL_ARB_texture_query_levels                          DONE (all drivers that support GLSL 1.30)
   GL_ARB_texture_storage_multisample                   DONE (all drivers that support GL_ARB_texture_multisample)
-  GL_ARB_texture_view                                  DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
+  GL_ARB_texture_view                                  DONE (i965, nv50, nvc0)
   GL_ARB_vertex_attrib_binding                         DONE (all drivers)
 
 
 GL 4.4, GLSL 4.40:
 
   GL_MAX_VERTEX_ATTRIB_STRIDE                          DONE (all drivers)
-  GL_ARB_buffer_storage                                DONE (i965, nv50, nvc0, r600, radeonsi)
-  GL_ARB_clear_texture                                 DONE (i965, nv50, nvc0)
-  GL_ARB_enhanced_layouts                              in progress (Timothy)
-  - compile-time constant expressions                  DONE
-  - explicit byte offsets for blocks                   in progress
-  - forced alignment within blocks                     in progress
-  - specified vec4-slot component numbers              in progress
-  - specified transform/feedback layout                in progress
-  - input/output block locations                       DONE
+  GL_ARB_buffer_storage                                DONE (i965, nv30, nv50, nvc0, r300, r600, radeonsi)
+  GL_ARB_clear_texture                                 DONE (i965)
+  GL_ARB_enhanced_layouts                              not started
   GL_ARB_multi_bind                                    DONE (all drivers)
-  GL_ARB_query_buffer_object                           DONE (nvc0)
-  GL_ARB_texture_mirror_clamp_to_edge                  DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_texture_stencil8                              DONE (nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
+  GL_ARB_query_buffer_object                           not started
+  GL_ARB_texture_mirror_clamp_to_edge                  DONE (i965, nv30, nv50, nvc0, r300, r600, radeonsi, swrast, llvmpipe, softpipe)
+  GL_ARB_texture_stencil8                              not started
   GL_ARB_vertex_type_10f_11f_11f_rev                   DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
 
 GL 4.5, GLSL 4.50:
 
   GL_ARB_ES3_1_compatibility                           not started
-  GL_ARB_clip_control                                  DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_conditional_render_inverted                   DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_cull_distance                                 in progress (Tobias)
-  GL_ARB_derivative_control                            DONE (i965, nv50, nvc0, r600, radeonsi)
-  GL_ARB_direct_state_access                           DONE (all drivers)
-  GL_ARB_get_texture_sub_image                         DONE (all drivers)
-  GL_ARB_shader_texture_image_samples                  DONE (i965, nv50, nvc0, r600, radeonsi)
-  GL_ARB_texture_barrier                               DONE (i965, nv50, nvc0, r600, radeonsi)
-  GL_KHR_context_flush_control                         DONE (all - but needs GLX/EGL extension to be useful)
+  GL_ARB_clip_control                                  DONE (nv50, nvc0, r300, r600, radeonsi, llvmpipe, softpipe)
+  GL_ARB_conditional_render_inverted                   DONE (i965, nv50, nvc0, llvmpipe, softpipe)
+  GL_ARB_cull_distance                                 not started
+  GL_ARB_derivative_control                            DONE (i965, nv50, nvc0, r600)
+  GL_ARB_direct_state_access                           started
+  - Transform Feedback object                          started (Martin Peres)
+  - Buffer object                                      started (Laura Ekstrand)
+  - Framebuffer object                                 started (Laura Ekstrand)
+  - Renderbuffer object                                not started
+  - Texture object                                     started (Laura Ekstrand)
+  - Vertex array object                                started (Fredrik Höglund)
+  - Sampler object                                     not started
+  - Program Pipeline object                            not started
+  - Query object                                       started (Martin Peres)
+  GL_ARB_get_texture_sub_image                         started (Brian Paul)
+  GL_ARB_shader_texture_image_samples                  not started
+  GL_ARB_texture_barrier                               DONE (nv50, nvc0, r300, r600, radeonsi)
+  GL_KHR_context_flush_control                         DONE (all - but needs GLX/EXT extension to be useful)
   GL_KHR_robust_buffer_access_behavior                 not started
   GL_KHR_robustness                                    90% done (the ARB variant)
-  GL_EXT_shader_integer_mix                            DONE (all drivers that support GLSL)
 
 These are the extensions cherry-picked to make GLES 3.1
 GLES3.1, GLSL ES 3.1
-  GL_ARB_arrays_of_arrays                              DONE (all drivers that support GLSL 1.30)
-  GL_ARB_compute_shader                                DONE (i965)
-  GL_ARB_draw_indirect                                 DONE (i965, nvc0, r600, radeonsi, llvmpipe, softpipe)
+  GL_ARB_arrays_of_arrays                              started (Timothy)
+  GL_ARB_compute_shader                                in progress (jljusten)
   GL_ARB_explicit_uniform_location                     DONE (all drivers that support GLSL)
-  GL_ARB_framebuffer_no_attachments                    DONE (i965)
-  GL_ARB_program_interface_query                       DONE (all drivers)
-  GL_ARB_shader_atomic_counters                        DONE (i965, nvc0)
-  GL_ARB_shader_image_load_store                       DONE (i965)
-  GL_ARB_shader_image_size                             DONE (i965)
-  GL_ARB_shader_storage_buffer_object                  DONE (i965, nvc0)
-  GL_ARB_shading_language_packing                      DONE (all drivers)
+  GL_ARB_framebuffer_no_attachments                    not started
+  GL_ARB_program_interface_query                       not started
+  GL_ARB_shader_atomic_counters                        DONE (i965)
+  GL_ARB_shader_image_load_store                       in progress (curro)
+  GL_ARB_shader_storage_buffer_object                  not started
   GL_ARB_separate_shader_objects                       DONE (all drivers)
   GL_ARB_stencil_texturing                             DONE (i965/gen8+, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  Multisample textures (GL_ARB_texture_multisample)    DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_texture_storage_multisample                   DONE (all drivers that support GL_ARB_texture_multisample)
   GL_ARB_vertex_attrib_binding                         DONE (all drivers)
   GS5 Enhanced textureGather                           DONE (i965, nvc0, r600, radeonsi)
-  GS5 Packing/bitfield/conversion functions            DONE (i965, nvc0, r600, radeonsi)
+  GS5 Packing/bitfield/conversion functions            DONE (i965, nvc0, r600)
   GL_EXT_shader_integer_mix                            DONE (all drivers that support GLSL)
 
-  Additional functionality not covered above:
-      glMemoryBarrierByRegion                          DONE
-      glGetTexLevelParameter[fi]v - needs updates      DONE
-      glGetBooleani_v - restrict to GLES enums
-      gl_HelperInvocation support                      DONE (i965, nvc0, r600)
-
-GLES3.2, GLSL ES 3.2
-  GL_EXT_color_buffer_float                            DONE (all drivers)
-  GL_KHR_blend_equation_advanced                       not started
-  GL_KHR_debug                                         DONE (all drivers)
-  GL_KHR_robustness                                    90% done (the ARB variant)
-  GL_KHR_texture_compression_astc_ldr                  DONE (i965/gen9+)
-  GL_OES_copy_image                                    not started (based on GL_ARB_copy_image, which is done for some drivers)
-  GL_OES_draw_buffers_indexed                          not started
-  GL_OES_draw_elements_base_vertex                     DONE (all drivers)
-  GL_OES_geometry_shader                               started (Marta)
-  GL_OES_gpu_shader5                                   not started (based on parts of GL_ARB_gpu_shader5, which is done for some drivers)
-  GL_OES_primitive_bounding box                        not started
-  GL_OES_sample_shading                                not started (based on parts of GL_ARB_sample_shading, which is done for some drivers)
-  GL_OES_sample_variables                              not started (based on parts of GL_ARB_sample_shading, which is done for some drivers)
-  GL_OES_shader_image_atomic                           not started (based on parts of GL_ARB_shader_image_load_store, which is done for some drivers)
-  GL_OES_shader_io_blocks                              not started (based on parts of GLSL 1.50, which is done)
-  GL_OES_shader_multisample_interpolation              not started (based on parts of GL_ARB_gpu_shader5, which is done)
-  GL_OES_tessellation_shader                           not started (based on GL_ARB_tessellation_shader, which is done for some drivers)
-  GL_OES_texture_border_clamp                          not started (based on GL_ARB_texture_border_clamp, which is done)
-  GL_OES_texture_buffer                                not started (based on GL_ARB_texture_buffer_object, GL_ARB_texture_buffer_range, and GL_ARB_texture_buffer_object_rgb32 that are all done)
-  GL_OES_texture_cube_map_array                        not started (based on GL_ARB_texture_cube_map_array, which is done for all drivers)
-  GL_OES_texture_stencil8                              DONE (all drivers that support GL_ARB_texture_stencil8)
-  GL_OES_texture_storage_multisample_2d_array          DONE (all drivers that support GL_ARB_texture_multisample)
 
 More info about these features and the work involved can be found at
 http://dri.freedesktop.org/wiki/MissingFunctionality

docs/README.UVD

@@ -2,8 +2,8 @@ The software may implement third party technologies (e.g. third party
 libraries) that are not licensed to you by AMD and for which you may need
 to obtain licenses from other parties.  Unless explicitly stated otherwise,
 these third party technologies are not licensed hereunder.  Such third
-party technologies include, but are not limited, to H.264, H.265, HEVC, MPEG-2,
-MPEG-4, AVC, and VC-1.
+party technologies include, but are not limited, to H.264, MPEG-2, MPEG-4,
+AVC, and VC-1.
 
 For MPEG-2 Encoding Products ANY USE OF THIS PRODUCT IN ANY MANNER OTHER
 THAN PERSONAL USE THAT COMPLIES WITH THE MPEG-2 STANDARD FOR ENCODING VIDEO

docs/README.WIN32

@@ -11,6 +11,10 @@ no longer shipped or supported.
 
 Run
 
+  scons osmesa mesagdi
+
+to build classic mesa Windows GDI drivers; or
+
   scons libgl-gdi
 
 to build gallium based GDI driver.

docs/VERSIONS

@@ -103,7 +103,7 @@ Mesa Version History
 	- Stencil-related functions now work in display lists
     Changes:
 	- renamed aux.h as glaux.h (MS-DOS names can't start with aux)
-	- most filenames are in 8.3 format to accommodate MS-DOS
+	- most filenames are in 8.3 format to accomodate MS-DOS
 	- use GLubytes to store arrays of colors instead of GLints
 
 1.2.2   August 2, 1995
@@ -1007,7 +1007,7 @@ Mesa Version History
 	- glGetTexImage was using pixel unpacking instead of packing params
 	- auto-mipmap generation for cube maps was incorrect
     Changes:
-	- max texture units reduced to six to accommodate texture rectangles
+	- max texture units reduced to six to accomodate texture rectangles
 	- removed unfinished GL_MESA_sprite_point extension code
 
 

docs/autoconf.html

@@ -87,13 +87,6 @@ created in a <code>lib64</code> directory at the top of the Mesa source
 tree.</p>
 </dd>
 
-<dt><code>--sysconfdir=DIR</code></dt>
-<dd><p>This option specifies the directory where the configuration
-files will be installed. The default is <code>${prefix}/etc</code>.
-Currently there's only one config file provided when dri drivers are
-enabled - it's <code>drirc</code>.</p>
-</dd>
-
 <dt><code>--enable-static, --disable-shared</code></dt>
 <dd><p>By default, Mesa
 will build shared libraries. Either of these options will force static
@@ -224,7 +217,7 @@ GLX.
 <dt><code>--with-expat=DIR</code>
 <dd><p><strong>DEPRECATED</strong>, use <code>PKG_CONFIG_PATH</code> instead.</p>
 <p>The DRI-enabled libGL uses expat to
-parse the DRI configuration files in <code>${sysconfdir}/drirc</code> and
+parse the DRI configuration files in <code>/etc/drirc</code> and
 <code>~/.drirc</code>. This option allows a specific expat installation
 to be used. For example, <code>--with-expat=/usr/local</code> will
 search for expat headers and libraries in <code>/usr/local/include</code>

docs/contents.html

@@ -61,6 +61,7 @@
 <li><a href="shading.html" target="_parent">Shading Language</a>
 <li><a href="egl.html" target="_parent">EGL</a>
 <li><a href="opengles.html" target="_parent">OpenGL ES</a>
+<li><a href="openvg.html" target="_parent">OpenVG / Vega</a>
 <li><a href="envvars.html" target="_parent">Environment Variables</a>
 <li><a href="osmesa.html" target="_parent">Off-Screen Rendering</a>
 <li><a href="debugging.html" target="_parent">Debugging Tips</a>
@@ -90,14 +91,14 @@
 <li><a href="http://www.opengl.org" target="_parent">OpenGL website</a>
 <li><a href="http://dri.freedesktop.org" target="_parent">DRI website</a>
 <li><a href="http://www.freedesktop.org" target="_parent">freedesktop.org</a>
-<li><a href="http://planet.freedesktop.org" target="_parent">Developer blogs</a>
 </ul>
 
 <b>Hosted by:</b>
 <br>
 <blockquote>
 <a href="http://sourceforge.net"
-target="_parent">sourceforge.net</a>
+target="_parent"><img src="http://sourceforge.net/sflogo.php?group_id=3&amp;type=1"
+width="88" height="31" align="bottom" alt="Sourceforge.net" border="0"></a>
 </blockquote>
 
 </body>

docs/devinfo.html

@@ -17,240 +17,158 @@
 <h1>Development Notes</h1>
 
 
+<h2>Adding Extensions</h2>
+
+<p>
+To add a new GL extension to Mesa you have to do at least the following.
+
 <ul>
-<li><a href="#style">Coding Style</a>
-<li><a href="#submitting">Submitting Patches</a>
-<li><a href="#release">Making a New Mesa Release</a>
-<li><a href="#extensions">Adding Extensions</a>
+<li>
+   If glext.h doesn't define the extension, edit include/GL/gl.h and add
+   code like this:
+   <pre>
+     #ifndef GL_EXT_the_extension_name
+     #define GL_EXT_the_extension_name 1
+     /* declare the new enum tokens */
+     /* prototype the new functions */
+     /* TYPEDEFS for the new functions */
+     #endif
+   </pre>
+</li>
+<li>
+   In the src/mapi/glapi/gen/ directory, add the new extension functions and
+   enums to the gl_API.xml file.
+   Then, a bunch of source files must be regenerated by executing the
+   corresponding Python scripts.
+</li>
+<li>
+   Add a new entry to the <code>gl_extensions</code> struct in mtypes.h
+</li>
+<li>
+   Update the <code>extensions.c</code> file.
+</li>
+<li>
+   From this point, the best way to proceed is to find another extension,
+   similar to the new one, that's already implemented in Mesa and use it
+   as an example.
+</li>
+<li>
+   If the new extension adds new GL state, the functions in get.c, enable.c
+   and attrib.c will most likely require new code.
+</li>
+<li>
+   The dispatch tests check_table.cpp and dispatch_sanity.cpp
+   should be updated with details about the new extensions functions. These
+   tests are run using 'make check'
+</li>
 </ul>
 
 
-<h2 id="style">Coding Style</h2>
+
+<h2>Coding Style</h2>
 
 <p>
-Mesa is over 20 years old and the coding style has evolved over time.
-Some old parts use a style that's a bit out of date.
-If the guidelines below don't cover something, try following the format of
-existing, neighboring code.
+Mesa's code style has changed over the years.  Here's the latest.
 </p>
 
 <p>
-Basic formatting guidelines
+Comment your code!  It's extremely important that open-source code be
+well documented.  Also, strive to write clean, easily understandable code.
 </p>
 
-<ul>
-<li>3-space indentation, no tabs.
-<li>Limit lines to 78 or fewer characters.  The idea is to prevent line
-wrapping in 80-column editors and terminals.  There are exceptions, such
-as if you're defining a large, static table of information.
-<li>Opening braces go on the same line as the if/for/while statement.
-For example:
+<p>
+3-space indentation
+</p>
+
+<p>
+If you use tabs, set them to 8 columns
+</p>
+
+<p>
+Line width: the preferred width to fill comments and code in Mesa is 78
+columns.  Exceptions are sometimes made for clarity (e.g. tabular data is
+sometimes filled to a much larger width so that extraneous carriage returns
+don't obscure the table).
+</p>
+
+<p>
+Brace example:
+</p>
 <pre>
-   if (condition) {
-      foo;
-   } else {
-      bar;
-   }
+	if (condition) {
+	   foo;
+	}
+	else {
+	   bar;
+	}
+
+	switch (condition) {
+	case 0:
+	   foo();
+	   break;
+
+	case 1: {
+	   ...
+	   break;
+	}
+
+	default:
+	   ...
+	   break;
+	}
 </pre>
 
-<li>Put a space before/after operators.  For example, <tt>a = b + c;</tt>
-and not <tt>a=b+c;</tt>
-
-<li>This GNU indent command generally does the right thing for formatting:
+<p>
+Here's the GNU indent command which will best approximate my preferred style:
+(Note that it won't format switch statements in the preferred way)
+</p>
 <pre>
-   indent -br -i3 -npcs --no-tabs infile.c -o outfile.c
+	indent -br -i3 -npcs --no-tabs infile.c -o outfile.c
 </pre>
 
-<li>Use comments wherever you think it would be helpful for other developers.
-Several specific cases and style examples follow.  Note that we roughly
-follow <a href="http://www.stack.nl/~dimitri/doxygen/">Doxygen</a> conventions.
-<br>
-<br>
-Single-line comments:
+
+<p>
+Local variable name example:  localVarName (no underscores)
+</p>
+
+<p>
+Constants and macros are ALL_UPPERCASE, with _ between words
+</p>
+
+<p>
+Global variables are not allowed.
+</p>
+
+<p>
+Function name examples:
+</p>
 <pre>
-   /* null-out pointer to prevent dangling reference below */
-   bufferObj = NULL;
-</pre>
-Or,
-<pre>
-   bufferObj = NULL;  /* prevent dangling reference below */
-</pre>
-Multi-line comment:
-<pre>
-   /* If this is a new buffer object id, or one which was generated but
-    * never used before, allocate a buffer object now.
-    */
-</pre>
-We try to quote the OpenGL specification where prudent:
-<pre>
-   /* Page 38 of the PDF of the OpenGL ES 3.0 spec says:
-    *
-    *     "An INVALID_OPERATION error is generated for any of the following
-    *     conditions:
-    *
-    *     * <length> is zero."
-    *
-    * Additionally, page 94 of the PDF of the OpenGL 4.5 core spec
-    * (30.10.2014) also says this, so it's no longer allowed for desktop GL,
-    * either.
-    */
-</pre>
-Function comment example:
-<pre>
-   /**
-    * Create and initialize a new buffer object.  Called via the
-    * ctx->Driver.CreateObject() driver callback function.
-    * \param  name  integer name of the object
-    * \param  type  one of GL_FOO, GL_BAR, etc.
-    * \return  pointer to new object or NULL if error
-    */
-   struct gl_object *
-   _mesa_create_object(GLuint name, GLenum type)
-   {
-      /* function body */
-   }
+	glFooBar()       - a public GL entry point (in glapi_dispatch.c)
+	_mesa_FooBar()   - the internal immediate mode function
+	save_FooBar()    - retained mode (display list) function in dlist.c
+	foo_bar()        - a static (private) function
+	_mesa_foo_bar()  - an internal non-static Mesa function
 </pre>
 
-<li>Put the function return type and qualifiers on one line and the function
-name and parameters on the next, as seen above.  This makes it easy to use
-<code>grep ^function_name dir/*</code> to find function definitions.  Also,
-the opening brace goes on the next line by itself (see above.)
-
-<li>Function names follow various conventions depending on the type of function:
-<pre>
-   glFooBar()       - a public GL entry point (in glapi_dispatch.c)
-   _mesa_FooBar()   - the internal immediate mode function
-   save_FooBar()    - retained mode (display list) function in dlist.c
-   foo_bar()        - a static (private) function
-   _mesa_foo_bar()  - an internal non-static Mesa function
-</pre>
-
-<li>Constants, macros and enumerant names are ALL_UPPERCASE, with _ between
-words.
-<li>Mesa usually uses camel case for local variables (Ex: "localVarname")
-while gallium typically uses underscores (Ex: "local_var_name").
-<li>Global variables are almost never used because Mesa should be thread-safe.
-
-<li>Booleans.  Places that are not directly visible to the GL API
-should prefer the use of <tt>bool</tt>, <tt>true</tt>, and
+<p>
+Places that are not directly visible to the GL API should prefer the use
+of <tt>bool</tt>, <tt>true</tt>, and
 <tt>false</tt> over <tt>GLboolean</tt>, <tt>GL_TRUE</tt>, and
 <tt>GL_FALSE</tt>.  In C code, this may mean that
 <tt>#include &lt;stdbool.h&gt;</tt> needs to be added.  The
 <tt>try_emit_</tt>* methods in src/mesa/program/ir_to_mesa.cpp and
 src/mesa/state_tracker/st_glsl_to_tgsi.cpp can serve as examples.
-
-</ul>
-
-
-<h2 id="submitting">Submitting patches</h2>
-
-<p>
-The basic guidelines for submitting patches are:
 </p>
 
-<ul>
-<li>Patches should be sufficiently tested before submitting.
-<li>Code patches should follow Mesa coding conventions.
-<li>Whenever possible, patches should only effect individual Mesa/Gallium
-components.
-<li>Patches should never introduce build breaks and should be bisectable (see
-<code>git bisect</code>.)
-<li>Patches should be properly formatted (see below).
-<li>Patches should be submitted to mesa-dev for review using
-<code>git send-email</code>.
-<li>Patches should not mix code changes with code formatting changes (except,
-perhaps, in very trivial cases.)
-</ul>
-
-<h3>Patch formatting</h3>
+<h2>Submitting patches</h2>
 
 <p>
-The basic rules for patch formatting are:
-</p>
-
-<ul>
-<li>Lines should be limited to 75 characters or less so that git logs
-displayed in 80-column terminals avoid line wrapping.  Note that git
-log uses 4 spaces of indentation (4 + 75 &lt; 80).
-<li>The first line should be a short, concise summary of the change prefixed
-with a module name.  Examples:
-<pre>
-    mesa: Add support for querying GL_VERTEX_ATTRIB_ARRAY_LONG
-
-    gallium: add PIPE_CAP_DEVICE_RESET_STATUS_QUERY
-
-    i965: Fix missing type in local variable declaration.
-</pre>
-<li>Subsequent patch comments should describe the change in more detail,
-if needed.  For example:
-<pre>
-    i965: Remove end-of-thread SEND alignment code.
-    
-    This was present in Eric's initial implementation of the compaction code
-    for Sandybridge (commit 077d01b6). There is no documentation saying this
-    is necessary, and removing it causes no regressions in piglit on any
-    platform.
-</pre>
-<li>A "Signed-off-by:" line is not required, but not discouraged either.
-<li>If a patch address a bugzilla issue, that should be noted in the
-patch comment.  For example:
-<pre>
-   Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=89689
-</pre>
-<li>If there have been several revisions to a patch during the review
-process, they should be noted such as in this example:
-<pre>
-    st/mesa: add ARB_texture_stencil8 support (v4)
-    
-    if we support stencil texturing, enable texture_stencil8
-    there is no requirement to support native S8 for this,
-    the texture can be converted to x24s8 fine.
-    
-    v2: fold fixes from Marek in:
-       a) put S8 last in the list
-       b) fix renderable to always test for d/s renderable
-        fixup the texture case to use a stencil only format
-        for picking the format for the texture view.
-    v3: hit fallback for getteximage
-    v4: put s8 back in front, it shouldn't get picked now (Ilia)
-</pre>
-<li>If someone tested your patch, document it with a line like this:
-<pre>
-    Tested-by: Joe Hacker &lt;jhacker@foo.com&gt;
-</pre>
-<li>If the patch was reviewed (usually the case) or acked by someone,
-that should be documented with:
-<pre>
-    Reviewed-by: Joe Hacker &lt;jhacker@foo.com&gt;
-    Acked-by: Joe Hacker &lt;jhacker@foo.com&gt;
-</pre>
-</ul>
-
-
-
-<h3>Testing Patches</h3>
-
-<p>
-It should go without saying that patches must be tested.  In general,
-do whatever testing is prudent.
-</p>
-
-<p>
-You should always run the Mesa test suite before submitting patches.
-The test suite can be run using the 'make check' command. All tests
+You should always run the Mesa Testsuite before submitting patches.
+The Testsuite can be run using the 'make check' command. All tests
 must pass before patches will be accepted, this may mean you have
 to update the tests themselves.
 </p>
 
-<p>
-Whenever possible and applicable, test the patch with
-<a href="http://piglit.freedesktop.org">Piglit</a> to
-check for regressions.
-</p>
-
-
-<h3>Mailing Patches</h3>
-
 <p>
 Patches should be sent to the Mesa mailing list for review.
 When submitting a patch make sure to use git send-email rather than attaching
@@ -266,38 +184,7 @@ re-sending the whole series). Using --in-reply-to makes
 it harder for reviewers to accidentally review old patches.
 </p>
 
-<p>
-When submitting follow-up patches you should also login to
-<a href="https://patchwork.freedesktop.org">patchwork</a> and change the
-state of your old patches to Superseded.
-</p>
-
-<h3>Reviewing Patches</h3>
-
-<p>
-When you've reviewed a patch on the mailing list, please be unambiguous
-about your review.  That is, state either
-<pre>
-    Reviewed-by: Joe Hacker &lt;jhacker@foo.com&gt;
-</pre>
-or
-<pre>
-    Acked-by: Joe Hacker &lt;jhacker@foo.com&gt;
-</pre>
-Rather than saying just "LGTM" or "Seems OK".
-</p>
-
-<p>
-If small changes are suggested, it's OK to say something like:
-<pre>
-   With the above fixes, Reviewed-by: Joe Hacker &lt;jhacker@foo.com&gt;
-</pre>
-which tells the patch author that the patch can be committed, as long
-as the issues are resolved first.
-</p>
-
-
-<h3>Marking a commit as a candidate for a stable branch</h3>
+<h2>Marking a commit as a candidate for a stable branch</h2>
 
 <p>
 If you want a commit to be applied to a stable branch,
@@ -334,7 +221,7 @@ the upcoming stable release can always be seen on the
 <a href="http://cworth.org/~cworth/mesa-stable-queue/">Mesa Stable Queue</a>
 page.
 
-<h3>Criteria for accepting patches to the stable branch</h3>
+<h2>Criteria for accepting patches to the stable branch</h2>
 
 Mesa has a designated release manager for each stable branch, and the release
 manager is the only developer that should be pushing changes to these
@@ -419,8 +306,7 @@ be rejected:
   regression that is unaacceptable for the stable branch.</li>
 </ul>
 
-
-<h2 id="release">Making a New Mesa Release</h2>
+<h2>Making a New Mesa Release</h2>
 
 <p>
 These are the instructions for making a new Mesa release.
@@ -570,7 +456,7 @@ Edit docs/relnotes/X.Y.Z.html to add the sha256sums printed as part of "make
 tarballs" in the previous step. Commit this change.
 </p>
 
-<h3>Push all commits and the tag created above</h3>
+<h3>Push all commits and the tag creates above</h3>
 
 <p>
 This is the first step that cannot easily be undone. The release is going
@@ -597,7 +483,7 @@ signatures to the freedesktop.org server:
 	mv ~/MesaLib-X.Y.Z* .
 </pre>
 
-<h3>Back on mesa master, add the new release notes into the tree</h3>
+<h3>Back on mesa master, andd the new release notes into the tree</h3>
 
 <p>
 Something like the following steps will do the trick:
@@ -657,56 +543,6 @@ release announcement:
 </pre>
 </p>
 
-
-<h2 id="extensions">Adding Extensions</h2>
-
-<p>
-To add a new GL extension to Mesa you have to do at least the following.
-
-<ul>
-<li>
-   If glext.h doesn't define the extension, edit include/GL/gl.h and add
-   code like this:
-   <pre>
-     #ifndef GL_EXT_the_extension_name
-     #define GL_EXT_the_extension_name 1
-     /* declare the new enum tokens */
-     /* prototype the new functions */
-     /* TYPEDEFS for the new functions */
-     #endif
-   </pre>
-</li>
-<li>
-   In the src/mapi/glapi/gen/ directory, add the new extension functions and
-   enums to the gl_API.xml file.
-   Then, a bunch of source files must be regenerated by executing the
-   corresponding Python scripts.
-</li>
-<li>
-   Add a new entry to the <code>gl_extensions</code> struct in mtypes.h
-</li>
-<li>
-   Update the <code>extensions.c</code> file.
-</li>
-<li>
-   From this point, the best way to proceed is to find another extension,
-   similar to the new one, that's already implemented in Mesa and use it
-   as an example.
-</li>
-<li>
-   If the new extension adds new GL state, the functions in get.c, enable.c
-   and attrib.c will most likely require new code.
-</li>
-<li>
-   The dispatch tests check_table.cpp and dispatch_sanity.cpp
-   should be updated with details about the new extensions functions. These
-   tests are run using 'make check'
-</li>
-</ul>
-
-
-
-
 </div>
 </body>
 </html>

docs/dispatch.html

@@ -204,8 +204,9 @@ terribly relevant.</p>
 few preprocessor defines.</p>
 
 <ul>
-<li>If <tt>GLX_USE_TLS</tt> is defined, method #3 is used.</li>
-<li>If <tt>HAVE_PTHREAD</tt> is defined, method #2 is used.</li>
+<li>If <tt>GLX_USE_TLS</tt> is defined, method #4 is used.</li>
+<li>If <tt>HAVE_PTHREAD</tt> is defined, method #3 is used.</li>
+<li>If <tt>WIN32_THREADS</tt> is defined, method #2 is used.</li>
 <li>If none of the preceding are defined, method #1 is used.</li>
 </ul>
 

docs/egl.html

@@ -88,11 +88,8 @@ types such as <code>EGLNativeDisplayType</code> or
 <code>EGLNativeWindowType</code> defined for.</p>
 
 <p>The available platforms are <code>x11</code>, <code>drm</code>,
-<code>wayland</code>, <code>surfaceless</code>, <code>android</code>,
-and <code>haiku</code>.  The <code>android</code> platform
-can only be built as a system component, part of AOSP, while the
-<code>haiku</code> platform can only be built with SCons.
-Unless for special needs, the build system should
+<code>fbdev</code>, and <code>gdi</code>.  The <code>gdi</code> platform can
+only be built with SCons.  Unless for special needs, the build system should
 select the right platforms automatically.</p>
 
 </dd>
@@ -115,6 +112,13 @@ is required if applications mix OpenGL and OpenGL ES.</p>
 
 </dd>
 
+<dt><code>--enable-openvg</code></dt>
+<dd>
+
+<p>OpenVG must be explicitly enabled by this option.</p>
+
+</dd>
+
 </dl>
 
 <h2>Use EGL</h2>
@@ -183,6 +187,14 @@ probably required only for some of the demos found in mesa/demo repository.</p>
 values are: <code>debug</code>, <code>info</code>, <code>warning</code>, and
 <code>fatal</code>.</p>
 
+</dd>
+
+<dt><code>EGL_SOFTWARE</code></dt>
+<dd>
+
+<p>For drivers that support both hardware and software rendering, setting this
+variable to true forces the use of software rendering.</p>
+
 </dd>
 </dl>
 
@@ -200,15 +212,38 @@ the X server directly using (XCB-)DRI2 protocol.</p>
 
 </dd>
 
+<dt><code>egl_gallium</code></dt>
+<dd>
+
+<p>This driver is based on Gallium3D.  It supports all rendering APIs and
+hardware supported by Gallium3D.  It is the only driver that supports OpenVG.
+The supported platforms are X11, DRM, FBDEV, and GDI.</p>
+
+<p>This driver comes with its own hardware drivers
+(<code>pipe_&lt;hw&gt;</code>) and client API modules
+(<code>st_&lt;api&gt;</code>).</p>
+
+</dd>
+
 <h2>Packaging</h2>
 
 <p>The ABI between the main library and its drivers are not stable.  Nor is
-there a plan to stabilize it at the moment.</p>
+there a plan to stabilize it at the moment.  Of the EGL drivers,
+<code>egl_gallium</code> has its own hardware drivers and client API modules.
+They are considered internal to <code>egl_gallium</code> and there is also no
+stable ABI between them.  These should be kept in mind when packaging for
+distribution.</p>
+
+<p>Generally, <code>egl_dri2</code> is preferred over <code>egl_gallium</code>
+when the system already has DRI drivers.  As <code>egl_gallium</code> is loaded
+before <code>egl_dri2</code> when both are available, <code>egl_gallium</code>
+is disabled by default.</p>
 
 <h2>Developers</h2>
 
-<p>The sources of the main library and drivers can be found at
-<code>src/egl/</code>.</p>
+<p>The sources of the main library and the classic drivers can be found at
+<code>src/egl/</code>.  The sources of the <code>egl</code> state tracker can
+be found at <code>src/gallium/state_trackers/egl/</code>.</p>
 
 <h3>Lifetime of Display Resources</h3>
 

docs/envvars.html

@@ -34,7 +34,6 @@ sometimes be useful for debugging end-user issues.
 <li>LIBGL_NO_DRAWARRAYS - if set do not use DrawArrays GLX protocol (for debugging)
 <li>LIBGL_SHOW_FPS - print framerate to stdout based on the number of glXSwapBuffers
     calls per second.
-<li>LIBGL_DRI3_DISABLE - disable DRI3 if set (the value does not matter)
 </ul>
 
 
@@ -91,20 +90,11 @@ This is only valid for versions &gt;= 3.0.
 <li> Mesa may not really implement all the features of the given version.
 (for developers only)
 </ul>
-<li>MESA_GLES_VERSION_OVERRIDE - changes the value returned by
-glGetString(GL_VERSION) for OpenGL ES.
-<ul>
-<li> The format should be MAJOR.MINOR
-<li> Examples: 2.0, 3.0, 3.1
-<li> Mesa may not really implement all the features of the given version.
-(for developers only)
-</ul>
 <li>MESA_GLSL_VERSION_OVERRIDE - changes the value returned by
 glGetString(GL_SHADING_LANGUAGE_VERSION). Valid values are integers, such as
 "130".  Mesa will not really implement all the features of the given language version
 if it's higher than what's normally reported. (for developers only)
 <li>MESA_GLSL - <a href="shading.html#envvars">shading language compiler options</a>
-<li>MESA_NO_MINMAX_CACHE - when set, the minmax index cache is globally disabled.
 </ul>
 
 
@@ -162,7 +152,6 @@ See the <a href="xlibdriver.html">Xlib software driver page</a> for details.
    <li>no16 - suppress generation of 16-wide fragment shaders. useful for debugging broken shaders</li>
    <li>blorp - emit messages about the blorp operations (blits &amp; clears)</li>
    <li>nodualobj - suppress generation of dual-object geometry shader code</li>
-   <li>optimizer - dump shader assembly to files at each optimization pass and iteration that make progress</li>
 </ul>
 </ul>
 
@@ -188,14 +177,6 @@ Mesa EGL supports different sets of environment variables.  See the
 <li>GALLIUM_HUD - draws various information on the screen, like framerate,
     cpu load, driver statistics, performance counters, etc.
     Set GALLIUM_HUD=help and run e.g. glxgears for more info.
-<li>GALLIUM_HUD_PERIOD - sets the hud update rate in seconds (float). Use zero
-    to update every frame. The default period is 1/2 second.
-<li>GALLIUM_HUD_VISIBLE - control default visibility, defaults to true.
-<li>GALLIUM_HUD_TOGGLE_SIGNAL - toggle visibility via user specified signal.
-    Especially useful to toggle hud at specific points of application and
-    disable for unencumbered viewing the rest of the time. For example, set
-    GALLIUM_HUD_VISIBLE to false and GALLIUM_HUD_SIGNAL_TOGGLE to 10 (SIGUSR1).
-    Use kill -10 <pid> to toggle the hud as desired.
 <li>GALLIUM_LOG_FILE - specifies a file for logging all errors, warnings, etc.
     rather than stderr.
 <li>GALLIUM_PRINT_OPTIONS - if non-zero, print all the Gallium environment
@@ -232,7 +213,7 @@ See src/mesa/state_tracker/st_debug.c for other options.
 <li>LP_PERF - a comma-separated list of options to selectively no-op various
     parts of the driver.  See the source code for details.
 <li>LP_NUM_THREADS - an integer indicating how many threads to use for rendering.
-    Zero turns off threading completely.  The default value is the number of CPU
+    Zero turns of threading completely.  The default value is the number of CPU
     cores present.
 </ul>
 
@@ -247,31 +228,6 @@ for details.
 </ul>
 
 
-<h3>VA-API state tracker environment variables</h3>
-<ul>
-<li>VAAPI_MPEG4_ENABLED - enable MPEG4 for VA-API, disabled by default.
-</ul>
-
-
-<h3>VC4 driver environment variables</h3>
-<ul>
-<li>VC4_DEBUG - a comma-separated list of named flags, which do various things:
-<ul>
-   <li>cl - dump command list during creation</li>
-   <li>qpu - dump generated QPU instructions</li>
-   <li>qir - dump QPU IR during program compile</li>
-   <li>nir - dump NIR during program compile</li>
-   <li>tgsi - dump TGSI during program compile</li>
-   <li>shaderdb - dump program compile information for shader-db analysis</li>
-   <li>perf - print during performance-related events</li>
-   <li>norast - skip actual hardware execution of commands</li>
-   <li>always_flush - flush after each draw call</li>
-   <li>always_sync - wait for finish after each flush</li>
-   <li>dump - write a GPU command stream trace file (VC4 simulator only)</li>
-</ul>
-</ul>
-
-
 <p>
 Other Gallium drivers have their own environment variables.  These may change
 frequently so the source code should be consulted for details.

docs/faq.html

@@ -327,6 +327,19 @@ Basically, applying a translation of (0.375, 0.375, 0.0) to your coordinates
 will fix the problem.
 </p>
 
+<h2>3.6 How can I change the maximum framebuffer size in Mesa's
+<tt>swrast</tt> backend?</h2>
+<p>
+These can be overridden by using the <tt>--with-max-width</tt> and
+<tt>--with-max-height</tt> options.  The two need not be equal.
+</p><p>
+Do note that Mesa uses these values to size some internal buffers,
+so increasing these sizes will cause Mesa to require additional
+memory.  Furthermore, increasing these limits beyond <tt>4096</tt>
+may introduce rasterization artifacts; see the leading comments in
+<tt>src/mesa/swrast/s_tritemp.h</tt>.
+</p>
+
 <br>
 <br>
 

docs/index.html

@@ -16,243 +16,6 @@
 
 <h1>News</h1>
 
-<h2>February 10, 2016</h2>
-<p>
-<a href="relnotes/11.1.2.html">Mesa 11.1.2</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>January 22, 2016</h2>
-<p>
-<a href="relnotes/11.0.9.html">Mesa 11.0.9</a> is released.
-This is a bug-fix release.
-<br>
-NOTE: It is anticipated that 11.0.9 will be the final release in the 11.0
-series. Users of 11.0 are encouraged to migrate to the 11.1 series in order
-to obtain future fixes.
-</p>
-
-<h2>January 13, 2016</h2>
-<p>
-<a href="relnotes/11.1.1.html">Mesa 11.1.1</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>December 21, 2015</h2>
-<p>
-<a href="relnotes/11.0.8.html">Mesa 11.0.8</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>December 15, 2015</h2>
-<p>
-<a href="relnotes/11.1.0.html">Mesa 11.1.0</a> is released.  This is a new
-development release.  See the release notes for more information about
-the release.
-</p>
-
-<h2>December 9, 2015</h2>
-<p>
-<a href="relnotes/11.0.7.html">Mesa 11.0.7</a> is released.
-This is a bug-fix release.
-</p>
-<p>
-Mesa demos 8.3.0 is also released.
-See the <a href="http://lists.freedesktop.org/archives/mesa-announce/2015-December/000191.html">announcement</a> for more information about the release.
-You can download it from <a href="ftp://ftp.freedesktop.org/pub/mesa/demos/8.3.0/">ftp.freedesktop.org/pub/mesa/demos/8.3.0/</a>.
-</p>
-
-<h2>November 21, 2015</h2>
-<p>
-<a href="relnotes/11.0.6.html">Mesa 11.0.6</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>November 11, 2015</h2>
-<p>
-<a href="relnotes/11.0.5.html">Mesa 11.0.5</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>October 24, 2015</h2>
-<p>
-<a href="relnotes/11.0.4.html">Mesa 11.0.4</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>October 10, 2015</h2>
-<p>
-<a href="relnotes/11.0.3.html">Mesa 11.0.3</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>October 3, 2015</h2>
-<p>
-<a href="relnotes/10.6.9.html">Mesa 10.6.9</a> is released.
-This is a bug-fix release.
-<br>
-NOTE: It is anticipated that 10.6.9 will be the final release in the 10.6
-series. Users of 10.6 are encouraged to migrate to the 11.0 series in order
-to obtain future fixes.
-</p>
-
-<h2>September 28, 2015</h2>
-<p>
-<a href="relnotes/11.0.2.html">Mesa 11.0.2</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>September 26, 2015</h2>
-<p>
-<a href="relnotes/11.0.1.html">Mesa 11.0.1</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>September 20, 2015</h2>
-<p>
-<a href="relnotes/10.6.8.html">Mesa 10.6.8</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>September 12, 2015</h2>
-<p>
-<a href="relnotes/11.0.0.html">Mesa 11.0.0</a> is released.  This is a new
-development release.  See the release notes for more information about
-the release.
-</p>
-
-<h2>September 10, 2015</h2>
-<p>
-<a href="relnotes/10.6.7.html">Mesa 10.6.7</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>September 4, 2015</h2>
-<p>
-<a href="relnotes/10.6.6.html">Mesa 10.6.6</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>August 22, 2015</h2>
-<p>
-<a href="relnotes/10.6.5.html">Mesa 10.6.5</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>August 11, 2015</h2>
-<p>
-<a href="relnotes/10.6.4.html">Mesa 10.6.4</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>July 26, 2015</h2>
-<p>
-<a href="relnotes/10.6.3.html">Mesa 10.6.3</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>July 11, 2015</h2>
-<p>
-<a href="relnotes/10.6.2.html">Mesa 10.6.2</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>July 04, 2015</h2>
-<p>
-<a href="relnotes/10.5.9.html">Mesa 10.5.9</a> is released.
-This is a bug-fix release.
-<br>
-NOTE: It is anticipated that 10.5.9 will be the final release in the 10.5
-series. Users of 10.5 are encouraged to migrate to the 10.6 series in order
-to obtain future fixes.
-</p>
-
-<h2>June 29, 2015</h2>
-<p>
-<a href="relnotes/10.6.1.html">Mesa 10.6.1</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>June 20, 2015</h2>
-<p>
-<a href="relnotes/10.5.8.html">Mesa 10.5.8</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>June 14, 2015</h2>
-<p>
-<a href="relnotes/10.6.0.html">Mesa 10.6.0</a> is released.  This is a new
-development release.  See the release notes for more information about
-the release.
-</p>
-
-<h2>June 07, 2015</h2>
-<p>
-<a href="relnotes/10.5.7.html">Mesa 10.5.7</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>May 23, 2015</h2>
-<p>
-<a href="relnotes/10.5.6.html">Mesa 10.5.6</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>May 11, 2015</h2>
-<p>
-<a href="relnotes/10.5.5.html">Mesa 10.5.5</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>April 24, 2015</h2>
-<p>
-<a href="relnotes/10.5.4.html">Mesa 10.5.4</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>April 12, 2015</h2>
-<p>
-<a href="relnotes/10.5.3.html">Mesa 10.5.3</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>March 28, 2015</h2>
-<p>
-<a href="relnotes/10.5.2.html">Mesa 10.5.2</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>March 20, 2015</h2>
-<p>
-<a href="relnotes/10.4.7.html">Mesa 10.4.7</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>March 13, 2015</h2>
-<p>
-<a href="relnotes/10.5.1.html">Mesa 10.5.1</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>March 06, 2015</h2>
-<p>
-<a href="relnotes/10.5.0.html">Mesa 10.5.0</a> is released.  This is a new
-development release.  See the release notes for more information about
-the release.
-</p>
-
-<h2>March 06, 2015</h2>
-<p>
-<a href="relnotes/10.4.6.html">Mesa 10.4.6</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>February 21, 2015</h2>
-<p>
-<a href="relnotes/10.4.5.html">Mesa 10.4.5</a> is released.
-This is a bug-fix release.
-</p>
-
 <h2>February 06, 2015</h2>
 <p>
 <a href="relnotes/10.4.4.html">Mesa 10.4.4</a> is released.
@@ -1554,7 +1317,7 @@ The <a href="faq.html">Mesa FAQ</a> has been rewritten.
 	- glGetTexImage was using pixel unpacking instead of packing params
 	- auto-mipmap generation for cube maps was incorrect
     Changes:
-	- max texture units reduced to six to accommodate texture rectangles
+	- max texture units reduced to six to accomodate texture rectangles
 	- removed unfinished GL_MESA_sprite_point extension code
 </pre>
 

docs/install.html

@@ -39,7 +39,7 @@ Version 2.6.4 or later should work.
 </li>
 <br>
 <li><a href="http://www.makotemplates.org/">Python Mako module</a> -
-Python Mako module is required. Version 0.3.4 or later should work.
+Python Mako module is required. Version 0.7.3 or later should work.
 </li>
 </br>
 <li><a href="http://www.scons.org/">SCons</a> is required for building on
@@ -55,11 +55,8 @@ Versions 2.5.35 and 2.4.1, respectively, (or later) should work.
 <br>
 On Windows with MinGW, install flex and bison with:
 <pre>mingw-get install msys-flex msys-bison</pre>
-For MSVC on Windows, install
-<a href="http://winflexbison.sourceforge.net/">Win flex-bison</a>.
-</li>
-<br>
-<li>For building on Windows, Microsoft Visual Studio 2013 or later is required.
+For MSVC on Windows, you can find flex/bison programs on the
+<a href="ftp://ftp.freedesktop.org/pub/mesa/windows-utils/">Mesa ftp site</a>.
 </li>
 </ul>
 
@@ -130,13 +127,14 @@ by -debug for debug builds.
 To build Mesa with SCons for Windows on Linux using the MinGW crosscompiler toolchain do
 </p>
 <pre>
-    scons platform=windows toolchain=crossmingw machine=x86 libgl-gdi
+    scons platform=windows toolchain=crossmingw machine=x86 mesagdi libgl-gdi
 </pre>
 <p>
 This will create:
 </p>
 <ul>
-<li>build/windows-x86-debug/gallium/targets/libgl-gdi/opengl32.dll &mdash; Mesa + Gallium + softpipe (or llvmpipe), binary compatible with Windows's opengl32.dll
+<li>build/windows-x86-debug/mesa/drivers/windows/gdi/opengl32.dll &mdash; Mesa + swrast, binary compatible with Windows's opengl32.dll
+<li>build/windows-x86-debug/gallium/targets/libgl-gdi/opengl32.dll &mdash; Mesa + Gallium + softpipe, binary compatible with Windows's opengl32.dll
 </ul>
 <p>
 Put them all in the same directory to test them.

docs/libGL.txt

@@ -49,7 +49,7 @@ stderr if the LIBGL_DEBUG environment variable is defined.
 libGL.so is thread safe.  The overhead of thread safety for common,
 single-thread clients is negligible.  However, the overhead of thread
 safety for multi-threaded clients is significant.  Each GL API call
-requires two calls to pthread_get_specific() which can noticeably
+requires two calls to pthread_get_specific() which can noticably
 impact performance.  Warning:  libGL.so is thread safe but individual
 DRI drivers may not be.  Please consult the documentation for a driver
 to learn if it is thread safe.

docs/llvmpipe.html

@@ -58,37 +58,15 @@ It's the fastest software rasterizer for Mesa.
 </pre>
 
    <p>
-   For Windows you will need to build LLVM from source with MSVC or MINGW
-   (either natively or through cross compilers) and CMake, and set the LLVM
-   environment variable to the directory you installed it to.
+	 For Windows you will need to build LLVM from source with MSVC or MINGW
+	 (either natively or through cross compilers) and CMake, and set the LLVM
+	 environment variable to the directory you installed it to.
 
    LLVM will be statically linked, so when building on MSVC it needs to be
    built with a matching CRT as Mesa, and you'll need to pass
-   <code>-DLLVM_USE_CRT_xxx=yyy</code> as described below.
-   </p>
+   -DLLVM_USE_CRT_RELEASE=MTd for debug and checked builds,
+   -DLLVM_USE_CRT_RELEASE=MTd for profile and release builds.
 
-   <table border="1">
-     <tr>
-       <th rowspan="2">LLVM build-type</th>
-       <th colspan="2" align="center">Mesa build-type</th>
-     </tr>
-     <tr>
-       <th>debug,checked</th>
-       <th>release,profile</th>
-     </tr>
-     <tr>
-       <th>Debug</th>
-       <td><code>-DLLVM_USE_CRT_DEBUG=MTd</code></td>
-       <td><code>-DLLVM_USE_CRT_DEBUG=MT</code></td>
-     </tr>
-     <tr>
-       <th>Release</th>
-       <td><code>-DLLVM_USE_CRT_RELEASE=MTd</code></td>
-       <td><code>-DLLVM_USE_CRT_RELEASE=MT</code></td>
-     </tr>
-   </table>
-
-   <p>
    You can build only the x86 target by passing -DLLVM_TARGETS_TO_BUILD=X86
    to cmake.
    </p>

docs/openvg.html

@@ -0,0 +1,59 @@
+<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
+<html lang="en">
+<head>
+  <meta http-equiv="content-type" content="text/html; charset=utf-8">
+  <title>OpenVG State Tracker</title>
+  <link rel="stylesheet" type="text/css" href="mesa.css">
+</head>
+<body>
+
+<div class="header">
+  <h1>The Mesa 3D Graphics Library</h1>
+</div>
+
+<iframe src="contents.html"></iframe>
+<div class="content">
+
+<h1>OpenVG State Tracker</h1>
+
+<p>
+The current version of the OpenVG state tracker implements OpenVG 1.1.
+</p>
+<p>
+More information about OpenVG can be found at
+<a href="http://www.khronos.org/openvg/">
+http://www.khronos.org/openvg/</a> .
+</p>
+<p>
+The OpenVG state tracker depends on the Gallium architecture and a working EGL implementation.
+Please refer to <a href="egl.html">Mesa EGL</a> for more information about EGL.
+</p>
+
+
+<h2>Building the library</h2>
+<ol>
+<li>Run <code>configure</code> with <code>--enable-openvg</code> and
+<code>--enable-gallium-egl</code>.  If you do not need OpenGL, you can add
+<code>--disable-opengl</code> to save the compilation time.</li>
+
+<li>Build and install Mesa as usual.</li>
+</ol>
+
+<h3>Sample build</h3>
+A sample build looks as follows:
+<pre>
+  $ ./configure --disable-opengl --enable-openvg --enable-gallium-egl
+  $ make
+  $ make install
+</pre>
+
+<p>It will install <code>libOpenVG.so</code>, <code>libEGL.so</code>, and one
+or more EGL drivers.</p>
+
+<h2>OpenVG Demos</h2>
+
+<p>OpenVG demos can be found in mesa/demos repository.</p>
+
+</div>
+</body>
+</html>

docs/relnotes.html

@@ -21,42 +21,6 @@ The release notes summarize what's new or changed in each Mesa release.
 </p>
 
 <ul>
-<li><a href="relnotes/11.1.2.html">11.1.2 release notes</a>
-<li><a href="relnotes/11.0.9.html">11.0.9 release notes</a>
-<li><a href="relnotes/11.1.1.html">11.1.1 release notes</a>
-<li><a href="relnotes/11.0.8.html">11.0.8 release notes</a>
-<li><a href="relnotes/11.1.0.html">11.1.0 release notes</a>
-<li><a href="relnotes/11.0.7.html">11.0.7 release notes</a>
-<li><a href="relnotes/11.0.6.html">11.0.6 release notes</a>
-<li><a href="relnotes/11.0.5.html">11.0.5 release notes</a>
-<li><a href="relnotes/11.0.4.html">11.0.4 release notes</a>
-<li><a href="relnotes/11.0.3.html">11.0.3 release notes</a>
-<li><a href="relnotes/10.6.9.html">10.6.9 release notes</a>
-<li><a href="relnotes/11.0.2.html">11.0.2 release notes</a>
-<li><a href="relnotes/11.0.1.html">11.0.1 release notes</a>
-<li><a href="relnotes/10.6.8.html">10.6.8 release notes</a>
-<li><a href="relnotes/11.0.0.html">11.0.0 release notes</a>
-<li><a href="relnotes/10.6.7.html">10.6.7 release notes</a>
-<li><a href="relnotes/10.6.6.html">10.6.6 release notes</a>
-<li><a href="relnotes/10.6.5.html">10.6.5 release notes</a>
-<li><a href="relnotes/10.6.4.html">10.6.4 release notes</a>
-<li><a href="relnotes/10.6.3.html">10.6.3 release notes</a>
-<li><a href="relnotes/10.6.2.html">10.6.2 release notes</a>
-<li><a href="relnotes/10.5.9.html">10.5.9 release notes</a>
-<li><a href="relnotes/10.6.1.html">10.6.1 release notes</a>
-<li><a href="relnotes/10.5.8.html">10.5.8 release notes</a>
-<li><a href="relnotes/10.6.0.html">10.6.0 release notes</a>
-<li><a href="relnotes/10.5.7.html">10.5.7 release notes</a>
-<li><a href="relnotes/10.5.6.html">10.5.6 release notes</a>
-<li><a href="relnotes/10.5.5.html">10.5.5 release notes</a>
-<li><a href="relnotes/10.5.4.html">10.5.4 release notes</a>
-<li><a href="relnotes/10.5.3.html">10.5.3 release notes</a>
-<li><a href="relnotes/10.5.2.html">10.5.2 release notes</a>
-<li><a href="relnotes/10.4.7.html">10.4.7 release notes</a>
-<li><a href="relnotes/10.5.1.html">10.5.1 release notes</a>
-<li><a href="relnotes/10.5.0.html">10.5.0 release notes</a>
-<li><a href="relnotes/10.4.6.html">10.4.6 release notes</a>
-<li><a href="relnotes/10.4.5.html">10.4.5 release notes</a>
 <li><a href="relnotes/10.4.4.html">10.4.4 release notes</a>
 <li><a href="relnotes/10.4.3.html">10.4.3 release notes</a>
 <li><a href="relnotes/10.4.2.html">10.4.2 release notes</a>

docs/relnotes/10.0.3.html

@@ -104,7 +104,7 @@ a07b4b6b9eb449b88a6cb5061e51c331  MesaLib-10.0.3.zip
   <li>Add md5sums for 10.0.2. release.</li>
   <li>cherry-ignore: Ignore several patches not yet ready for the stable branch</li>
   <li>Drop another couple of patches.</li>
-  <li>cherry-ignore: Ignore 4 patches at the request of the author, (Anuj).</li>
+  <li>cherry-ignore: Ignore 4 patches at teh request of the author, (Anuj).</li>
   <li>Update version to 10.0.3</li>
 </ul>
 

docs/relnotes/10.4.5.html

@@ -1,114 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.4.5 Release Notes / February 21, 2015</h1>
-
-<p>
-Mesa 10.4.5 is a bug fix release which fixes bugs found since the 10.4.4 release.
-</p>
-<p>
-Mesa 10.4.5 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-e12bbdaee9a758617e8ebd0bb0e987f72addd11db2e4da25ba695e386cd63843  MesaLib-10.4.5.tar.gz
-bf60000700a9d58e3aca2bfeee7e781053b0d839e61a95b1883e05a2dee247a0  MesaLib-10.4.5.tar.bz2
-3b926de8eee500bb67cf85332c51292f826cc539b8636382aadbb8e70c76527a  MesaLib-10.4.5.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82477">Bug 82477</a> - [softpipe] piglit fp-long-alu regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88658">Bug 88658</a> - (bisected) Slow video playback on Kabini</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89069">Bug 89069</a> - Lack of grass in The Talos Principle on radeonsi (native\wine\nine)</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Carl Worth (1):</p>
-<ul>
-  <li>Revert use of Mesa IR optimizer for ARB_fragment_programs</li>
-</ul>
-
-<p>Emil Velikov (3):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.4.4 release</li>
-  <li>get-pick-list.sh: Require explicit "10.4" for nominating stable patches</li>
-  <li>Update version to 10.4.5</li>
-</ul>
-
-<p>Ilia Mirkin (3):</p>
-<ul>
-  <li>nvc0: bail out of 2d blits with non-A8_UNORM alpha formats</li>
-  <li>st/mesa: treat resource-less xfb buffers as if they weren't there</li>
-  <li>nvc0: allow holes in xfb target lists</li>
-</ul>
-
-<p>Jeremy Huddleston Sequoia (2):</p>
-<ul>
-  <li>darwin: build fix</li>
-  <li>darwin: build fix</li>
-</ul>
-
-<p>Kenneth Graunke (4):</p>
-<ul>
-  <li>i965: Override swizzles for integer luminance formats.</li>
-  <li>i965: Use a gl_color_union for sampler border color.</li>
-  <li>i965: Fix integer border color on Haswell.</li>
-  <li>glsl: Reduce memory consumption of copy propagation passes.</li>
-</ul>
-
-<p>Laura Ekstrand (1):</p>
-<ul>
-  <li>main: Fixed _mesa_GetCompressedTexImage_sw to copy slices correctly.</li>
-</ul>
-
-<p>Marek Olšák (5):</p>
-<ul>
-  <li>r600g,radeonsi: don't append to streamout buffers that haven't been used yet</li>
-  <li>radeonsi: fix instanced arrays with non-zero start instance</li>
-  <li>radeonsi: small fix in SPI state</li>
-  <li>mesa: fix AtomicBuffer typo in _mesa_DeleteBuffers</li>
-  <li>radeonsi: fix a crash if a stencil ref state is set before a DSA state</li>
-</ul>
-
-<p>Michel Dänzer (2):</p>
-<ul>
-  <li>st/mesa: Don't use PIPE_USAGE_STREAM for GL_PIXEL_UNPACK_BUFFER_ARB</li>
-  <li>Revert "radeon/llvm: enable unsafe math for graphics shaders"</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.4.6.html

@@ -1,143 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.4.6 Release Notes / March 06, 2015</h1>
-
-<p>
-Mesa 10.4.6 is a bug fix release which fixes bugs found since the 10.4.5 release.
-</p>
-<p>
-Mesa 10.4.6 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-46c9082142e811c01e49a2c332a9ac0a1eb98f2908985fb9df216539d7eaeaf4  MesaLib-10.4.6.tar.gz
-d8baedd20e79ccd98a5a7b05e23d59a30892e68de1fcc057ca6873dafca02735  MesaLib-10.4.6.tar.bz2
-6aded6eac7f0d4d55117b8b581d8424710bbb4c768fc90f7b881f29311a751aa  MesaLib-10.4.6.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=45348">Bug 45348</a> - [swrast] piglit fbo-drawbuffers-arbfp regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84613">Bug 84613</a> - [G965, bisected] piglit regressions : glslparsertest.glsl2</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87516">Bug 87516</a> - glProgramBinary violates spec</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88885">Bug 88885</a> - Transform feedback uses incorrect interleaving if a previous draw did not write gl_Position</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89180">Bug 89180</a> - [IVB regression] Rendering issues in Mass Effect through VMware Workstation</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Abdiel Janulgue (2):</p>
-<ul>
-  <li>glsl: Don't optimize min/max into saturate when EmitNoSat is set</li>
-  <li>st/mesa: For vertex shaders, don't emit saturate when SM 3.0 is unsupported</li>
-</ul>
-
-<p>Andreas Boll (1):</p>
-<ul>
-  <li>glx: Fix returned values of GLX_RENDERER_PREFERRED_PROFILE_MESA</li>
-</ul>
-
-<p>Brian Paul (2):</p>
-<ul>
-  <li>swrast: fix multiple color buffer writing</li>
-  <li>st/mesa: fix sampler view reference counting bug in glDraw/CopyPixels</li>
-</ul>
-
-<p>Chris Forbes (1):</p>
-<ul>
-  <li>i965/gs: Check newly-generated GS-out VUE map against correct stage</li>
-</ul>
-
-<p>Eduardo Lima Mitev (1):</p>
-<ul>
-  <li>mesa: Fix error validating args for TexSubImage3D</li>
-</ul>
-
-<p>Emil Velikov (6):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.4.5 release</li>
-  <li>install-lib-links: remove the .install-lib-links file</li>
-  <li>Revert "mesa: Correct backwards NULL check."</li>
-  <li>mesa: cherry-pick the second half of commit 2aa71e9485a</li>
-  <li>Revert "gallivm: Update for RTDyldMemoryManager becoming an unique_ptr."</li>
-  <li>Update version to 10.4.6</li>
-</ul>
-
-<p>Ian Romanick (3):</p>
-<ul>
-  <li>mesa: Add missing error checks in _mesa_ProgramBinary</li>
-  <li>mesa: Ensure that length is set to zero in _mesa_GetProgramBinary</li>
-  <li>mesa: Always generate GL_INVALID_OPERATION in _mesa_GetProgramBinary</li>
-</ul>
-
-<p>Jonathan Gray (1):</p>
-<ul>
-  <li>auxilary/os: correct sysctl use in os_get_total_physical_memory()</li>
-</ul>
-
-<p>José Fonseca (1):</p>
-<ul>
-  <li>gallivm: Update for RTDyldMemoryManager becoming an unique_ptr.</li>
-</ul>
-
-<p>Leo Liu (1):</p>
-<ul>
-  <li>st/omx/dec/h264: fix picture out-of-order with poc type 0 v2</li>
-</ul>
-
-<p>Lucas Stach (1):</p>
-<ul>
-  <li>install-lib-links: don't depend on .libs directory</li>
-</ul>
-
-<p>Marek Olšák (2):</p>
-<ul>
-  <li>vbo: fix an unitialized-variable warning</li>
-  <li>radeonsi: fix point sprites</li>
-</ul>
-
-<p>Matt Turner (4):</p>
-<ul>
-  <li>glsl: Rewrite and fix min/max to saturate optimization.</li>
-  <li>mesa: Correct backwards NULL check.</li>
-  <li>i965/fs: Don't use backend_visitor::instructions after creating the CFG.</li>
-  <li>mesa: Correct backwards NULL check.</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.4.7.html

@@ -1,134 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.4.7 Release Notes / March 20, 2015</h1>
-
-<p>
-Mesa 10.4.7 is a bug fix release which fixes bugs found since the 10.4.6 release.
-</p>
-<p>
-Mesa 10.4.7 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-9e7b59267199658808f8b33e0410b86fbafbdcd52378658b9df65fac9d24947f  MesaLib-10.4.7.tar.gz
-2c351c98671f9a7ab3fd9c601bb7a255801b1580f5dd0992639f99152801b0d2  MesaLib-10.4.7.tar.bz2
-d14ac578b5ce16560757b53fbd1cb4d6b34652f8e110e4b10a019adc82e67ffd  MesaLib-10.4.7.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79202">Bug 79202</a> - valgrind errors in glsl-fs-uniform-array-loop-unroll.shader_test; random code generation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89156">Bug 89156</a> - r300g: GL_COMPRESSED_RED_RGTC1 / ATI1N support broken</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89224">Bug 89224</a> - Incorrect rendering of Unigine Valley running in VM on VMware Workstation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89530">Bug 89530</a> - FTBFS in loader: missing fstat</li>
-
-</ul>
-
-<h2>Changes</h2>
-
-<p>Andrey Sudnik (1):</p>
-<ul>
-  <li>i965/vec4: Don't lose the saturate modifier in copy propagation.</li>
-</ul>
-
-<p>Daniel Stone (1):</p>
-<ul>
-  <li>egl: Take alpha bits into account when selecting GBM formats</li>
-</ul>
-
-<p>Emil Velikov (6):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.4.6 release</li>
-  <li>cherry-ignore: add not applicable/rejected commits</li>
-  <li>mesa: rename format_info.c to format_info.h</li>
-  <li>loader: include &lt;sys/stat.h&gt; for non-sysfs builds</li>
-  <li>auxiliary/os: fix the android build - s/drm_munmap/os_munmap/</li>
-  <li>Update version to 10.4.7</li>
-</ul>
-
-<p>Iago Toral Quiroga (1):</p>
-<ul>
-  <li>i965: Fix out-of-bounds accesses into pull_constant_loc array</li>
-</ul>
-
-<p>Ilia Mirkin (4):</p>
-<ul>
-  <li>freedreno: move fb state copy after checking for size change</li>
-  <li>freedreno/ir3: fix array count returned by TXQ</li>
-  <li>freedreno/ir3: get the # of miplevels from getinfo</li>
-  <li>freedreno: fix slice pitch calculations</li>
-</ul>
-
-<p>Marc-Andre Lureau (1):</p>
-<ul>
-  <li>gallium/auxiliary/indices: fix start param</li>
-</ul>
-
-<p>Marek Olšák (4):</p>
-<ul>
-  <li>r300g: fix RGTC1 and LATC1 SNORM formats</li>
-  <li>r300g: fix a crash when resolving into an sRGB texture</li>
-  <li>r300g: fix sRGB-&gt;sRGB blits</li>
-  <li>radeonsi: increase coords array size for radeon_llvm_emit_prepare_cube_coords</li>
-</ul>
-
-<p>Mario Kleiner (1):</p>
-<ul>
-  <li>glx: Handle out-of-sequence swap completion events correctly. (v2)</li>
-</ul>
-
-<p>Matt Turner (2):</p>
-<ul>
-  <li>r300g: Use PATH_MAX instead of limiting ourselves to 100 chars.</li>
-  <li>r300g: Check return value of snprintf().</li>
-</ul>
-
-<p>Rob Clark (2):</p>
-<ul>
-  <li>freedreno/ir3: fix silly typo for binning pass shaders</li>
-  <li>freedreno: update generated headers</li>
-</ul>
-
-<p>Samuel Iglesias Gonsalvez (1):</p>
-<ul>
-  <li>glsl: optimize (0 cmp x + y) into (-x cmp y).</li>
-</ul>
-
-<p>Stefan Dösinger (1):</p>
-<ul>
-  <li>r300g: Fix the ATI1N swizzle (RGTC1 and LATC1)</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.5.6.html

@@ -31,8 +31,7 @@ because compatibility contexts are not supported.
 
 <h2>SHA256 checksums</h2>
 <pre>
-89ff9cb08d0f6e3f34154864c3071253057cd21020759457c8ae27e0f70985d3  mesa-10.5.6.tar.gz
-66017853bde5f7a6647db3eede30512a091a3491daa1708e0ad8027c328ba595  mesa-10.5.6.tar.xz
+TBD
 </pre>
 
 

docs/relnotes/10.5.7.html

@@ -1,103 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.5.7 Release Notes / June 07, 2015</h1>
-
-<p>
-Mesa 10.5.7 is a bug fix release which fixes bugs found since the 10.5.6 release.
-</p>
-<p>
-Mesa 10.5.7 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-8f865ce497435fdf25d4e35f3b5551b2bcd5f9bc6570561183be82af20d18b82  mesa-10.5.7.tar.gz
-04d06890cd69af8089d6ca76f40e46dcf9cacfe4a9788b32be620574d4638818  mesa-10.5.7.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89131">Bug 89131</a> - [Bisected] Graphical corruption in Weston,  shows old framebuffer pieces</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Ben Widawsky (1):</p>
-<ul>
-  <li>i965: Emit 3DSTATE_MULTISAMPLE before WM_HZ_OP (gen8+)</li>
-</ul>
-
-<p>Emil Velikov (4):</p>
-<ul>
-  <li>docs: Add sha256sums for the 10.5.6 release</li>
-  <li>get-pick-list.sh: Require explicit "10.5" for nominating stable patches</li>
-  <li>cherry-ignore: add clover build fix not applicable for 10.5</li>
-  <li>Update version to 10.5.7</li>
-</ul>
-
-<p>Ilia Mirkin (18):</p>
-<ul>
-  <li>nvc0/ir: set ftz when sources are floats, not just destinations</li>
-  <li>nv50/ir: guess that the constant offset is the starting slot of array</li>
-  <li>nvc0/ir: LOAD's can't be used for shader inputs</li>
-  <li>nvc0: a geometry shader can have up to 1024 vertices output</li>
-  <li>nv50/ir: avoid messing up arg1 of PFETCH</li>
-  <li>nv30: don't leak fragprog consts</li>
-  <li>nv30: avoid leaking render state and draw shaders</li>
-  <li>nv30: fix clip plane uploads and enable changes</li>
-  <li>nv30/draw: avoid leaving stale pointers in draw state</li>
-  <li>nv30/draw: draw expects constbuf size in bytes, not vec4 units</li>
-  <li>st/mesa: don't leak glsl_to_tgsi object on link failure</li>
-  <li>glsl: avoid leaking linked gl_shader when there's a late linker error</li>
-  <li>nv30/draw: fix indexed draws with swtnl path and a resource index buffer</li>
-  <li>nv30/draw: only use the DMA1 object (GART) if the bo is not in VRAM</li>
-  <li>nv30/draw: allocate vertex buffers in gart</li>
-  <li>nv30/draw: switch varying hookup logic to know about texcoords</li>
-  <li>nv30: falling back to draw path for edgeflag does no good</li>
-  <li>nv30: avoid doing extra work on clear and hitting unexpected states</li>
-</ul>
-
-<p>Jason Ekstrand (1):</p>
-<ul>
-  <li>i965/fs: Fix implied_mrf_writes for scratch writes</li>
-</ul>
-
-<p>Marek Olšák (1):</p>
-<ul>
-  <li>st/dri: fix postprocessing crash when there's no depth buffer</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.5.8.html

@@ -1,112 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.5.8 Release Notes / June 20, 2015</h1>
-
-<p>
-Mesa 10.5.8 is a bug fix release which fixes bugs found since the 10.5.7 release.
-</p>
-<p>
-Mesa 10.5.8 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-611ddcfa3c1bf13f7e6ccac785c8749c3b74c9a78452bac70f8372cf6b209aa0  mesa-10.5.8.tar.gz
-2866b855c5299a4aed066338c77ff6467c389b2c30ada7647be8758663da2b54  mesa-10.5.8.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90310">Bug 90310</a> - Fails to build gallium_dri.so at linking stage with clang because of multiple redefinitions</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90347">Bug 90347</a> - [NVE0+] Failure to insert texbar under some circumstances (causing bad colors in Terasology)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90520">Bug 90520</a> - Register spilling clobbers registers used elsewhere in the shader</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90905">Bug 90905</a> - mesa: Finish subdir-objects transition</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Ben Widawsky (1):</p>
-<ul>
-  <li>i965: Disable compaction for EOT send messages</li>
-</ul>
-
-<p>Boyan Ding (1):</p>
-<ul>
-  <li>egl/x11: Set version of swrastLoader to 2</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: Add sha256sums for the 10.5.7 release</li>
-  <li>Update version to 10.5.8</li>
-</ul>
-
-<p>Erik Faye-Lund (1):</p>
-<ul>
-  <li>mesa: build xmlconfig to a separate static library</li>
-</ul>
-
-<p>Francisco Jerez (1):</p>
-<ul>
-  <li>i965: Don't compact instructions with unmapped bits.</li>
-</ul>
-
-<p>Ilia Mirkin (3):</p>
-<ul>
-  <li>nvc0/ir: fix collection of first uses for texture barrier insertion</li>
-  <li>nv50,nvc0: clamp uniform size to 64k</li>
-  <li>nvc0/ir: can't have a join on a load with an indirect source</li>
-</ul>
-
-<p>Jason Ekstrand (1):</p>
-<ul>
-  <li>i965/fs: Don't let the EOT send message interfere with the MRF hack</li>
-</ul>
-
-<p>Marek Olšák (1):</p>
-<ul>
-  <li>egl: fix setting context flags</li>
-</ul>
-
-<p>Roland Scheidegger (1):</p>
-<ul>
-  <li>draw: (trivial) fix NULL pointer dereference</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.5.9.html

@@ -1,140 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.5.9 Release Notes / July 04, 2015</h1>
-
-<p>
-Mesa 10.5.9 is a bug fix release which fixes bugs found since the 10.5.8 release.
-</p>
-<p>
-Mesa 10.5.9 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-0c081b59572ee9732e7438d34adc3817fe8cc8d4b58abc0e71fd4b4c904945cb  mesa-10.5.9.tar.gz
-71c69f31d3dbc35cfa79950e58a01d27030378d8c7ef1259a0b31d4d0487f4ec  mesa-10.5.9.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84225">Bug 84225</a> - Allow constant-index-expression sampler array indexing with GLSL-ES &lt; 300</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88999">Bug 88999</a> - [SKL] Compiz crashes after opening unity dash</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89118">Bug 89118</a> - [SKL Bisected]many Ogles3conform cases core dumped</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90537">Bug 90537</a> - radeonsi bo/va conflict on RADEON_GEM_VA (rscreen-&gt;ws-&gt;buffer_from_handle returns NULL)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90839">Bug 90839</a> - [10.5.5/10.6 regression, bisected] PBO glDrawPixels no longer using blit fastpath</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90873">Bug 90873</a> - Kernel hang, TearFree On, Mate desktop environment</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91056">Bug 91056</a> - The Bard's Tale (2005, native)  has rendering issues</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91117">Bug 91117</a> - Nimbus (running in wine) has rendering issues, objects are semi-transparent</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91124">Bug 91124</a> - Civilization V (in Wine) has rendering issues: text missing, menu bar corrupted</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Ben Widawsky (2):</p>
-<ul>
-  <li>i965/gen9: Implement Push Constant Buffer workaround</li>
-  <li>i965/skl: Use 1 register for uniform pull constant payload</li>
-</ul>
-
-<p>Boyan Ding (1):</p>
-<ul>
-  <li>egl/x11: Remove duplicate call to dri2_x11_add_configs_for_visuals</li>
-</ul>
-
-<p>Chris Wilson (3):</p>
-<ul>
-  <li>i965: Fix HW blitter pitch limits</li>
-  <li>i915: Blit RGBX&lt;-&gt;RGBA drawpixels</li>
-  <li>i965: Export format comparison for blitting between miptrees</li>
-</ul>
-
-<p>Emil Velikov (6):</p>
-<ul>
-  <li>docs: Add sha256sums for the 10.5.8 release</li>
-  <li>configure: warn about shared_glapi &amp; xlib-glx only when both are set</li>
-  <li>configure: error out when building backend-less libEGL</li>
-  <li>configure: error out when building libEGL without shared-glapi</li>
-  <li>gbm: do not (over)link against libglapi.so</li>
-  <li>Update version to 10.5.9</li>
-</ul>
-
-<p>Frank Henigman (1):</p>
-<ul>
-  <li>gbm: dlopen libglapi so gbm_create_device works</li>
-</ul>
-
-<p>Ilia Mirkin (8):</p>
-<ul>
-  <li>glsl: add version checks to conditionals for builtin variable enablement</li>
-  <li>mesa: add GL_PROGRAM_PIPELINE support in KHR_debug calls</li>
-  <li>glsl: binding point is a texture unit, which is a combined space</li>
-  <li>nvc0: always put all tfb bufs into bufctx</li>
-  <li>nv50,nvc0: make sure to pushbuf_refn before putting bo into pushbuf_data</li>
-  <li>nv50/ir: propagate modifier to right arg when const-folding mad</li>
-  <li>nv50/ir: fix emission of address reg in 3rd source</li>
-  <li>nv50/ir: copy joinAt when splitting both before and after</li>
-</ul>
-
-<p>Mario Kleiner (2):</p>
-<ul>
-  <li>nouveau: Use dup fd as key in drm-winsys hash table to fix ZaphodHeads.</li>
-  <li>winsys/radeon: Use dup fd as key in drm-winsys hash table to fix ZaphodHeads.</li>
-</ul>
-
-<p>Michel Dänzer (1):</p>
-<ul>
-  <li>winsys/radeon: Unmap GPU VM address range when destroying BO</li>
-</ul>
-
-<p>Tapani Pälli (6):</p>
-<ul>
-  <li>glsl: Allow dynamic sampler array indexing with GLSL ES &lt; 3.00</li>
-  <li>mesa/glsl: new compiler option EmitNoIndirectSampler</li>
-  <li>i915: use EmitNoIndirectSampler</li>
-  <li>mesa/st: use EmitNoIndirectSampler if !ARB_gpu_shader5</li>
-  <li>i965: use EmitNoIndirectSampler for gen &lt; 7</li>
-  <li>glsl: validate sampler array indexing for 'constant-index-expression'</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.0.html

@@ -1,331 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.0 Release Notes / June 14, 2015</h1>
-
-<p>
-Mesa 10.6.0 is a new development release.
-People who are concerned with stability and reliability should stick
-with a previous release or wait for Mesa 10.6.1.
-</p>
-<p>
-Mesa 10.6.0 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-9bc659abdba26202509304f259723aaa4343dba6aac4bd87d5baea11d23c8c63  mesa-10.6.0.tar.gz
-f37e2633978deed02ff0522abc36c709586e2b555fd439a82ab71dce2c866c76  mesa-10.6.0.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-
-<p>
-Note: some of the new features are only available with certain drivers.
-</p>
-
-<ul>
-<li>GL_AMD_pinned_memory on r600, radeonsi</li>
-<li>GL_ARB_clip_control on i965</li>
-<li>GL_ARB_depth_buffer_float on freedreno</li>
-<li>GL_ARB_depth_clamp on freedreno</li>
-<li>GL_ARB_direct_state_access on all drivers that support GL 2.0+</li>
-<li>GL_ARB_draw_indirect, GL_ARB_multi_draw_indirect on r600</li>
-<li>GL_ARB_draw_instanced on freedreno</li>
-<li>GL_ARB_gpu_shader_fp64 on nvc0, softpipe</li>
-<li>GL_ARB_gpu_shader5 on i965/gen8+</li>
-<li>GL_ARB_instanced_arrays on freedreno</li>
-<li>GL_ARB_pipeline_statistics_query on i965, nv50, nvc0, r600, radeonsi, softpipe</li>
-<li>GL_ARB_program_interface_query (all drivers)</li>
-<li>GL_ARB_texture_stencil8 on nv50, nvc0, r600, radeonsi, softpipe</li>
-<li>GL_ARB_texture_view on llvmpipe, softpipe</li>
-<li>GL_ARB_uniform_buffer_object on freedreno</li>
-<li>GL_ARB_vertex_attrib_64bit on nvc0, softpipe</li>
-<li>GL_ARB_viewport_array, GL_AMD_vertex_shader_viewport_index on i965/gen6</li>
-<li>GL_EXT_draw_buffers2 on freedreno</li>
-<li>GL_OES_EGL_sync on all drivers</li>
-<li>EGL_KHR_fence_sync on i965, freedreno, nv50, nvc0, r600, radeonsi</li>
-<li>EGL_KHR_wait_sync on i965, freedreno, nv50, nvc0, r600, radeonsi</li>
-<li>EGL_KHR_cl_event2 on freedreno, nv50, nvc0, r600, radeonsi</li>
-<li>GL_AMD_performance_monitor on nvc0</li>
-</ul>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=15006">Bug 15006</a> - translate &amp; rotate the line cause Aliasing</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=27007">Bug 27007</a> - Lines disappear with GL_LINE_SMOOTH</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28832">Bug 28832</a> - piglit/general/line-aa-width fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=45348">Bug 45348</a> - [swrast] piglit fbo-drawbuffers-arbfp regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=60797">Bug 60797</a> - 1px lines in octave plot aliased to 0</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=67564">Bug 67564</a> - HiZ buffers are much larger than necessary</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=69226">Bug 69226</a> - Cannot enable basic shaders with Second Life aborts attempt</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=71591">Bug 71591</a> - Second Life shaders fail to compile (extension declared in middle of shader)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79202">Bug 79202</a> - valgrind errors in glsl-fs-uniform-array-loop-unroll.shader_test; random code generation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81025">Bug 81025</a> - [IVB/BYT Bisected]Piglit spec_ARB_draw_indirect_arb_draw_indirect-draw-elements-prim-restart-ugly fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82477">Bug 82477</a> - [softpipe] piglit fp-long-alu regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82668">Bug 82668</a> - Can't set int attributes to certain values on 32-bit</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82831">Bug 82831</a> - i965: Support GL_ARB_blend_func_extended in SIMD16</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83962">Bug 83962</a> - [HSW/BYT]Piglit spec_ARB_gpu_shader5_arb_gpu_shader5-emitstreamvertex_nodraw fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84613">Bug 84613</a> - [G965, bisected] piglit regressions : glslparsertest.glsl2</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86747">Bug 86747</a> - Noise in Football Manager 2014 textures</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86792">Bug 86792</a> - [NVC0] Portal 2 Crashes in Wine</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86811">Bug 86811</a> - [BDW/BSW Bisected]Piglit spec_arb_shading_language_packing_execution_built-in-functions_vs-unpackSnorm4x8 fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86837">Bug 86837</a> - kodi segfault since auxiliary/vl: rework the build of the VL code</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86944">Bug 86944</a> - glsl_parser_extras.cpp&quot;, line 1455: Error: Badly formed expression. (Oracle Studio)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86974">Bug 86974</a> - INTEL_DEBUG=shader_time always asserts in fs_generator::generate_code() when Mesa is built with --enable-debug (= with asserts)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86980">Bug 86980</a> - [swrast] piglit fp-rfl regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87258">Bug 87258</a> - [BDW/BSW Bisected]Piglit spec_ARB_shader_atomic_counters_array-indexing fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88246">Bug 88246</a> - Commit 2881b12 causes 43 DrawElements test regressions</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88248">Bug 88248</a> - Calling glClear while there is an occlusion query in progress messes up the results</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88521">Bug 88521</a> - GLBenchmark 2.7 TRex renders with artifacts on Gen8 with !UXA</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88534">Bug 88534</a> - include/c11/threads_posix.h PTHREAD_MUTEX_RECURSIVE_NP not defined</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88561">Bug 88561</a> - [radeonsi][regression,bisected] Depth test/buffer issues in Portal</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88793">Bug 88793</a> - [BDW/BSW Bisected]Piglit/shaders_glsl-max-varyings fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88815">Bug 88815</a> - Incorrect handling of GLSL #line directive</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88883">Bug 88883</a> - ir-a2xx.c: variable changed in assert statement</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88885">Bug 88885</a> - Transform feedback uses incorrect interleaving if a previous draw did not write gl_Position</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88905">Bug 88905</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.gtf.GL3Tests.packed_pixels.packed_pixels fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88999">Bug 88999</a> - [SKL] Compiz crashes after opening unity dash</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89014">Bug 89014</a> - PIPE_QUERY_GPU_FINISHED is not acting as expected on SI</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89026">Bug 89026</a> - Renderbuffer layered state used for framebuffer completeness test</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89032">Bug 89032</a> - [BDW/BSW/SKL Bisected]Piglit spec_OpenGL_1.1_infinite-spot-light fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89037">Bug 89037</a> - [SKL]Piglit spec_EXT_texture_array_copyteximage_1D_ARRAY_samples=2 sporadically causes GPU hang</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89039">Bug 89039</a> - [SKL]etqw system hang</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89058">Bug 89058</a> - [SKL]Render error in some games (etqw-demo, nexuiz, portal)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89068">Bug 89068</a> - glTexImage2D regression by texstore_rgba switch to _mesa_format_convert</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89069">Bug 89069</a> - Lack of grass in The Talos Principle on radeonsi (native\wine\nine)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89094">Bug 89094</a> - [SNB/IVB/HSW/BYT Bisected]Ogles3conform ES3-CTS.gtf.GL3Tests.shadow.shadow_execution_vert fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89095">Bug 89095</a> - [SNB/IVB/BYT Bisected]Webglc conformance/glsl/functions/glsl-function-mix-float.html fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89112">Bug 89112</a> - u_atomic_test: u_atomic_test.c:124: test_atomic_8bits_bool: Assertion `r == 65 &amp;&amp; &quot;p_atomic_add&quot;' failed.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89118">Bug 89118</a> - [SKL Bisected]many Ogles3conform cases core dumped</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89131">Bug 89131</a> - [Bisected] Graphical corruption in Weston,  shows old framebuffer pieces</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89156">Bug 89156</a> - r300g: GL_COMPRESSED_RED_RGTC1 / ATI1N support broken</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89180">Bug 89180</a> - [IVB regression] Rendering issues in Mass Effect through VMware Workstation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89210">Bug 89210</a> - GS statistics fail on SNB</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89218">Bug 89218</a> - lower_instructions.cpp:648:48: error: invalid suffix 'd' on floating constant</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89224">Bug 89224</a> - Incorrect rendering of Unigine Valley running in VM on VMware Workstation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89260">Bug 89260</a> - macros.h:34:25: fatal error: util/u_math.h: No such file or directory</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89292">Bug 89292</a> - [regression,bisected] incomplete screenshots in some cases</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89311">Bug 89311</a> - [regression, bisected] dEQP: Added entry points for glCompressedTextureSubImage*D.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89312">Bug 89312</a> - [regression, bisected] main: Added entry points for CopyTextureSubImage*D. (d6b7c40cecfe01)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89315">Bug 89315</a> - [HSW, regression, bisected] i965/fs: Emit MAD instructions when possible.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89317">Bug 89317</a> - [HSW, regression, bisected] i965: Add LINTERP/CINTERP to can_do_cmod() (d91390634)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89328">Bug 89328</a> - python required to build Mesa release tarballs</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89342">Bug 89342</a> - main/light.c:159:62: error: 'M_PI' undeclared (first use in this function)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89343">Bug 89343</a> - compiler/tests/radeon_compiler_optimize_tests.c:43:3: error: implicit declaration of function ‘fprintf’ [-Werror=implicit-function-declaration]</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89345">Bug 89345</a> - imports.h:452:58: error: expected declaration specifiers or '...' before 'va_list'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89364">Bug 89364</a> - c99_alloca.h:40:22: fatal error: alloca.h: No such file or directory</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89372">Bug 89372</a> - [softpipe] piglit glsl-1.50 generate-zero-primitives regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89387">Bug 89387</a> - Double delete in lp_bld_misc.cpp</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89416">Bug 89416</a> - UE4Editor crash after load project</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89430">Bug 89430</a> - [g965][bisected] arb_copy_image-targets gl_texture* tests fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89433">Bug 89433</a> - GCC 4.2 does not support -Wvla</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89455">Bug 89455</a> - [NVC0/Gallium] Unigine Heaven black and white boxes</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89457">Bug 89457</a> - [BSW Bisected]ogles3conform ES3-CTS.gtf.GL3Tests.shadow.shadow_execution_vert fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89477">Bug 89477</a> - include/no_extern_c.h:47:1: error: template with C linkage</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89508">Bug 89508</a> - Bad int(floatBitsToInt(vec4))</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89530">Bug 89530</a> - FTBFS in loader: missing fstat</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89569">Bug 89569</a> - Papo &amp; Yo crash on startup [HSW]</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89590">Bug 89590</a> - Crash in glLinkProgram with shaders with multiple constant arrays</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89662">Bug 89662</a> - context.c:943: undefined reference to `_glapi_new_nop_table'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89670">Bug 89670</a> - cmod_propagation_test.andnz_one regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89679">Bug 89679</a> - [NV50] Portal/Half-Life 2 will not start (native Steam)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89689">Bug 89689</a> - [Regression] Weston on DRM backend won't start with new version of mesa</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89722">Bug 89722</a> - [ILK Bisected]Ogles2conform/ES2-CTS.gtf.GL.equal.equal_vec2_frag fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89726">Bug 89726</a> - [Bisected] dEQP-GLES3: uniform linking logic in the presence of structs</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89746">Bug 89746</a> - Mesa and LLVM 3.6+ break opengl for genymotion</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89754">Bug 89754</a> - vertexAttrib fails WebGL Conformance test with mesa drivers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89758">Bug 89758</a> - pow WebGL Conformance test with mesa drivers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89759">Bug 89759</a> - WebGL OGL ES GLSL conformance test with mesa drivers fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89831">Bug 89831</a> - [r600] r600_asm.c:310:assign_alu_units: Assertion `0' failed.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89899">Bug 89899</a> - nir/nir_lower_tex_projector.c:112: error: unknown field ‘ssa’ specified in initializer</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89957">Bug 89957</a> - vm protection faults in piglit lest: texsubimage cube_map_array pbo</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89960">Bug 89960</a> - [softpipe] piglit copy-pixels regreession</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89961">Bug 89961</a> - [BDW/BSW Bisected]Synmark2_v6 OglDrvRes/OglDrvShComp/OglDrvState/OglPSPom Image Validation fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89963">Bug 89963</a> - lp_bld_debug.cpp:100:31: error: no matching function for call to ‘llvm::raw_ostream::raw_ostream()’</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90000">Bug 90000</a> - [i965 Bisected NIR] Piglit/gglean_fragprog1-z-write_test fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90109">Bug 90109</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.shaders.uniform_block.random.basic_arrays.3 fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90114">Bug 90114</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.shaders.struct.uniform.sampler_array_fragment fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90130">Bug 90130</a> - gl_PrimitiveId seems to reset at 340</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90147">Bug 90147</a> - swrast: build error undeclared _SC_PHYS_PAGES on osx</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90149">Bug 90149</a> - [SNB+ Bisected]ES3-CTS.gtf.GL3Tests.uniform_buffer_object.uniform_buffer_object_getactiveuniformsiv_for_nonexistent_uniform_indices fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90153">Bug 90153</a> - [SKL Bisected]ES3-CTS.gtf.GL3Tests.uniform_buffer_object.uniform_buffer_object_all_valid_basic_types fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90167">Bug 90167</a> - [softpipe] piglit depthstencil-default_fb-drawpixels-32f_24_8_rev regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90207">Bug 90207</a> - [r600g, bisected] regression: NI/Turks crash on WebGL Water (most WebGL stuff)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90213">Bug 90213</a> - glDrawPixels with GL_COLOR_INDEX never returns.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90243">Bug 90243</a> - [bisected] regression: spec.!opengl 3_2.get-active-attrib-returns-all-inputs</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90258">Bug 90258</a> - [IVB] spec.glsl-1_10.execution.fs-dfdy-accuracy fails intermittently</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90310">Bug 90310</a> - Fails to build gallium_dri.so at linking stage with clang because of multiple redefinitions</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90350">Bug 90350</a> - [G96] Portal's portal are incorrectly rendered</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90363">Bug 90363</a> - [nv50] HW state is not reset correctly when using a new GL context</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90397">Bug 90397</a> - ARB_program_interface_query: glGetProgramResourceiv() returns wrong value for GL_REFERENCED_BY_*_SHADER prop for GL_UNIFORM for members of an interface block with an instance name</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90466">Bug 90466</a> - arm: linker error ndefined reference to `nir_metadata_preserve'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90520">Bug 90520</a> - Register spilling clobbers registers used elsewhere in the shader</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90547">Bug 90547</a> - [BDW/BSW/SKL Bisected]Piglit/glean&#64;vertprog1-rsq_test_2_(reciprocal_square_root_of_negative_value) fais</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90580">Bug 90580</a> - [HSW bisected] integer multiplication bug</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90629">Bug 90629</a> - [i965] SIMD16 dual_source_blend assertion `src[i].file != GRF || src[i].width == dst.width' failed</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90749">Bug 90749</a> - [BDW Bisected]dEQP-GLES3.functional.rasterization.fbo.rbo_multisample_max.primitives.lines_wide fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90830">Bug 90830</a> - [bsw bisected regression] GPU hang for spec.arb_gpu_shader5.execution.sampler_array_indexing.vs-nonzero-base</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90839">Bug 90839</a> - [10.5.5/10.6 regression, bisected] PBO glDrawPixels no longer using blit fastpath</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90905">Bug 90905</a> - mesa: Finish subdir-objects transition</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=9951">Bug 9951</a> - GL_LINE_SMOOTH and GL_POLYGON_SMOOTH with i965 driver</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<ul>
-<li>Removed classic Windows software rasterizer.</li>
-<li>Removed egl_gallium EGL driver.</li>
-<li>Removed gbm_gallium GBM driver.</li>
-<li>Removed OpenVG support.</li>
-<li>Removed the galahad gallium driver.</li>
-<li>Removed the identity gallium driver.</li>
-<li>Removed the EGL loader from the Windows SCons build.</li>
-<li>Removed the classic osmesa from the Windows SCons build.</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.1.html

@@ -1,104 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.1 Release Notes / June 29, 2015</h1>
-
-<p>
-Mesa 10.6.1 is a bug fix release which fixes bugs found since the 10.6.0 release.
-</p>
-<p>
-Mesa 10.6.1 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-b4cccd4d0eabcc2bca00c3175d3ad88fdda57ffdb883a7998525b873a21fe607  mesa-10.6.1.tar.gz
-6c80a2b647e57c85dc36e609d9aed17f878f0d8e0cf9ace86d14cf604101e1eb  mesa-10.6.1.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90347">Bug 90347</a> - [NVE0+] Failure to insert texbar under some circumstances (causing bad colors in Terasology)</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Anuj Phogat (4):</p>
-<ul>
-  <li>mesa: Handle integer formats in need_rgb_to_luminance_conversion()</li>
-  <li>mesa: Use helper function need_rgb_to_luminance_conversion()</li>
-  <li>mesa: Turn need_rgb_to_luminance_conversion() in to a global function</li>
-  <li>meta: Abort meta path if ReadPixels need rgb to luminance conversion</li>
-</ul>
-
-<p>Ben Widawsky (1):</p>
-<ul>
-  <li>i965/gen9: Implement Push Constant Buffer workaround</li>
-</ul>
-
-<p>Boyan Ding (2):</p>
-<ul>
-  <li>egl/x11: Set version of swrastLoader to 2</li>
-  <li>egl/x11: Remove duplicate call to dri2_x11_add_configs_for_visuals</li>
-</ul>
-
-<p>Emil Velikov (6):</p>
-<ul>
-  <li>docs: Add sha256sums for the 10.6.0 release</li>
-  <li>configure: warn about shared_glapi &amp; xlib-glx only when both are set</li>
-  <li>configure: error out when building backend-less libEGL</li>
-  <li>configure: error out when building libEGL without shared-glapi</li>
-  <li>gbm: do not (over)link against libglapi.so</li>
-  <li>Update version to 10.6.1</li>
-</ul>
-
-<p>Frank Henigman (1):</p>
-<ul>
-  <li>gbm: dlopen libglapi so gbm_create_device works</li>
-</ul>
-
-<p>Ilia Mirkin (9):</p>
-<ul>
-  <li>nvc0/ir: fix collection of first uses for texture barrier insertion</li>
-  <li>nv50,nvc0: clamp uniform size to 64k</li>
-  <li>nvc0/ir: can't have a join on a load with an indirect source</li>
-  <li>glsl: handle conversions to double when comparing param matches</li>
-  <li>glsl: add version checks to conditionals for builtin variable enablement</li>
-  <li>mesa: add GL_PROGRAM_PIPELINE support in KHR_debug calls</li>
-  <li>glsl: binding point is a texture unit, which is a combined space</li>
-  <li>nvc0: always put all tfb bufs into bufctx</li>
-  <li>nv50,nvc0: make sure to pushbuf_refn before putting bo into pushbuf_data</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.2.html

@@ -1,165 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.2 Release Notes / July 11, 2015</h1>
-
-<p>
-Mesa 10.6.2 is a bug fix release which fixes bugs found since the 10.6.1 release.
-</p>
-<p>
-Mesa 10.6.2 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-9c7ab9300dda6c912faaaff97995ec1820ba21d114d9cf555f145cbad90995f4  mesa-10.6.2.tar.gz
-05753d3db4212900927b9894221a1669a10f56786e86a7e818b6e18a0817dca9  mesa-10.6.2.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=73528">Bug 73528</a> - Deferred lighting in Second Life causes system hiccups and screen flickering</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80500">Bug 80500</a> - Flickering shadows in unreleased title trace</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82186">Bug 82186</a> - [r600g] BARTS GPU lockup with minecraft shaders</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84225">Bug 84225</a> - Allow constant-index-expression sampler array indexing with GLSL-ES &lt; 300</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90537">Bug 90537</a> - radeonsi bo/va conflict on RADEON_GEM_VA (rscreen-&gt;ws-&gt;buffer_from_handle returns NULL)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90873">Bug 90873</a> - Kernel hang, TearFree On, Mate desktop environment</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91022">Bug 91022</a> - [g45 g965 bisected] assertions generated from textureGrad cube samplers fix</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91047">Bug 91047</a> - [SNB Bisected] Messed up Fog in Super Smash Bros. Melee in Dolphin</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91056">Bug 91056</a> - The Bard's Tale (2005, native)  has rendering issues</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91117">Bug 91117</a> - Nimbus (running in wine) has rendering issues, objects are semi-transparent</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91124">Bug 91124</a> - Civilization V (in Wine) has rendering issues: text missing, menu bar corrupted</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91173">Bug 91173</a> - Oddworld: Stranger's Wrath HD: disfigured models in wrong colors</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91226">Bug 91226</a> - Crash in glLinkProgram (NEW)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91231">Bug 91231</a> - [NV92] Psychonauts (native) segfaults on start when DRI3 enabled</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Chris Wilson (1):</p>
-<ul>
-  <li>loader: Look for any version of currently linked libudev.so</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: Add sha256 checksums for the 10.6.1 release</li>
-  <li>Update version to 10.6.2</li>
-</ul>
-
-<p>Ilia Mirkin (8):</p>
-<ul>
-  <li>nv50/ir: propagate modifier to right arg when const-folding mad</li>
-  <li>nv50/ir: fix emission of address reg in 3rd source</li>
-  <li>nv50/ir: copy joinAt when splitting both before and after</li>
-  <li>mesa: reset the source packing when creating temp transfer image</li>
-  <li>nv50/ir: don't emit src2 in immediate form</li>
-  <li>mesa/prog: relative offsets into constbufs are not constant</li>
-  <li>nv50/ir: UCMP arguments are float, so make sure modifiers are applied</li>
-  <li>nvc0: turn sample counts off during blit</li>
-</ul>
-
-<p>Kenneth Graunke (5):</p>
-<ul>
-  <li>i965/fs: Fix ir_txs in emit_texture_gen4_simd16().</li>
-  <li>i965: Reserve more batch space to accomodate Gen6 perfmonitors.</li>
-  <li>i965/vs: Fix matNxM vertex attributes where M != 4.</li>
-  <li>Revert "glsl: clone inputs and outputs during linking"</li>
-  <li>Revert "i965: Delete linked GLSL IR when using NIR."</li>
-</ul>
-
-<p>Marek Olšák (3):</p>
-<ul>
-  <li>r600g: disable single-sample fast color clear due to hangs</li>
-  <li>radeonsi: fix a hang with DrawTransformFeedback on 4 SE chips</li>
-  <li>st/dri: don't set PIPE_BIND_SCANOUT for MSAA surfaces</li>
-</ul>
-
-<p>Mario Kleiner (2):</p>
-<ul>
-  <li>nouveau: Use dup fd as key in drm-winsys hash table to fix ZaphodHeads.</li>
-  <li>winsys/radeon: Use dup fd as key in drm-winsys hash table to fix ZaphodHeads.</li>
-</ul>
-
-<p>Matt Turner (2):</p>
-<ul>
-  <li>i965/fs: Don't mess up stride for uniform integer multiplication.</li>
-  <li>Revert SHA1 additions.</li>
-</ul>
-
-<p>Michel Dänzer (1):</p>
-<ul>
-  <li>winsys/radeon: Unmap GPU VM address range when destroying BO</li>
-</ul>
-
-<p>Mike Stroyan (2):</p>
-<ul>
-  <li>meta: Only change and restore viewport 0 in mesa meta mode</li>
-  <li>i965: allocate at least 1 BLEND_STATE element</li>
-</ul>
-
-<p>Neil Roberts (4):</p>
-<ul>
-  <li>i965/skl: Set the pulls bary bit in 3DSTATE_PS_EXTRA</li>
-  <li>glsl: Add missing check for whether an expression is an add operation</li>
-  <li>glsl: Make sure not to dereference NULL</li>
-  <li>i965: Don't try to print the GLSL IR if it has been freed</li>
-</ul>
-
-<p>Tapani Pälli (8):</p>
-<ul>
-  <li>glsl: clone inputs and outputs during linking</li>
-  <li>i965: Delete linked GLSL IR when using NIR.</li>
-  <li>glsl: Allow dynamic sampler array indexing with GLSL ES &lt; 3.00</li>
-  <li>mesa/glsl: new compiler option EmitNoIndirectSampler</li>
-  <li>i965: use EmitNoIndirectSampler for gen &lt; 7</li>
-  <li>i915: use EmitNoIndirectSampler</li>
-  <li>mesa/st: use EmitNoIndirectSampler if !ARB_gpu_shader5</li>
-  <li>glsl: validate sampler array indexing for 'constant-index-expression'</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.3.html

@@ -1,106 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.3 Release Notes / July 26, 2015</h1>
-
-<p>
-Mesa 10.6.3 is a bug fix release which fixes bugs found since the 10.6.2 release.
-</p>
-<p>
-Mesa 10.6.3 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-c27e1e33798e69a6d2d2425aee8ac7b4c0b243066a65dd76cbb182ea31b1c7f2  mesa-10.6.3.tar.gz
-58592e07c350cd2e8969b73fa83048c657a39fe2f13f3b88f5e5818fe2e4676d  mesa-10.6.3.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90728">Bug 90728</a> - dvd playback with vlc and vdpau causes segmentation fault</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91337">Bug 91337</a> - OSMesaGetProcAdress(&quot;OSMesaPixelStore&quot;) returns nil</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Brian Paul (1):</p>
-<ul>
-  <li>osmesa: fix OSMesaPixelsStore typo</li>
-</ul>
-
-<p>Chad Versace (1):</p>
-<ul>
-  <li>mesa: Fix generation of git_sha1.h.tmp for gitlinks</li>
-</ul>
-
-<p>Christian König (2):</p>
-<ul>
-  <li>vl: cleanup video buffer private when the decoder is destroyed</li>
-  <li>st/vdpau: fix mixer size checks</li>
-</ul>
-
-<p>Emil Velikov (3):</p>
-<ul>
-  <li>docs: Add sha256 checksums for the 10.6.2 release</li>
-  <li>auxiliary/vl: use the correct screen index</li>
-  <li>Update version to 10.6.3</li>
-</ul>
-
-<p>Francisco Jerez (1):</p>
-<ul>
-  <li>i965/gen9: Use custom MOCS entries set up by the kernel.</li>
-</ul>
-
-<p>Ilia Mirkin (5):</p>
-<ul>
-  <li>nv50, nvc0: enable at least one color RT if alphatest is enabled</li>
-  <li>nvc0/ir: fix txq on indirect samplers</li>
-  <li>nvc0/ir: don't worry about sampler in txq handling</li>
-  <li>gm107/ir: fix indirect txq emission</li>
-  <li>nv50: fix max level clamping on G80</li>
-</ul>
-
-<p>Kenneth Graunke (1):</p>
-<ul>
-  <li>program: Allow redundant OPTION ARB_fog_* directives.</li>
-</ul>
-
-<p>Rob Clark (1):</p>
-<ul>
-  <li>xa: don't leak fences</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.4.html

@@ -1,137 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.4 Release Notes / August 11, 2015</h1>
-
-<p>
-Mesa 10.6.4 is a bug fix release which fixes bugs found since the 10.6.3 release.
-</p>
-<p>
-Mesa 10.6.4 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-4960bf17d8b5d6a6503c6954ec6cf480b5cd930797bac901c60bea192675f85e  mesa-10.6.4.tar.gz
-8f5ac103f0f503de2f7a985b0df349bd4ecdfe7f51c714be146fa5a9a3c07b77  mesa-10.6.4.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=73512">Bug 73512</a> - [clover] mesa.icd. should contain full path</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91290">Bug 91290</a> - SIGSEGV glcpp/glcpp-parse.y:1077</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Anuj Phogat (6):</p>
-<ul>
-  <li>mesa: Turn get_readpixels_transfer_ops() in to a global function</li>
-  <li>meta: Fix transfer operations check in meta pbo path for readpixels</li>
-  <li>meta: Abort meta pbo path if readpixels need signed-unsigned conversion</li>
-  <li>meta: Don't do fragment color clamping in _mesa_meta_pbo_GetTexSubImage</li>
-  <li>mesa: Add a helper function _mesa_need_luminance_to_rgb_conversion()</li>
-  <li>meta: Fix reading luminance texture as rgba in _mesa_meta_pbo_GetTexSubImage()</li>
-</ul>
-
-<p>Ben Widawsky (1):</p>
-<ul>
-  <li>i965/skl: Add production thread counts and URB size</li>
-</ul>
-
-<p>Eduardo Lima Mitev (3):</p>
-<ul>
-  <li>mesa: Fix errors values returned by glShaderBinary()</li>
-  <li>mesa: Validate target before resolving tex obj in glTex(ture)SubImageXD</li>
-  <li>mesa: Fix error returned by glCopyTexImage2D() upon an invalid internal format</li>
-</ul>
-
-<p>Emil Velikov (6):</p>
-<ul>
-  <li>docs: Add checksums for mesa 10.6.3 tarballs</li>
-  <li>configure.ac: do not set HAVE_DRI(23) when libdrm is missing</li>
-  <li>egl/wayland: libdrm is a hard requirement, treat it as such</li>
-  <li>winsys/radeon: don't leak the fd when it is 0</li>
-  <li>bugzilla_mesa.sh: sort the bugs list by number</li>
-  <li>Update version to 10.6.4</li>
-</ul>
-
-<p>Francisco Jerez (1):</p>
-<ul>
-  <li>i965/fs: Fix fs_inst::regs_read() for sources in the ATTR file.</li>
-</ul>
-
-<p>Frank Binns (2):</p>
-<ul>
-  <li>egl/dri: Add error info needed for EGL_EXT_image_dma_buf_import extension</li>
-  <li>egl: Add eglQuerySurface surface type check for EGL_LARGEST_PBUFFER attrib</li>
-</ul>
-
-<p>Igor Gnatenko (1):</p>
-<ul>
-  <li>opencl: use versioned .so in mesa.icd</li>
-</ul>
-
-<p>Ilia Mirkin (1):</p>
-<ul>
-  <li>nvc0: fix geometry program revalidation of clipping params</li>
-</ul>
-
-<p>Kenneth Graunke (1):</p>
-<ul>
-  <li>glsl: Fix a bug where LHS swizzles of swizzles were too small.</li>
-</ul>
-
-<p>Marek Olšák (6):</p>
-<ul>
-  <li>st/mesa: don't call st_validate_state in BlitFramebuffer</li>
-  <li>radeonsi: upload shader rodata after updating scratch relocations</li>
-  <li>st/mesa: don't ignore texture buffer state changes</li>
-  <li>radeonsi: rework how shader pointers to descriptors are set</li>
-  <li>radeonsi: completely rework updating descriptors without CP DMA</li>
-  <li>r600g: fix the CB_SHADER_MASK setup</li>
-</ul>
-
-<p>Samuel Iglesias Gonsalvez (1):</p>
-<ul>
-  <li>glsl/glcpp: fix SIGSEGV when checking error condition for macro redefinition</li>
-</ul>
-
-<p>Samuel Pitoiset (1):</p>
-<ul>
-  <li>nv50: avoid segfault with enabled but unbound vertex attrib</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.5.html

@@ -1,124 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.5 Release Notes / August 22, 2015</h1>
-
-<p>
-Mesa 10.6.5 is a bug fix release which fixes bugs found since the 10.6.4 release.
-</p>
-<p>
-Mesa 10.6.5 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-afe290fc7af75a25df5ee52396a9f09e5dba85fb3e159304bdda265b8564b0d4  mesa-10.6.5.tar.gz
-fb6fac3c85bcfa9d06b8dd439169f23f0c0924a88e44362e738b99b1feff762f  mesa-10.6.5.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85252">Bug 85252</a> - Segfault in compiler while processing ternary operator with void arguments</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91570">Bug 91570</a> - Upgrading mesa to 10.6 causes segfault in OpenGL applications with GeForce4 MX 440 / AGP 8X</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91610">Bug 91610</a> - [BSW] GPU hang for spec.shaders.point-vertex-id gl_instanceid divisor</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Adam Jackson (1):</p>
-<ul>
-  <li>glx: Fix __glXWireToEvent for BufferSwapComplete</li>
-</ul>
-
-<p>Alex Deucher (2):</p>
-<ul>
-  <li>radeonsi: add new OLAND pci id</li>
-  <li>radeonsi: properly set the raster_config for KV</li>
-</ul>
-
-<p>Emil Velikov (4):</p>
-<ul>
-  <li>docs: add sha256 checksums for 10.6.4</li>
-  <li>vc4: add missing nir include, to fix the build</li>
-  <li>Revert "radeonsi: properly set the raster_config for KV"</li>
-  <li>Update version to 10.6.5</li>
-</ul>
-
-<p>Frank Binns (1):</p>
-<ul>
-  <li>egl/x11: don't abort when creating a DRI2 drawable fails</li>
-</ul>
-
-<p>Ilia Mirkin (3):</p>
-<ul>
-  <li>nouveau: no need to do tnl wakeup, state updates are always hooked up</li>
-  <li>gm107/ir: indirect handle goes first on maxwell also</li>
-  <li>nv50,nvc0: take level into account when doing eng2d multi-layer blits</li>
-</ul>
-
-<p>Jason Ekstrand (4):</p>
-<ul>
-  <li>meta/copy_image: Stash off the scissor</li>
-  <li>mesa/formats: Only do byteswapping for packed formats</li>
-  <li>mesa/formats: Fix swizzle flipping for big-endian targets</li>
-  <li>mesa/formats: Don't flip channels of null array formats</li>
-</ul>
-
-<p>Marek Olšák (3):</p>
-<ul>
-  <li>radeonsi: fix polygon offset scale</li>
-  <li>r600g: fix polygon offset scale</li>
-  <li>r600g: allow setting geometry shader sampler states</li>
-</ul>
-
-<p>Neil Roberts (1):</p>
-<ul>
-  <li>i965/bdw: Fix setting the instancing state for the SGVS element</li>
-</ul>
-
-<p>Oded Gabbay (2):</p>
-<ul>
-  <li>mesa: clear existing swizzle info before bitwise-OR</li>
-  <li>mesa/formats: don't byteswap when building array formats</li>
-</ul>
-
-<p>Renaud Gaubert (1):</p>
-<ul>
-  <li>glsl: avoid compiler's segfault when processing operators with void arguments</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.6.html

@@ -1,164 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.6 Release Notes / September 04, 2015</h1>
-
-<p>
-Mesa 10.6.6 is a bug fix release which fixes bugs found since the 10.6.5 release.
-</p>
-<p>
-Mesa 10.6.6 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-416517aa9df4791f97d34451a9e4da33c966afcd18c115c5769b92b15b018ef5  mesa-10.6.6.tar.gz
-570f2154b7340ff5db61ff103bc6e85165b8958798b78a50fa2df488e98e5778  mesa-10.6.6.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84677">Bug 84677</a> - Triangle disappears with glPolygonMode GL_LINE</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90734">Bug 90734</a> - glBufferSubData is corrupting data when buffer is &gt; 32k</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90748">Bug 90748</a> - [BDW Bisected]dEQP-GLES3.functional.fbo.completeness.renderable.texture.depth.rg_half_float_oes fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90902">Bug 90902</a> - [bsw][regression] dEQP: &quot;Found invalid pixel values&quot;</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90925">Bug 90925</a> - &quot;high fidelity&quot;: Segfault in _mesa_program_resource_find_name</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91254">Bug 91254</a> - (regresion) video using VA-API on Intel slow and freeze system with mesa 10.6 or 10.6.1</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91292">Bug 91292</a> - [BDW+] glVertexAttribDivisor not working in combination with glPolygonMode</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91673">Bug 91673</a> - Segfault when calling glTexSubImage2D on storage texture to bound FBO</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91726">Bug 91726</a> - R600 asserts in tgsi_cmp/make_src_for_op3</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Chris Wilson (2):</p>
-<ul>
-  <li>i965: Prevent coordinate overflow in intel_emit_linear_blit</li>
-  <li>i965: Always re-emit the pipeline select during invariant state emission</li>
-</ul>
-
-<p>Daniel Scharrer (1):</p>
-<ul>
-  <li>mesa: add missing queries for ARB_direct_state_access</li>
-</ul>
-
-<p>Dave Airlie (8):</p>
-<ul>
-  <li>mesa/arb_gpu_shader_fp64: add support for glGetUniformdv</li>
-  <li>mesa/texgetimage: fix missing stencil check</li>
-  <li>st/readpixels: fix accel path for skipimages.</li>
-  <li>texcompress_s3tc/fxt1: fix stride checks (v1.1)</li>
-  <li>mesa/readpixels: check strides are equal before skipping conversion</li>
-  <li>mesa: enable texture stencil8 for multisample</li>
-  <li>r600/sb: update last_cf for finalize if.</li>
-  <li>r600g: fix calculation for gpr allocation</li>
-</ul>
-
-<p>David Heidelberg (1):</p>
-<ul>
-  <li>st/nine: Require gcc &gt;= 4.6</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: add sha256 checksums for 10.6.5</li>
-  <li>get-pick-list.sh: Require explicit "10.6" for nominating stable patches</li>
-</ul>
-
-<p>Glenn Kennard (4):</p>
-<ul>
-  <li>r600g: Fix assert in tgsi_cmp</li>
-  <li>r600g/sb: Handle undef in read port tracker</li>
-  <li>r600g/sb: Don't read junk after EOP</li>
-  <li>r600g/sb: Don't crash on empty if jump target</li>
-</ul>
-
-<p>Ilia Mirkin (5):</p>
-<ul>
-  <li>st/mesa: fix assignments with 4-operand arguments (i.e. BFI)</li>
-  <li>st/mesa: pass through 4th opcode argument in bitmap/pixel visitors</li>
-  <li>nv50,nvc0: disable depth bounds test on blit</li>
-  <li>nv50: fix 2d engine blits for 64- and 128-bit formats</li>
-  <li>mesa: only copy the requested teximage faces</li>
-</ul>
-
-<p>Jason Ekstrand (1):</p>
-<ul>
-  <li>i965/fs: Split VGRFs after lowering pull constants</li>
-</ul>
-
-<p>Kenneth Graunke (3):</p>
-<ul>
-  <li>i965: Fix copy propagation type changes.</li>
-  <li>Revert "i965: Advertise a line width of 40.0 on Cherryview and Skylake."</li>
-  <li>i965: Momentarily pretend to support ARB_texture_stencil8 for blits.</li>
-</ul>
-
-<p>Marek Olšák (3):</p>
-<ul>
-  <li>gallium/radeon: fix the ADDRESS_HI mask for EVENT_WRITE CIK packets</li>
-  <li>mesa: create multisample fallback textures like normal textures</li>
-  <li>radeonsi: fix a Unigine Heaven hang when drirc is missing</li>
-</ul>
-
-<p>Matt Turner (1):</p>
-<ul>
-  <li>i965/fs: Handle MRF destinations in lower_integer_multiplication().</li>
-</ul>
-
-<p>Neil Roberts (2):</p>
-<ul>
-  <li>i965: Swap the order of the vertex ID and edge flag attributes</li>
-  <li>i965/bdw: Fix 3DSTATE_VF_INSTANCING when the edge flag is used</li>
-</ul>
-
-<p>Tapani Pälli (5):</p>
-<ul>
-  <li>mesa: update fbo state in glTexStorage</li>
-  <li>glsl: build stageref mask using IR, not symbol table</li>
-  <li>glsl: expose build_program_resource_list function</li>
-  <li>glsl: create program resource list after LinkShader</li>
-  <li>mesa: add GL_RED, GL_RG support for floating point textures</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.7.html

@@ -1,75 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.7 Release Notes / September 10, 2015</h1>
-
-<p>
-Mesa 10.6.7 is a bug fix release which fixes bugs found since the 10.6.6 release.
-</p>
-<p>
-Mesa 10.6.7 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-4ba10c59abee30d72476543a57afd2f33803dabf4620dc333b335d47966ff842  mesa-10.6.7.tar.gz
-feb1f640b915dada88a7c793dfaff0ae23580f8903f87a6b76469253de0d28d8  mesa-10.6.7.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90751">Bug 90751</a> - [BDW Bisected]dEQP-GLES3.functional.fbo.completeness.renderable.texture.stencil.stencil_index8 fails</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Dave Airlie (1):</p>
-<ul>
-  <li>mesa/teximage: use correct extension for accept stencil texture.</li>
-</ul>
-
-<p>Emil Velikov (3):</p>
-<ul>
-  <li>docs: add sha256 checksums for 10.6.6</li>
-  <li>Revert "i965: Momentarily pretend to support ARB_texture_stencil8 for blits."</li>
-  <li>Update version to 10.6.7</li>
-</ul>
-
-<p>Kenneth Graunke (1):</p>
-<ul>
-  <li>glsl: Handle attribute aliasing in attribute storage limit check.</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.8.html

@@ -1,136 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.8 Release Notes / September 20, 2015</h1>
-
-<p>
-Mesa 10.6.8 is a bug fix release which fixes bugs found since the 10.6.7 release.
-</p>
-<p>
-Mesa 10.6.8 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-1f34dba2a8059782e3e4e0f18b9628004e253b2c69085f735b846d2e63c9e250  mesa-10.6.8.tar.gz
-e36ee5ceeadb3966fb5ce5b4cf18322dbb76a4f075558ae49c3bba94f57d58fd  mesa-10.6.8.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90621">Bug 90621</a> - Mesa fail to build from git</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91526">Bug 91526</a> - World of Warcraft (on Wine) has UI corruption with nouveau</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91719">Bug 91719</a> - [SNB,HSW,BYT] dEQP regressions associated with using NIR for vertex shaders</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Alejandro Piñeiro (1):</p>
-<ul>
-  <li>i965/vec4: fill src_reg type using the constructor type parameter</li>
-</ul>
-
-<p>Antia Puentes (1):</p>
-<ul>
-  <li>i965/vec4: Fix saturation errors when coalescing registers</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: add sha256 checksums for 10.6.7</li>
-  <li>cherry-ignore: add commit non applicable for 10.6</li>
-</ul>
-
-<p>Hans de Goede (4):</p>
-<ul>
-  <li>nv30: Fix creation of scanout buffers</li>
-  <li>nv30: Implement color resolve for msaa</li>
-  <li>nv30: Fix max width / height checks in nv30 sifm code</li>
-  <li>nv30: Disable msaa unless requested from the env by NV30_MAX_MSAA</li>
-</ul>
-
-<p>Ian Romanick (2):</p>
-<ul>
-  <li>mesa: Pass the type to _mesa_uniform_matrix as a glsl_base_type</li>
-  <li>mesa: Don't allow wrong type setters for matrix uniforms</li>
-</ul>
-
-<p>Ilia Mirkin (5):</p>
-<ul>
-  <li>st/mesa: don't fall back to 16F when 32F is requested</li>
-  <li>nvc0: always emit a full shader colormask</li>
-  <li>nvc0: remove BGRA4 format support</li>
-  <li>st/mesa: avoid integer overflows with buffers &gt;= 512MB</li>
-  <li>nv50, nvc0: fix max texture buffer size to 128M elements</li>
-</ul>
-
-<p>Jason Ekstrand (1):</p>
-<ul>
-  <li>i965/vec4: Don't reswizzle hardware registers</li>
-</ul>
-
-<p>Jose Fonseca (1):</p>
-<ul>
-  <li>gallivm: Workaround LLVM PR23628.</li>
-</ul>
-
-<p>Kenneth Graunke (1):</p>
-<ul>
-  <li>i965: Momentarily pretend to support ARB_texture_stencil8 for blits.</li>
-</ul>
-
-<p>Oded Gabbay (1):</p>
-<ul>
-  <li>llvmpipe: convert double to long long instead of unsigned long long</li>
-</ul>
-
-<p>Ray Strode (1):</p>
-<ul>
-  <li>gbm: convert gbm bo format to fourcc format on dma-buf import</li>
-</ul>
-
-<p>Ulrich Weigand (1):</p>
-<ul>
-  <li>mesa: Fix texture compression on big-endian systems</li>
-</ul>
-
-<p>Vinson Lee (1):</p>
-<ul>
-  <li>gallivm: Do not use NoFramePointerElim with LLVM 3.7.</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.9.html

@@ -1,130 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.9 Release Notes / Octover 03, 2015</h1>
-
-<p>
-Mesa 10.6.9 is a bug fix release which fixes bugs found since the 10.6.8 release.
-</p>
-<p>
-Mesa 10.6.9 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-3406876aac67546d0c3e2cb97da330b62644c313e7992b95618662e13c54296a  mesa-10.6.9.tar.gz
-b04c4de6280b863babc2929573da17218d92e9e4ba6272d548d135415723e8c3  mesa-10.6.9.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=38109">Bug 38109</a> - i915 driver crashes if too few vertices are submitted (Mesa 7.10.2)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=55552">Bug 55552</a> - Compile errors with --enable-mangling</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86281">Bug 86281</a> - brw_meta_fast_clear (brw=brw&#64;entry=0x7fffd4097a08, fb=fb&#64;entry=0x7fffd40fa900, buffers=buffers&#64;entry=2, partial_clear=partial_clear&#64;entry=false)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91970">Bug 91970</a> - [BSW regression] dEQP-GLES3.functional.shaders.precision.int.highp_mul_vertex</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92072">Bug 92072</a> - Wine breakage since d082c5324 (st/mesa: don't call st_validate_state in BlitFramebuffer)</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Brian Paul (1):</p>
-<ul>
-  <li>st/mesa: try PIPE_BIND_RENDER_TARGET when choosing float texture formats</li>
-</ul>
-
-<p>Chris Wilson (1):</p>
-<ul>
-  <li>i965: Remove early release of DRI2 miptree</li>
-</ul>
-
-<p>Emil Velikov (4):</p>
-<ul>
-  <li>docs: add sha256 checksums for 10.6.8</li>
-  <li>cherry-ignore: add commit non applicable for 10.6</li>
-  <li>cherry-ignore: add commit non applicable for 10.6</li>
-  <li>Update version to 10.6.9</li>
-</ul>
-
-<p>Iago Toral Quiroga (1):</p>
-<ul>
-  <li>mesa: Fix GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE for default framebuffer.</li>
-</ul>
-
-<p>Ian Romanick (5):</p>
-<ul>
-  <li>t_dd_dmatmp: Make "count" actually be the count</li>
-  <li>t_dd_dmatmp: Clean up improper code formatting from previous patch</li>
-  <li>t_dd_dmatmp: Use '&amp; 3' instead of '% 4' everywhere</li>
-  <li>t_dd_dmatmp: Pull out common 'count -= count &amp; 3' code</li>
-  <li>t_dd_dmatmp: Use addition instead of subtraction in loop bounds</li>
-</ul>
-
-<p>Jeremy Huddleston (1):</p>
-<ul>
-  <li>configure.ac: Add support to enable read-only text segment on x86.</li>
-</ul>
-
-<p>Kristian Høgsberg Kristensen (1):</p>
-<ul>
-  <li>i965: Respect stride and subreg_offset for ATTR registers</li>
-</ul>
-
-<p>Kyle Brenneman (3):</p>
-<ul>
-  <li>glx: Fix build errors with --enable-mangling (v2)</li>
-  <li>mapi: Make _glapi_get_stub work with "gl" or "mgl" prefix.</li>
-  <li>glx: Don't hard-code the name "libGL.so.1" in driOpenDriver (v3)</li>
-</ul>
-
-<p>Leo Liu (1):</p>
-<ul>
-  <li>radeon/vce: fix vui time_scale zero error</li>
-</ul>
-
-<p>Marek Olšák (1):</p>
-<ul>
-  <li>st/mesa: fix front buffer regression after dropping st_validate_state in Blit</li>
-</ul>
-
-<p>Roland Scheidegger (1):</p>
-<ul>
-  <li>mesa: fix mipmap generation for immutable, compressed textures</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/11.0.0.html

@@ -1,259 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.0.0 Release Notes / September 12, 2015</h1>
-
-<p>
-Mesa 11.0.0 is a new development release.
-People who are concerned with stability and reliability should stick
-with a previous release or wait for Mesa 11.0.1.
-</p>
-<p>
-Mesa 11.0.0 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-7d7e4ddffa3b162506efa01e2cc41e329caa4995336b92e5cc21f2e1fb36c1b3  mesa-11.0.0.tar.gz
-e095a3eb2eca9dfde7efca8946527c8ae20a0cc938a8c78debc7f158ad44af32  mesa-11.0.0.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-
-<p>
-Note: some of the new features are only available with certain drivers.
-</p>
-
-<ul>
-<li>New hardware support for AMD GCN 1.2 GPUs: Tonga, Iceland, Carrizo, Fiji</li>
-<li>OpenGL 4.1 on radeonsi, nvc0</li>
-<li>OpenGL ES 3.0 on freedreno (a3xx, a4xx)
-<li>GL_AMD_vertex_shader_viewport_index on radeonsi</li>
-<li>GL_ARB_conditional_render_inverted on r600, radeonsi</li>
-<li>GL_ARB_depth_buffer_float on a4xx</li>
-<li>GL_ARB_derivative_control on radeonsi</li>
-<li>GL_ARB_draw_buffers, GL_ARB_draw_buffers_blend on a4xx</li>
-<li>GL_ARB_fragment_layer_viewport on radeonsi</li>
-<li>GL_ARB_framebuffer_no_attachments on i965</li>
-<li>GL_ARB_get_texture_sub_image for all drivers</li>
-<li>GL_ARB_gpu_shader5 on radeonsi</li>
-<li>GL_ARB_gpu_shader_fp64 on llvmpipe, radeonsi</li>
-<li>GL_ARB_shader_image_load_store on i965</li>
-<li>GL_ARB_shader_precision on radeonsi, nvc0</li>
-<li>GL_ARB_shader_image_size on i965</li>
-<li>GL_ARB_shader_stencil_export on llvmpipe</li>
-<li>GL_ARB_shader_subroutine on core profile all drivers</li>
-<li>GL_ARB_tessellation_shader on nvc0, radeonsi</li>
-<li>GL_ARB_transform_feedback2, GL_ARB_transform_feedback_instanced, GL_EXT_transform_feedback on a3xx, a4xx</li>
-<li>GL_ARB_vertex_attrib_64bit on llvmpipe, radeonsi</li>
-<li>GL_ARB_viewport_array on radeonsi</li>
-<li>GL_EXT_depth_bounds_test on radeonsi, nv30, nv50, nvc0</li>
-<li>GL_EXT_texture_compression_s3tc on freedreno (a3xx)</li>
-<li>GL_NV_read_depth (GLES) on all drivers</li>
-<li>GL_NV_read_depth_stencil (GLES) on all drivers</li>
-<li>GL_NV_read_stencil (GLES) on all drivers</li>
-<li>GL_OES_texture_float on all r300, r600, radeonsi, nv30, nv50, nvc0, softpipe, llvmpipe</li>
-<li>GL_OES_texture_half_float on all r300, r600, radeonsi, nv30, nv50, nvc0, softpipe, llvmpipe</li>
-<li>GL_OES_texture_float_linear on all r300, r600, radeonsi, nv30, nv50, nvc0, softpipe, llvmpipe</li>
-<li>GL_OES_texture_half_float_linear on all r300, r600, radeonsi, nv30, nv50, nvc0, softpipe, llvmpipe</li>
-<li>GL_EXT_draw_buffers2 on a4xx</li>
-<li>GLX_ARB_create_context_robustness on r600, radeonsi</li>
-<li>EGL_EXT_create_context_robustness on r600, radeonsi</li>
-<li>EGL_KHR_gl_colorspace on r600, radeonsi, nv50, nvc0</li>
-<li>EGL_KHR_gl_texture_3D_image on r600, radeonsi, nv50, nvc0</li>
-<li>EGL 1.5 on r600, radeonsi, nv50, nvc0</li>
-</ul>
-
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=51658">Bug 51658</a> - r200 (&amp; possibly radeon) DRI fixes for gnome shell on Mesa 8.0.3</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=65525">Bug 65525</a> - [llvmpipe] lp_scene.h:210:lp_scene_alloc: Assertion `size &lt;= (64 * 1024)' failed.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=66346">Bug 66346</a> - shader_query.cpp:49: error: invalid conversion from 'void*' to 'GLuint'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=73512">Bug 73512</a> - [clover] mesa.icd. should contain full path</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=73528">Bug 73528</a> - Deferred lighting in Second Life causes system hiccups and screen flickering</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=74329">Bug 74329</a> - Please expose OES_texture_float and OES_texture_half_float on the ES3 context</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80500">Bug 80500</a> - Flickering shadows in unreleased title trace</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82186">Bug 82186</a> - [r600g] BARTS GPU lockup with minecraft shaders</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84225">Bug 84225</a> - Allow constant-index-expression sampler array indexing with GLSL-ES &lt; 300</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84677">Bug 84677</a> - Triangle disappears with glPolygonMode GL_LINE</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85252">Bug 85252</a> - Segfault in compiler while processing ternary operator with void arguments</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89131">Bug 89131</a> - [Bisected] Graphical corruption in Weston,  shows old framebuffer pieces</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90000">Bug 90000</a> - [i965 Bisected NIR] Piglit/gglean_fragprog1-z-write_test fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90073">Bug 90073</a> - Leaks in xcb_dri3_open_reply_fds() and get_render_node_from_id_path_tag</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90249">Bug 90249</a> - Fails to build egl_dri2 on osx</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90310">Bug 90310</a> - Fails to build gallium_dri.so at linking stage with clang because of multiple redefinitions</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90347">Bug 90347</a> - [NVE0+] Failure to insert texbar under some circumstances (causing bad colors in Terasology)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90466">Bug 90466</a> - arm: linker error ndefined reference to `nir_metadata_preserve'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90520">Bug 90520</a> - Register spilling clobbers registers used elsewhere in the shader</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90537">Bug 90537</a> - radeonsi bo/va conflict on RADEON_GEM_VA (rscreen-&gt;ws-&gt;buffer_from_handle returns NULL)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90547">Bug 90547</a> - [BDW/BSW/SKL Bisected]Piglit/glean&#64;vertprog1-rsq_test_2_(reciprocal_square_root_of_negative_value) fais</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90580">Bug 90580</a> - [HSW bisected] integer multiplication bug</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90600">Bug 90600</a> - IOError: [Errno 2] No such file or directory: 'gl_API.xml'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90621">Bug 90621</a> - Mesa fail to build from git</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90629">Bug 90629</a> - [i965] SIMD16 dual_source_blend assertion `src[i].file != GRF || src[i].width == dst.width' failed</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90691">Bug 90691</a> - [BSW]Piglit/spec/nv_conditional_render/dlist fails intermittently</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90728">Bug 90728</a> - dvd playback with vlc and vdpau causes segmentation fault</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90734">Bug 90734</a> - glBufferSubData is corrupting data when buffer is &gt; 32k</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90748">Bug 90748</a> - [BDW Bisected]dEQP-GLES3.functional.fbo.completeness.renderable.texture.depth.rg_half_float_oes fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90749">Bug 90749</a> - [BDW Bisected]dEQP-GLES3.functional.rasterization.fbo.rbo_multisample_max.primitives.lines_wide fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90751">Bug 90751</a> - [BDW Bisected]dEQP-GLES3.functional.fbo.completeness.renderable.texture.stencil.stencil_index8 fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90797">Bug 90797</a> - [ALL bisected] Mesa change cause performance case manhattan fail.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90817">Bug 90817</a> - swrast fails to load with certain remote X servers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90830">Bug 90830</a> - [bsw bisected regression] GPU hang for spec.arb_gpu_shader5.execution.sampler_array_indexing.vs-nonzero-base</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90839">Bug 90839</a> - [10.5.5/10.6 regression, bisected] PBO glDrawPixels no longer using blit fastpath</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90873">Bug 90873</a> - Kernel hang, TearFree On, Mate desktop environment</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90887">Bug 90887</a> - PhiMovesPass in register allocator broken</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90895">Bug 90895</a> - [IVB/HSW/BDW/BSW Bisected] GLB2.7 Egypt, GfxBench3.0 T-Rex &amp; ALU and many SynMark cases performance reduced by 10-23%</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90902">Bug 90902</a> - [bsw][regression] dEQP: &quot;Found invalid pixel values&quot;</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90903">Bug 90903</a> - egl_dri2.c:dri2_load fails to load libglapi on osx</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90904">Bug 90904</a> - OSX: EXC_BAD_ACCESS when using translate_sse + gallium + softpipe/llvmpipe</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90905">Bug 90905</a> - mesa: Finish subdir-objects transition</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90925">Bug 90925</a> - &quot;high fidelity&quot;: Segfault in _mesa_program_resource_find_name</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91022">Bug 91022</a> - [g45 g965 bisected] assertions generated from textureGrad cube samplers fix</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91047">Bug 91047</a> - [SNB Bisected] Messed up Fog in Super Smash Bros. Melee in Dolphin</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91056">Bug 91056</a> - The Bard's Tale (2005, native)  has rendering issues</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91077">Bug 91077</a> - dri2_glx.c:1186: undefined reference to `loader_open_device'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91099">Bug 91099</a> - [llvmpipe] piglit glsl-max-varyings &gt;max_varying_components regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91101">Bug 91101</a> - [softpipe] piglit glsl-1.50&#64;execution&#64;geometry&#64;max-input-components regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91117">Bug 91117</a> - Nimbus (running in wine) has rendering issues, objects are semi-transparent</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91124">Bug 91124</a> - Civilization V (in Wine) has rendering issues: text missing, menu bar corrupted</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91173">Bug 91173</a> - Oddworld: Stranger's Wrath HD: disfigured models in wrong colors</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91193">Bug 91193</a> - [290x] Dota2 reborn ingame rendering breaks with git-af4b9c7</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91222">Bug 91222</a> - lp_test_format regression on CentOS 7</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91226">Bug 91226</a> - Crash in glLinkProgram (NEW)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91231">Bug 91231</a> - [NV92] Psychonauts (native) segfaults on start when DRI3 enabled</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91254">Bug 91254</a> - (regresion) video using VA-API on Intel slow and freeze system with mesa 10.6 or 10.6.1</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91290">Bug 91290</a> - SIGSEGV glcpp/glcpp-parse.y:1077</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91292">Bug 91292</a> - [BDW+] glVertexAttribDivisor not working in combination with glPolygonMode</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91337">Bug 91337</a> - OSMesaGetProcAdress(&quot;OSMesaPixelStore&quot;) returns nil</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91418">Bug 91418</a> - Visual Studio 2015 vsnprintf build error</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91425">Bug 91425</a> - [regression, bisected] Piglit spec/ext_packed_float/ getteximage-invalid-format-for-packed-type fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91441">Bug 91441</a> - make check DispatchSanity_test.GL30 regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91444">Bug 91444</a> - regression bisected radeonsi: don't change pipe_resource in resource_copy_region</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91461">Bug 91461</a> - gl_TessLevel* writes have no effect for all but the last TCS invocation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91513">Bug 91513</a> - [IVB/HSW/BDW/SKL Bisected] Lightsmark performance reduced by 7%-10%</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91526">Bug 91526</a> - World of Warcraft (on Wine) has UI corruption with nouveau</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91544">Bug 91544</a> - [i965, regression, bisected] regression of several tests in 93977d3a151675946c03e</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91551">Bug 91551</a> - DXTn compressed normal maps produce severe artifacts on all NV5x and NVDx chipsets</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91570">Bug 91570</a> - Upgrading mesa to 10.6 causes segfault in OpenGL applications with GeForce4 MX 440 / AGP 8X</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91591">Bug 91591</a> - rounding.h:102:2: error: #error &quot;Unsupported or undefined LONG_BIT&quot;</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91610">Bug 91610</a> - [BSW] GPU hang for spec.shaders.point-vertex-id gl_instanceid divisor</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91673">Bug 91673</a> - Segfault when calling glTexSubImage2D on storage texture to bound FBO</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91726">Bug 91726</a> - R600 asserts in tgsi_cmp/make_src_for_op3</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91847">Bug 91847</a> - glGenerateTextureMipmap not working (no errors) unless glActiveTexture(GL_TEXTURE1) is called before</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91857">Bug 91857</a> - Mesa 10.6.3 linker is slow</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91881">Bug 91881</a> - regression: GPU lockups since mesa-11.0.0_rc1 on RV620 (r600) driver</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91890">Bug 91890</a> - [nve7] witcher2: blurry image &amp; DATA_ERRORs (class 0xa097 mthd 0x2380/0x238c)</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<li>Removed the EGL loader from the Linux SCons build.</li>
-
-</div>
-</body>
-</html>

docs/relnotes/11.0.1.html

@@ -1,134 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.0.1 Release Notes / September 26, 2015</h1>
-
-<p>
-Mesa 11.0.1 is a bug fix release which fixes bugs found since the 11.0.0 release.
-</p>
-<p>
-Mesa 11.0.1 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-6dab262877e12c0546a0e2970c6835a0f217e6d4026ccecb3cd5dd733d1ce867  mesa-11.0.1.tar.gz
-43d0dfcd1f1e36f07f8228cd76d90175d3fc74c1ed25d7071794a100a98ef2a6  mesa-11.0.1.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=38109">Bug 38109</a> - i915 driver crashes if too few vertices are submitted (Mesa 7.10.2)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91114">Bug 91114</a> - ES3-CTS.gtf.GL3Tests.shadow.shadow_execution_vert fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91716">Bug 91716</a> - [bisected] piglit.shaders.glsl-vs-int-attrib regresses on 32 bit BYT, HSW, IVB, SNB</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91719">Bug 91719</a> - [SNB,HSW,BYT] dEQP regressions associated with using NIR for vertex shaders</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92009">Bug 92009</a> - ES3-CTS.gtf.GL3Tests.packed_pixels.packed_pixels fails</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Antia Puentes (2):</p>
-<ul>
-  <li>i965/vec4: Fix saturation errors when coalescing registers</li>
-  <li>i965/vec4_nir: Load constants as integers</li>
-</ul>
-
-<p>Anuj Phogat (1):</p>
-<ul>
-  <li>meta: Abort meta pbo path if TexSubImage need signed unsigned conversion</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: add sha256 checksums for 11.0.0</li>
-  <li>Update version to 11.0.1</li>
-</ul>
-
-<p>Iago Toral Quiroga (1):</p>
-<ul>
-  <li>mesa: Fix GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE for default framebuffer.</li>
-</ul>
-
-<p>Ian Romanick (5):</p>
-<ul>
-  <li>t_dd_dmatmp: Make "count" actually be the count</li>
-  <li>t_dd_dmatmp: Clean up improper code formatting from previous patch</li>
-  <li>t_dd_dmatmp: Use '&amp; 3' instead of '% 4' everywhere</li>
-  <li>t_dd_dmatmp: Pull out common 'count -= count &amp; 3' code</li>
-  <li>t_dd_dmatmp: Use addition instead of subtraction in loop bounds</li>
-</ul>
-
-<p>Ilia Mirkin (6):</p>
-<ul>
-  <li>st/mesa: avoid integer overflows with buffers &gt;= 512MB</li>
-  <li>nv50, nvc0: fix max texture buffer size to 128M elements</li>
-  <li>freedreno/a3xx: fix blending of L8 format</li>
-  <li>nv50,nvc0: detect underlying resource changes and update tic</li>
-  <li>nv50,nvc0: flush texture cache in presence of coherent bufs</li>
-  <li>radeonsi: load fmask ptr relative to the resources array</li>
-</ul>
-
-<p>Jason Ekstrand (2):</p>
-<ul>
-  <li>nir: Fix a bunch of ralloc parenting errors</li>
-  <li>i965/vec4: Don't reswizzle hardware registers</li>
-</ul>
-
-<p>Jeremy Huddleston (1):</p>
-<ul>
-  <li>configure.ac: Add support to enable read-only text segment on x86.</li>
-</ul>
-
-<p>Ray Strode (1):</p>
-<ul>
-  <li>gbm: convert gbm bo format to fourcc format on dma-buf import</li>
-</ul>
-
-<p>Tapani Pälli (2):</p>
-<ul>
-  <li>mesa: fix errors when reading depth with glReadPixels</li>
-  <li>i965: fix textureGrad for cubemaps</li>
-</ul>
-
-<p>Ulrich Weigand (1):</p>
-<ul>
-  <li>mesa: Fix texture compression on big-endian systems</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/11.0.2.html

@@ -1,85 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.0.2 Release Notes / September 28, 2015</h1>
-
-<p>
-Mesa 11.0.2 is a bug fix release which fixes bugs found since the 11.0.1 release.
-</p>
-<p>
-Mesa 11.0.2 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-45170773500d6ae2f9eb93fc85efee69f7c97084411ada4eddf92f78bca56d20  mesa-11.0.2.tar.gz
-fce11fb27eb87adf1e620a76455d635c6136dfa49ae58c53b34ef8d0c7b7eae4  mesa-11.0.2.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91582">Bug 91582</a> - [bisected] Regression in DEQP gles2.functional.negative_api.texture.texsubimage2d_neg_offset</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91970">Bug 91970</a> - [BSW regression] dEQP-GLES3.functional.shaders.precision.int.highp_mul_vertex</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92095">Bug 92095</a> - [Regression, bisected] arb_shader_atomic_counters.compiler.builtins.frag</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Eduardo Lima Mitev (3):</p>
-<ul>
-  <li>mesa: Fix order of format+type and internal format checks for glTexImageXD ops</li>
-  <li>mesa: Move _mesa_base_tex_format() from teximage to glformats files</li>
-  <li>mesa: Use the effective internal format instead for validation</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: add sha256 checksums for 11.0.1</li>
-  <li>Update version to 11.0.2</li>
-</ul>
-
-<p>Kristian Høgsberg Kristensen (1):</p>
-<ul>
-  <li>i965: Respect stride and subreg_offset for ATTR registers</li>
-</ul>
-
-<p>Matt Turner (1):</p>
-<ul>
-  <li>glsl: Expose gl_MaxTess{Control,Evaluation}AtomicCounters.</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/11.0.3.html

@@ -1,185 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.0.3 Release Notes / October 10, 2015</h1>
-
-<p>
-Mesa 11.0.3 is a bug fix release which fixes bugs found since the 11.0.2 release.
-</p>
-<p>
-Mesa 11.0.3 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-c2210e3daecc10ed9fdcea500327652ed6effc2f47c4b9cee63fb08f560d7117  mesa-11.0.3.tar.gz
-ab2992eece21adc23c398720ef8c6933cb69ea42e1b2611dc09d031e17e033d6  mesa-11.0.3.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=55552">Bug 55552</a> - Compile errors with --enable-mangling</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=71789">Bug 71789</a> - [r300g] Visuals not found in (default) depth = 24</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91044">Bug 91044</a> - piglit spec/egl_khr_create_context/valid debug flag gles* fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91342">Bug 91342</a> - Very dark textures on some objects in indoors environments in Postal 2</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91596">Bug 91596</a> - EGL_KHR_gl_colorspace (v2) causes problem with Android-x86 GUI</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91718">Bug 91718</a> - piglit.spec.arb_shader_image_load_store.invalid causes intermittent GPU HANG</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92072">Bug 92072</a> - Wine breakage since d082c5324 (st/mesa: don't call st_validate_state in BlitFramebuffer)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92265">Bug 92265</a> - Black windows in weston after update mesa to 11.0.2-1</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Brian Paul (1):</p>
-<ul>
-  <li>st/mesa: try PIPE_BIND_RENDER_TARGET when choosing float texture formats</li>
-</ul>
-
-<p>Daniel Scharrer (1):</p>
-<ul>
-  <li>mesa: Add abs input modifier to base for POW in ffvertex_prog</li>
-</ul>
-
-<p>Emil Velikov (3):</p>
-<ul>
-  <li>docs: add sha256 checksums for 11.0.2</li>
-  <li>Revert "nouveau: make sure there's always room to emit a fence"</li>
-  <li>Update version to 11.0.3</li>
-</ul>
-
-<p>Francisco Jerez (1):</p>
-<ul>
-  <li>i965/fs: Fix hang on IVB and VLV with image format mismatch.</li>
-</ul>
-
-<p>Ian Romanick (1):</p>
-<ul>
-  <li>meta: Handle array textures in scaled MSAA blits</li>
-</ul>
-
-<p>Ilia Mirkin (6):</p>
-<ul>
-  <li>nouveau: be more careful about freeing temporary transfer buffers</li>
-  <li>nouveau: delay deleting buffer with unflushed fence</li>
-  <li>nouveau: wait to unref the transfer's bo until it's no longer used</li>
-  <li>nv30: pretend to have packed texture/surface formats</li>
-  <li>nv30: always go through translate module on big-endian</li>
-  <li>nouveau: make sure there's always room to emit a fence</li>
-</ul>
-
-<p>Jason Ekstrand (1):</p>
-<ul>
-  <li>mesa: Correctly handle GL_BGRA_EXT in ES3 format_and_type checks</li>
-</ul>
-
-<p>Kyle Brenneman (3):</p>
-<ul>
-  <li>glx: Fix build errors with --enable-mangling (v2)</li>
-  <li>mapi: Make _glapi_get_stub work with "gl" or "mgl" prefix.</li>
-  <li>glx: Don't hard-code the name "libGL.so.1" in driOpenDriver (v3)</li>
-</ul>
-
-<p>Leo Liu (1):</p>
-<ul>
-  <li>radeon/vce: fix vui time_scale zero error</li>
-</ul>
-
-<p>Marek Olšák (21):</p>
-<ul>
-  <li>st/mesa: fix front buffer regression after dropping st_validate_state in Blit</li>
-  <li>radeonsi: handle index buffer alloc failures</li>
-  <li>radeonsi: handle constant buffer alloc failures</li>
-  <li>gallium/radeon: handle buffer_map staging buffer failures better</li>
-  <li>gallium/radeon: handle buffer alloc failures in r600_draw_rectangle</li>
-  <li>gallium/radeon: add a fail path for depth MSAA texture readback</li>
-  <li>radeonsi: report alloc failure from si_shader_binary_read</li>
-  <li>radeonsi: add malloc fail paths to si_create_shader_state</li>
-  <li>radeonsi: skip drawing if the tess factor ring allocation fails</li>
-  <li>radeonsi: skip drawing if GS ring allocations fail</li>
-  <li>radeonsi: handle shader precompile failures</li>
-  <li>radeonsi: handle fixed-func TCS shader create failure</li>
-  <li>radeonsi: skip drawing if VS, TCS, TES, GS fail to compile or upload</li>
-  <li>radeonsi: skip drawing if PS fails to compile or upload</li>
-  <li>radeonsi: skip drawing if updating the scratch buffer fails</li>
-  <li>radeonsi: don't forget to update scratch relocations for LS, HS, ES shaders</li>
-  <li>radeonsi: handle dummy constant buffer allocation failure</li>
-  <li>gallium/u_blitter: handle allocation failures</li>
-  <li>radeonsi: add scratch buffer to the buffer list when it's re-allocated</li>
-  <li>st/dri: don't use _ctx in client_wait_sync</li>
-  <li>egl/dri2: don't require a context for ClientWaitSync (v2)</li>
-</ul>
-
-<p>Matthew Waters (1):</p>
-<ul>
-  <li>egl: rework handling EGL_CONTEXT_FLAGS</li>
-</ul>
-
-<p>Michel Dänzer (1):</p>
-<ul>
-  <li>st/dri: Use packed RGB formats</li>
-</ul>
-
-<p>Roland Scheidegger (1):</p>
-<ul>
-  <li>mesa: fix mipmap generation for immutable, compressed textures</li>
-</ul>
-
-<p>Tom Stellard (3):</p>
-<ul>
-  <li>gallium/radeon: Use call_once() when initailizing LLVM targets</li>
-  <li>gallivm: Allow drivers and state trackers to initialize gallivm LLVM targets v2</li>
-  <li>radeon/llvm: Initialize gallivm targets when initializing the AMDGPU target v2</li>
-</ul>
-
-<p>Varad Gautam (1):</p>
-<ul>
-  <li>egl: restore surface type before linking config to its display</li>
-</ul>
-
-<p>Ville Syrjälä (3):</p>
-<ul>
-  <li>i830: Fix collision between I830_UPLOAD_RASTER_RULES and I830_UPLOAD_TEX(0)</li>
-  <li>i915: Fix texcoord vs. varying collision in fragment programs</li>
-  <li>i915: Remember to call intel_prepare_render() before blitting</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/11.0.4.html

@@ -1,168 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.0.4 Release Notes / October 24, 2015</h1>
-
-<p>
-Mesa 11.0.4 is a bug fix release which fixes bugs found since the 11.0.3 release.
-</p>
-<p>
-Mesa 11.0.4 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-ed412ca6a46d1bd055120e5c12806c15419ae8c4dd6d3f6ea20a83091d5c78bf  mesa-11.0.4.tar.gz
-40201bf7fc6fa12a6d9edfe870b41eb4dd6669154e3c42c48a96f70805f5483d  mesa-11.0.4.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86281">Bug 86281</a> - brw_meta_fast_clear (brw=brw&#64;entry=0x7fffd4097a08, fb=fb&#64;entry=0x7fffd40fa900, buffers=buffers&#64;entry=2, partial_clear=partial_clear&#64;entry=false)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86720">Bug 86720</a> - [radeon] Europa Universalis 4 freezing during game start (10.3.3+, still broken on 11.0.2)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91788">Bug 91788</a> - [HSW Regression] Synmark2_v6 Multithread performance case FPS reduced by 36%</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92304">Bug 92304</a> - [cts] cts.shaders.negative conformance tests fail</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Alejandro Piñeiro (2):</p>
-<ul>
-  <li>i965/vec4: check writemask when bailing out at register coalesce</li>
-  <li>i965/vec4: fill src_reg type using the constructor type parameter</li>
-</ul>
-
-<p>Brian Paul (2):</p>
-<ul>
-  <li>vbo: fix incorrect switch statement in init_mat_currval()</li>
-  <li>mesa: fix incorrect opcode in save_BlendFunci()</li>
-</ul>
-
-<p>Chih-Wei Huang (3):</p>
-<ul>
-  <li>mesa: android: Fix the incorrect path of sse_minmax.c</li>
-  <li>nv50/ir: use C++11 standard std::unordered_map if possible</li>
-  <li>nv30: include the header of ffs prototype</li>
-</ul>
-
-<p>Chris Wilson (1):</p>
-<ul>
-  <li>i965: Remove early release of DRI2 miptree</li>
-</ul>
-
-<p>Dave Airlie (1):</p>
-<ul>
-  <li>mesa/uniforms: fix get_uniform for doubles (v2)</li>
-</ul>
-
-<p>Emil Velikov (1):</p>
-<ul>
-  <li>docs: add sha256 checksums for 11.0.3</li>
-</ul>
-
-<p>Francisco Jerez (5):</p>
-<ul>
-  <li>i965: Don't tell the hardware about our UAV access.</li>
-  <li>mesa: Expose function to calculate whether a shader image unit is valid.</li>
-  <li>mesa: Skip redundant texture completeness checking during image validation.</li>
-  <li>i965: Use _mesa_is_image_unit_valid() instead of gl_image_unit::_Valid.</li>
-  <li>mesa: Get rid of texture-dependent image unit derived state.</li>
-</ul>
-
-<p>Ian Romanick (8):</p>
-<ul>
-  <li>glsl: Allow built-in functions as constant expressions in OpenGL ES 1.00</li>
-  <li>ff_fragment_shader: Use binding to set the sampler unit</li>
-  <li>glsl/linker: Use constant_initializer instead of constant_value to initialize uniforms</li>
-  <li>glsl: Use constant_initializer instead of constant_value to determine whether to keep an unused uniform</li>
-  <li>glsl: Only set ir_variable::constant_value for const-decorated variables</li>
-  <li>glsl: Restrict initializers for global variables to constant expression in ES</li>
-  <li>glsl: Add method to determine whether an expression contains the sequence operator</li>
-  <li>glsl: In later GLSL versions, sequence operator is cannot be a constant expression</li>
-</ul>
-
-<p>Ilia Mirkin (1):</p>
-<ul>
-  <li>nouveau: make sure there's always room to emit a fence</li>
-</ul>
-
-<p>Indrajit Das (1):</p>
-<ul>
-  <li>st/va: Used correct parameter to derive the value of the "h" variable in vlVaCreateImage</li>
-</ul>
-
-<p>Jonathan Gray (1):</p>
-<ul>
-  <li>configure.ac: ensure RM is set</li>
-</ul>
-
-<p>Krzysztof Sobiecki (1):</p>
-<ul>
-  <li>st/fbo: use pipe_surface_release instead of pipe_surface_reference</li>
-</ul>
-
-<p>Leo Liu (1):</p>
-<ul>
-  <li>st/omx/dec/h264: fix field picture type 0 poc disorder</li>
-</ul>
-
-<p>Marek Olšák (3):</p>
-<ul>
-  <li>st/mesa: fix clip state dependencies</li>
-  <li>radeonsi: fix a GS copy shader leak</li>
-  <li>gallium: add PIPE_SHADER_CAP_MAX_UNROLL_ITERATIONS_HINT</li>
-</ul>
-
-<p>Nicolai Hähnle (1):</p>
-<ul>
-  <li>u_vbuf: fix vb slot assignment for translated buffers</li>
-</ul>
-
-<p>Rob Clark (1):</p>
-<ul>
-  <li>freedreno/a3xx: cache-flush is needed after MEM_WRITE</li>
-</ul>
-
-<p>Tapani Pälli (3):</p>
-<ul>
-  <li>mesa: add GL_UNSIGNED_INT_24_8 to _mesa_pack_depth_span</li>
-  <li>mesa: Set api prefix to version string when overriding version</li>
-  <li>mesa: fix ARRAY_SIZE query for GetProgramResourceiv</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/11.0.5.html

@@ -1,172 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.0.5 Release Notes / November 11, 2015</h1>
-
-<p>
-Mesa 11.0.5 is a bug fix release which fixes bugs found since the 11.0.4 release.
-</p>
-<p>
-Mesa 11.0.5 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-8495ef5c06f7f726452462b7d408a5b40048373ff908f2283a3b4d1f49b45ee6  mesa-11.0.5.tar.gz
-9c255a2a6695fcc6ef4a279e1df0aeaf417dc142f39ee59dfb533d80494bb67a  mesa-11.0.5.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91993">Bug 91993</a> - Graphical glitch in Astromenace (open-source game).</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92214">Bug 92214</a> - Flightgear crashes during splashboot with R600 driver, LLVM 3.7.0 and mesa 11.0.2</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92437">Bug 92437</a> - osmesa: Expose GL entry points for Windows build, via .def file</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92476">Bug 92476</a> - [cts] ES2-CTS.gtf.GL2ExtensionTests.egl_image.egl_image fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92623">Bug 92623</a> - Differences in prog_data ignored when caching fragment programs (causes hangs)</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Alex Deucher (1):</p>
-<ul>
-  <li>radeon/uvd: don't expose HEVC on old UVD hw (v3)</li>
-</ul>
-
-<p>Ben Widawsky (1):</p>
-<ul>
-  <li>i965/skl: Add GT4 PCI IDs</li>
-</ul>
-
-<p>Emil Velikov (4):</p>
-<ul>
-  <li>docs: add sha256 checksums for 11.0.4</li>
-  <li>cherry-ignore: ignore a possible wrong nomination</li>
-  <li>Revert "mesa/glformats: Undo code changes from _mesa_base_tex_format() move"</li>
-  <li>Update version to 11.0.5</li>
-</ul>
-
-<p>Emmanuel Gil Peyrot (1):</p>
-<ul>
-  <li>gbm.h: Add a missing stddef.h include for size_t.</li>
-</ul>
-
-<p>Eric Anholt (1):</p>
-<ul>
-  <li>vc4: When the create ioctl fails, free our cache and try again.</li>
-</ul>
-
-<p>Ian Romanick (1):</p>
-<ul>
-  <li>i965: Fix is-renderable check in intel_image_target_renderbuffer_storage</li>
-</ul>
-
-<p>Ilia Mirkin (3):</p>
-<ul>
-  <li>nvc0: respect edgeflag attribute width</li>
-  <li>nouveau: set MaxDrawBuffers to the same value as MaxColorAttachments</li>
-  <li>nouveau: relax fence emit space assert</li>
-</ul>
-
-<p>Ivan Kalvachev (1):</p>
-<ul>
-  <li>r600g: Fix special negative immediate constants when using ABS modifier.</li>
-</ul>
-
-<p>Jason Ekstrand (2):</p>
-<ul>
-  <li>nir/lower_vec_to_movs: Pass the shader around directly</li>
-  <li>nir: Report progress from lower_vec_to_movs().</li>
-</ul>
-
-<p>Jose Fonseca (2):</p>
-<ul>
-  <li>gallivm: Translate all util_cpu_caps bits to LLVM attributes.</li>
-  <li>gallivm: Explicitly disable unsupported CPU features.</li>
-</ul>
-
-<p>Julien Isorce (4):</p>
-<ul>
-  <li>st/va: pass picture desc to begin and decode</li>
-  <li>nvc0: fix crash when nv50_miptree_from_handle fails</li>
-  <li>st/va: do not destroy old buffer when new one failed</li>
-  <li>st/va: add more errors checks in vlVaBufferSetNumElements and vlVaMapBuffer</li>
-</ul>
-
-<p>Kenneth Graunke (6):</p>
-<ul>
-  <li>i965: Fix missing BRW_NEW_*_PROG_DATA flagging caused by cache reuse.</li>
-  <li>nir: Report progress from nir_split_var_copies().</li>
-  <li>nir: Properly invalidate metadata in nir_split_var_copies().</li>
-  <li>nir: Properly invalidate metadata in nir_opt_copy_prop().</li>
-  <li>nir: Properly invalidate metadata in nir_lower_vec_to_movs().</li>
-  <li>nir: Properly invalidate metadata in nir_opt_remove_phis().</li>
-</ul>
-
-<p>Marek Olšák (1):</p>
-<ul>
-  <li>radeonsi: add register definitions for Stoney</li>
-</ul>
-
-<p>Nanley Chery (1):</p>
-<ul>
-  <li>mesa/glformats: Undo code changes from _mesa_base_tex_format() move</li>
-</ul>
-
-<p>Nicolai Hähnle (1):</p>
-<ul>
-  <li>st/mesa: fix mipmap generation for immutable textures with incomplete pyramids</li>
-</ul>
-
-<p>Nigel Stewart (1):</p>
-<ul>
-  <li>osmesa: Expose GL entry points for Windows build via DEF file.</li>
-</ul>
-
-<p>Roland Scheidegger (1):</p>
-<ul>
-  <li>gallivm: disable f16c when not using AVX</li>
-</ul>
-
-<p>Samuel Li (2):</p>
-<ul>
-  <li>radeonsi: add support for Stoney asics (v3)</li>
-  <li>radeonsi: add Stoney pci ids</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/11.0.6.html

@@ -1,145 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.0.6 Release Notes / November 21, 2015</h1>
-
-<p>
-Mesa 11.0.6 is a bug fix release which fixes bugs found since the 11.0.5 release.
-</p>
-<p>
-Mesa 11.0.6 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-4bdf054af66ebabf3eca0616f9f5e44c2f234695661b570261c391bc2f4f7482  mesa-11.0.6.tar.gz
-8340e64cdc91999840404c211496f3de38e7b4cb38db34e2f72f1642c5134760  mesa-11.0.6.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91780">Bug 91780</a> - Rendering issues with geometry shader</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92588">Bug 92588</a> - [HSW,BDW,BSW,SKL-Y][GLES 3.1 CTS] ES31-CTS.arrays_of_arrays.InteractionFunctionCalls2 - assert</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92738">Bug 92738</a> - Randon R7 240 doesn't work on 16KiB page size platform</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92860">Bug 92860</a> - [radeonsi][bisected] st/mesa: implement ARB_copy_image - Corruption in ARK Survival Evolved</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92900">Bug 92900</a> - [regression bisected] About 700 piglit regressions is what could go wrong</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Alex Deucher (1):</p>
-<ul>
-  <li>radeonsi: enable optimal raster config setting for fiji (v2)</li>
-</ul>
-
-<p>Ben Widawsky (1):</p>
-<ul>
-  <li>i965/skl/gt4: Fix URB programming restriction.</li>
-</ul>
-
-<p>Boyuan Zhang (2):</p>
-<ul>
-  <li>st/vaapi: fix vaapi VC-1 simple/main corruption v2</li>
-  <li>radeon/uvd: fix VC-1 simple/main profile decode v2</li>
-</ul>
-
-<p>Dave Airlie (1):</p>
-<ul>
-  <li>r600: initialised PGM_RESOURCES_2 for ES/GS</li>
-</ul>
-
-<p>Emil Velikov (4):</p>
-<ul>
-  <li>docs: add sha256 checksums for 11.0.5</li>
-  <li>cherry-ignore: add the swrast front buffer support</li>
-  <li>automake: use static llvm for make distcheck</li>
-  <li>Update version to 11.0.6</li>
-</ul>
-
-<p>Eric Anholt (3):</p>
-<ul>
-  <li>vc4: Return GL_OUT_OF_MEMORY when buffer allocation fails.</li>
-  <li>vc4: Return NULL when we can't make our shadow for a sampler view.</li>
-  <li>vc4: Add support for nir_op_uge, using the carry bit on QPU_A_SUB.</li>
-</ul>
-
-<p>Ian Romanick (2):</p>
-<ul>
-  <li>meta/generate_mipmap: Don't leak the sampler object</li>
-  <li>meta/generate_mipmap: Only modify the draw framebuffer binding in fallback_required</li>
-</ul>
-
-<p>Ilia Mirkin (2):</p>
-<ul>
-  <li>mesa/copyimage: allow width/height to not be multiples of block</li>
-  <li>nouveau: don't expose HEVC decoding support</li>
-</ul>
-
-<p>Jason Ekstrand (1):</p>
-<ul>
-  <li>nir/vars_to_ssa: Rework copy set handling in lower_copies_to_load_store</li>
-</ul>
-
-<p>Kenneth Graunke (1):</p>
-<ul>
-  <li>glsl: Allow implicit int -&gt; uint conversions for the % operator.</li>
-</ul>
-
-<p>Marek Olšák (1):</p>
-<ul>
-  <li>radeonsi: initialize SX_PS_DOWNCONVERT to 0 on Stoney</li>
-</ul>
-
-<p>Michel Dänzer (1):</p>
-<ul>
-  <li>winsys/radeon: Use CPU page size instead of hardcoding 4096 bytes v3</li>
-</ul>
-
-<p>Oded Gabbay (1):</p>
-<ul>
-  <li>llvmpipe: use simple coeffs calc for 128bit vectors</li>
-</ul>
-
-<p>Roland Scheidegger (2):</p>
-<ul>
-  <li>radeon: fix bgrx8/xrgb8 blits</li>
-  <li>r200: fix bgrx8/xrgb8 blits</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/11.0.7.html

@@ -1,154 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.0.7 Release Notes / December 9, 2015</h1>
-
-<p>
-Mesa 11.0.7 is a bug fix release which fixes bugs found since the 11.0.6 release.
-</p>
-<p>
-Mesa 11.0.7 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-07c27004ff68b288097d17b2faa7bdf15ec73c96b7e6c9835266e544adf0a62f  mesa-11.0.7.tar.gz
-e7e90a332ede6c8fd08eff90786a3fd1605a4e62ebf3a9b514047838194538cb  mesa-11.0.7.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90348">Bug 90348</a> - Spilling failure of b96 merged value</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92363">Bug 92363</a> - [BSW/BDW] ogles1conform Gets test fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92438">Bug 92438</a> - Segfault in pushbuf_kref when running the android emulator (qemu) on nv50</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93110">Bug 93110</a> - [NVE4] textureSize() and textureQueryLevels() uses a texture bound during the previous draw call</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93126">Bug 93126</a> - wrongly claim supporting GL_EXT_texture_rg</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Chris Wilson (1):</p>
-<ul>
-  <li>meta: Compute correct buffer size with SkipRows/SkipPixels</li>
-</ul>
-
-<p>Daniel Stone (1):</p>
-<ul>
-  <li>egl/wayland: Ignore rects from SwapBuffersWithDamage</li>
-</ul>
-
-<p>Dave Airlie (4):</p>
-<ul>
-  <li>texgetimage: consolidate 1D array handling code.</li>
-  <li>r600: geometry shader gsvs itemsize workaround</li>
-  <li>r600: rv670 use at least 16es/gs threads</li>
-  <li>r600: workaround empty geom shader.</li>
-</ul>
-
-<p>Emil Velikov (4):</p>
-<ul>
-  <li>docs: add sha256 checksums for 11.0.6</li>
-  <li>get-pick-list.sh: Require explicit "11.0" for nominating stable patches</li>
-  <li>mesa; add get-extra-pick-list.sh script into bin/</li>
-  <li>Update version to 11.0.7</li>
-</ul>
-
-<p>François Tigeot (1):</p>
-<ul>
-  <li>xmlconfig: Add support for DragonFly</li>
-</ul>
-
-<p>Ian Romanick (22):</p>
-<ul>
-  <li>mesa: Make bind_vertex_buffer avilable outside varray.c</li>
-  <li>mesa: Refactor update_array_format to make _mesa_update_array_format_public</li>
-  <li>mesa: Refactor enable_vertex_array_attrib to make _mesa_enable_vertex_array_attrib</li>
-  <li>i965: Pass brw_context instead of gl_context to brw_draw_rectlist</li>
-  <li>i965: Use DSA functions for VBOs in brw_meta_fast_clear</li>
-  <li>i965: Use internal functions for buffer object access</li>
-  <li>i965: Don't pollute the buffer object namespace in brw_meta_fast_clear</li>
-  <li>meta: Use DSA functions for PBO in create_texture_for_pbo</li>
-  <li>meta: Use _mesa_NamedBufferData and _mesa_NamedBufferSubData for users of _mesa_meta_setup_vertex_objects</li>
-  <li>i965: Use _mesa_NamedBufferSubData for users of _mesa_meta_setup_vertex_objects</li>
-  <li>meta: Don't leave the VBO bound after _mesa_meta_setup_vertex_objects</li>
-  <li>meta: Track VBO using gl_buffer_object instead of GL API object handle</li>
-  <li>meta: Use DSA functions for VBOs in _mesa_meta_setup_vertex_objects</li>
-  <li>meta: Use internal functions for buffer object and VAO access</li>
-  <li>meta: Don't pollute the buffer object namespace in _mesa_meta_setup_vertex_objects</li>
-  <li>meta: Partially convert _mesa_meta_DrawTex to DSA</li>
-  <li>meta: Track VBO using gl_buffer_object instead of GL API object handle in _mesa_meta_DrawTex</li>
-  <li>meta: Use internal functions for buffer object and VAO access in _mesa_meta_DrawTex</li>
-  <li>meta: Don't pollute the buffer object namespace in _mesa_meta_DrawTex</li>
-  <li>meta/TexSubImage: Don't pollute the buffer object namespace</li>
-  <li>meta/generate_mipmap: Don't leak the framebuffer object</li>
-  <li>glsl: Fix off-by-one error in array size check assertion</li>
-</ul>
-
-<p>Ilia Mirkin (7):</p>
-<ul>
-  <li>nvc0/ir: actually emit AFETCH on kepler</li>
-  <li>nir: fix typo in idiv lowering, causing large-udiv-udiv failures</li>
-  <li>nouveau: use the buffer usage to determine placement when no binding</li>
-  <li>nv50,nvc0: properly handle buffer storage invalidation on dsa buffer</li>
-  <li>nv50/ir: fix (un)spilling of 3-wide results</li>
-  <li>mesa: support GL_RED/GL_RG in ES2 contexts when driver support exists</li>
-  <li>nvc0/ir: start offset at texBindBase for txq, like regular texturing</li>
-</ul>
-
-<p>Jonathan Gray (1):</p>
-<ul>
-  <li>automake: fix some occurrences of hardcoded -ldl and -lpthread</li>
-</ul>
-
-<p>Leo Liu (1):</p>
-<ul>
-  <li>radeon/vce: disable Stoney VCE for 11.0</li>
-</ul>
-
-<p>Marta Lofstedt (1):</p>
-<ul>
-  <li>gles2: Update gl2ext.h to revision: 32120</li>
-</ul>
-
-<p>Oded Gabbay (1):</p>
-<ul>
-  <li>llvmpipe: disable VSX in ppc due to LLVM PPC bug</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/11.0.8.html

@@ -1,200 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.0.8 Release Notes / December 9, 2015</h1>
-
-<p>
-Mesa 11.0.8 is a bug fix release which fixes bugs found since the 11.0.7 release.
-</p>
-<p>
-Mesa 11.0.8 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-ab9db87b54d7525e4b611b82577ea9a9eae55927558df57b190059d5ecd9406f  mesa-11.0.8.tar.gz
-5696e4730518b6805d2ed5def393c4293f425a2c2c01bd5ed4bdd7ad62f7ad75  mesa-11.0.8.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91806">Bug 91806</a> - configure does not test whether assembler supports sse4.1</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92849">Bug 92849</a> - [IVB HSW BDW] piglit image load/store load-from-cleared-image.shader_test fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92909">Bug 92909</a> - Offset/alignment issue with layout std140 and vec3</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93004">Bug 93004</a> - Guild Wars 2 crash on nouveau DX11 cards</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93215">Bug 93215</a> - [Regression bisected] Ogles1conform Automatic mipmap generation test is fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93266">Bug 93266</a> - gl_arb_shading_language_420pack does not allow binding of image variables</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Boyuan Zhang (1):</p>
-<ul>
-  <li>radeon/uvd: uv pitch separation for stoney</li>
-</ul>
-
-<p>Dave Airlie (9):</p>
-<ul>
-  <li>r600: do SQ flush ES ring rolling workaround</li>
-  <li>r600: SMX returns CONTEXT_DONE early workaround</li>
-  <li>r600/shader: split address get out to a function.</li>
-  <li>r600/shader: add utility functions to do single slot arithmatic</li>
-  <li>r600g: fix geom shader input indirect indexing.</li>
-  <li>r600: handle geometry dynamic input array index</li>
-  <li>radeonsi: handle doubles in lds load path.</li>
-  <li>mesa/varray: set double arrays to non-normalised.</li>
-  <li>mesa/shader: return correct attribute location for double matrix arrays</li>
-</ul>
-
-<p>Emil Velikov (8):</p>
-<ul>
-  <li>docs: add sha256 checksums for 11.0.7</li>
-  <li>cherry-ignore: don't pick a specific i965 formats patch</li>
-  <li>Revert "i965/nir: Remove unused indirect handling"</li>
-  <li>Revert "i965/state: Get rid of dword_pitch arguments to buffer functions"</li>
-  <li>Revert "i965/vec4: Use a stride of 1 and byte offsets for UBOs"</li>
-  <li>Revert "i965/fs: Use a stride of 1 and byte offsets for UBOs"</li>
-  <li>Revert "i965/vec4: Use byte offsets for UBO pulls on Sandy Bridge"</li>
-  <li>Update version to 11.0.8</li>
-</ul>
-
-<p>Francisco Jerez (1):</p>
-<ul>
-  <li>i965: Resolve color and flush for all active shader images in intel_update_state().</li>
-</ul>
-
-<p>Ian Romanick (1):</p>
-<ul>
-  <li>meta/generate_mipmap: Work-around GLES 1.x problem with GL_DRAW_FRAMEBUFFER</li>
-</ul>
-
-<p>Ilia Mirkin (17):</p>
-<ul>
-  <li>freedreno/a4xx: support lod_bias</li>
-  <li>freedreno/a4xx: fix 5_5_5_1 texture sampler format</li>
-  <li>freedreno/a4xx: point regid to "red" even for alpha-only rb formats</li>
-  <li>nvc0/ir: fold postfactor into immediate</li>
-  <li>nv50/ir: deal with loops with no breaks</li>
-  <li>nv50/ir: the mad source might not have a defining instruction</li>
-  <li>nv50/ir: fix instruction permutation logic</li>
-  <li>nv50/ir: don't forget to mark flagsDef on cvt in txb lowering</li>
-  <li>nv50/ir: fix DCE to not generate 96-bit loads</li>
-  <li>nv50/ir: avoid looking at uninitialized srcMods entries</li>
-  <li>gk110/ir: fix imul hi emission with limm arg</li>
-  <li>gk104/ir: sampler doesn't matter for txf</li>
-  <li>gk110/ir: fix imad sat/hi flag emission for immediate args</li>
-  <li>nv50/ir: fix cutoff for using r63 vs r127 when replacing zero</li>
-  <li>nv50/ir: can't have predication and immediates</li>
-  <li>glsl: assign varying locations to tess shaders when doing SSO</li>
-  <li>ttn: add TEX2 support</li>
-</ul>
-
-<p>Jason Ekstrand (5):</p>
-<ul>
-  <li>i965/vec4: Use byte offsets for UBO pulls on Sandy Bridge</li>
-  <li>i965/fs: Use a stride of 1 and byte offsets for UBOs</li>
-  <li>i965/vec4: Use a stride of 1 and byte offsets for UBOs</li>
-  <li>i965/state: Get rid of dword_pitch arguments to buffer functions</li>
-  <li>i965/nir: Remove unused indirect handling</li>
-</ul>
-
-<p>Jonathan Gray (2):</p>
-<ul>
-  <li>configure.ac: use pkg-config for libelf</li>
-  <li>configure: check for python2.7 for PYTHON2</li>
-</ul>
-
-<p>Kenneth Graunke (2):</p>
-<ul>
-  <li>i965: Fix fragment shader struct inputs.</li>
-  <li>i965: Fix scalar vertex shader struct outputs.</li>
-</ul>
-
-<p>Marek Olšák (8):</p>
-<ul>
-  <li>radeonsi: fix occlusion queries on Fiji</li>
-  <li>radeonsi: fix a hang due to uninitialized border color registers</li>
-  <li>radeonsi: fix Fiji for LLVM &lt;= 3.7</li>
-  <li>radeonsi: don't call of u_prims_for_vertices for patches and rectangles</li>
-  <li>radeonsi: apply the streamout workaround to Fiji as well</li>
-  <li>gallium/radeon: fix Hyper-Z hangs by programming PA_SC_MODE_CNTL_1 correctly</li>
-  <li>tgsi/scan: add flag colors_written</li>
-  <li>r600g: write all MRTs only if there is exactly one output (fixes a hang)</li>
-</ul>
-
-<p>Matt Turner (1):</p>
-<ul>
-  <li>glsl: Allow binding of image variables with 420pack.</li>
-</ul>
-
-<p>Neil Roberts (2):</p>
-<ul>
-  <li>i965: Add MESA_FORMAT_B8G8R8X8_SRGB to brw_format_for_mesa_format</li>
-  <li>i965: Add B8G8R8X8_SRGB to the alpha format override</li>
-</ul>
-
-<p>Oded Gabbay (1):</p>
-<ul>
-  <li>configura.ac: fix test for SSE4.1 assembler support</li>
-</ul>
-
-<p>Patrick Rudolph (2):</p>
-<ul>
-  <li>nv50,nvc0: fix use-after-free when vertex buffers are unbound</li>
-  <li>gallium/util: return correct number of bound vertex buffers</li>
-</ul>
-
-<p>Samuel Pitoiset (1):</p>
-<ul>
-  <li>nvc0: free memory allocated by the prog which reads MP perf counters</li>
-</ul>
-
-<p>Tapani Pälli (1):</p>
-<ul>
-  <li>i965: use _Shader to get fragment program when updating surface state</li>
-</ul>
-
-<p>Tom Stellard (2):</p>
-<ul>
-  <li>radeonsi: Rename si_shader::ls_rsrc{1,2} to si_shader::rsrc{1,2}</li>
-  <li>radeonsi/compute: Use the compiler's COMPUTE_PGM_RSRC* register values</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/11.0.9.html

@@ -1,127 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.0.9 Release Notes / January 22, 2016</h1>
-
-<p>
-Mesa 11.0.9 is a bug fix release which fixes bugs found since the 11.0.8 release.
-</p>
-<p>
-Mesa 11.0.9 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-1597c2e983f476f98efdd6cd58b5298896d18479ff542bdeff28b98b129ede05  mesa-11.0.9.tar.gz
-a1262ff1c66a16ccf341186cf0e57b306b8589eb2cc5ce92ffb6788ab01d2b01  mesa-11.0.9.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91596">Bug 91596</a> - EGL_KHR_gl_colorspace (v2) causes problem with Android-x86 GUI</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92229">Bug 92229</a> - [APITRACE] SOMA have serious graphical errors</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93257">Bug 93257</a> - [SKL, bisected] ASTC dEQP tests segfault</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Emil Velikov (6):</p>
-<ul>
-  <li>docs: add sha256 checksums for 11.0.8</li>
-  <li>cherry-ignore: add patch already in branch</li>
-  <li>cherry-ignore: add the dri3 glx null check patch</li>
-  <li>i915: correctly parse/set the context flags</li>
-  <li>egl/dri2: expose srgb configs when KHR_gl_colorspace is available</li>
-  <li>Update version to 11.0.9</li>
-</ul>
-
-<p>Grazvydas Ignotas (1):</p>
-<ul>
-  <li>r600: fix constant buffer size programming</li>
-</ul>
-
-<p>Ilia Mirkin (5):</p>
-<ul>
-  <li>nvc0: don't forget to reset VTX_TMP bufctx slot after blit completion</li>
-  <li>nv50/ir: float(s32 &amp; 0xff) = float(u8), not s8</li>
-  <li>nv50,nvc0: make sure there's pushbuf space and that we ref the bo early</li>
-  <li>nv50,nvc0: fix crash when increasing bsp bo size for h264</li>
-  <li>nvc0: scale up inter_bo size so that it's 16M for a 4K video</li>
-</ul>
-
-<p>Kenneth Graunke (2):</p>
-<ul>
-  <li>ralloc: Fix ralloc_adopt() to the old context's last child's parent.</li>
-  <li>nvc0: Set winding order regardless of domain.</li>
-</ul>
-
-<p>Marek Olšák (1):</p>
-<ul>
-  <li>radeonsi: don't miss changes to SPI_TMPRING_SIZE</li>
-</ul>
-
-<p>Miklós Máté (1):</p>
-<ul>
-  <li>mesa: Don't leak ATIfs instructions in DeleteFragmentShader</li>
-</ul>
-
-<p>Neil Roberts (1):</p>
-<ul>
-  <li>i965: Fix crash when calling glViewport with no surface bound</li>
-</ul>
-
-<p>Nicolai Hähnle (6):</p>
-<ul>
-  <li>gallium/radeon: only dispose locally created target machine in radeon_llvm_compile</li>
-  <li>mesa/bufferobj: make _mesa_delete_buffer_object externally accessible</li>
-  <li>st/mesa: use _mesa_delete_buffer_object</li>
-  <li>radeon: use _mesa_delete_buffer_object</li>
-  <li>i915: use _mesa_delete_buffer_object</li>
-  <li>i965: use _mesa_delete_buffer_object</li>
-</ul>
-
-<p>Oded Gabbay (1):</p>
-<ul>
-  <li>llvmpipe: use vpkswss when dst is signed</li>
-</ul>
-
-<p>Rob Herring (1):</p>
-<ul>
-  <li>freedreno/ir3: fix 32-bit builds with pointer-to-int-cast error enabled</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/11.1.0.html

@@ -1,281 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.1.0 Release Notes / 15 December 2015</h1>
-
-<p>
-Mesa 11.1.0 is a new development release.
-People who are concerned with stability and reliability should stick
-with a previous release or wait for Mesa 11.1.1.
-</p>
-<p>
-Mesa 11.1.0 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-e3bc44be4df5e4dc728dfda7b55b1aaeadfce36eca6a367b76cc07598070cb2d  mesa-11.1.0.tar.gz
-9befe03b04223eb1ede177fa8cac001e2850292c8c12a3ec9929106afad9cf1f  mesa-11.1.0.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-
-<p>
-Note: some of the new features are only available with certain drivers.
-</p>
-
-<ul>
-<li>OpenGL 3.1 support on freedreno (a3xx, a4xx)</li>
-<li>OpenGL 3.3 support for VMware guest VM driver (supported by Workstation 12
-    and Fusion 8).
-<li>GL_AMD_performance_monitor on nv50</li>
-<li>GL_ARB_arrays_of_arrays on i965</li>
-<li>GL_ARB_blend_func_extended on freedreno (a3xx)</li>
-<li>GL_ARB_clear_texture on nv50, nvc0</li>
-<li>GL_ARB_clip_control on freedreno/a4xx</li>
-<li>GL_ARB_copy_image on nv50, nvc0, radeonsi</li>
-<li>GL_ARB_depth_clamp on freedreno/a4xx</li>
-<li>GL_ARB_fragment_layer_viewport on i965 (gen6+)</li>
-<li>GL_ARB_gpu_shader_fp64 on r600 for Cypress/Cayman/Aruba chips</li>
-<li>GL_ARB_gpu_shader5 on r600 for Evergreen and later chips</li>
-<li>GL_ARB_seamless_cubemap_per_texture on freedreno/a4xx</li>
-<li>GL_ARB_shader_clock on i965 (gen7+)</li>
-<li>GL_ARB_shader_stencil_export on i965 (gen9+)</li>
-<li>GL_ARB_shader_storage_buffer_object on i965</li>
-<li>GL_ARB_shader_texture_image_samples on i965, nv50, nvc0, r600, radeonsi</li>
-<li>GL_ARB_texture_barrier / GL_NV_texture_barrier on i965</li>
-<li>GL_ARB_texture_buffer_range on freedreno/a3xx</li>
-<li>GL_ARB_texture_compression_bptc on freedreno/a4xx</li>
-<li>GL_ARB_texture_query_lod on softpipe</li>
-<li>GL_ARB_texture_view on radeonsi and r600 (for evergeen and newer)</li>
-<li>GL_ARB_vertex_type_2_10_10_10_rev on freedreno (a3xx, a4xx)</li>
-<li>GL_EXT_blend_func_extended on all drivers that support the ARB version</li>
-<li>GL_EXT_buffer_storage implemented for when ES 3.1 support is gained</li>
-<li>GL_EXT_draw_elements_base_vertex on all drivers</li>
-<li>GL_EXT_texture_compression_rgtc / latc on freedreno (a3xx & a4xx)</li>
-<li>GL_KHR_debug (GLES)</li>
-<li>GL_NV_conditional_render on freedreno</li>
-<li>GL_OES_draw_elements_base_vertex on all drivers</li>
-<li>EGL_KHR_create_context on softpipe, llvmpipe</li>
-<li>EGL_KHR_gl_colorspace on softpipe, llvmpipe</li>
-<li>new virgl gallium driver for qemu virtio-gpu</li>
-<li>16x multisampling on i965 (gen9+)</li>
-<li>GL_EXT_shader_samples_identical on i965.</li>
-</ul>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28130">Bug 28130</a> - vbo: premature flushing breaks GL_LINE_LOOP</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=38109">Bug 38109</a> - i915 driver crashes if too few vertices are submitted (Mesa 7.10.2)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=49779">Bug 49779</a> - Extra line segments in GL_LINE_LOOP</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=55552">Bug 55552</a> - Compile errors with --enable-mangling</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=71789">Bug 71789</a> - [r300g] Visuals not found in (default) depth = 24</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79783">Bug 79783</a> - Distorted output in obs-studio where other vendors &quot;work&quot;</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80821">Bug 80821</a> - When LIBGL_ALWAYS_SOFTWARE is set, KHR_create_context is not supported</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81174">Bug 81174</a> - Gallium: GL_LINE_LOOP broken with more than 512 points</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83508">Bug 83508</a> - [UBO] Assertion for array of blocks</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84677">Bug 84677</a> - Triangle disappears with glPolygonMode GL_LINE</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86281">Bug 86281</a> - brw_meta_fast_clear (brw=brw&#64;entry=0x7fffd4097a08, fb=fb&#64;entry=0x7fffd40fa900, buffers=buffers&#64;entry=2, partial_clear=partial_clear&#64;entry=false)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86469">Bug 86469</a> - Unreal Engine demo doesn't run</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86720">Bug 86720</a> - [radeon] Europa Universalis 4 freezing during game start (10.3.3+, still broken on 11.0.2)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89014">Bug 89014</a> - PIPE_QUERY_GPU_FINISHED is not acting as expected on SI</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90175">Bug 90175</a> - [hsw bisected][PATCH] atomic counters doesn't work for a binding point different to zero</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90348">Bug 90348</a> - Spilling failure of b96 merged value</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90631">Bug 90631</a> - Compilation failure for fragment shader with many branches on Sandy Bridge</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90734">Bug 90734</a> - glBufferSubData is corrupting data when buffer is &gt; 32k</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90887">Bug 90887</a> - PhiMovesPass in register allocator broken</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91044">Bug 91044</a> - piglit spec/egl_khr_create_context/valid debug flag gles* fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91114">Bug 91114</a> - ES3-CTS.gtf.GL3Tests.shadow.shadow_execution_vert fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91254">Bug 91254</a> - (regresion) video using VA-API on Intel slow and freeze system with mesa 10.6 or 10.6.1</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91292">Bug 91292</a> - [BDW+] glVertexAttribDivisor not working in combination with glPolygonMode</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91342">Bug 91342</a> - Very dark textures on some objects in indoors environments in Postal 2</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91526">Bug 91526</a> - World of Warcraft (on Wine) has UI corruption with nouveau</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91551">Bug 91551</a> - DXTn compressed normal maps produce severe artifacts on all NV5x and NVDx chipsets</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91596">Bug 91596</a> - EGL_KHR_gl_colorspace (v2) causes problem with Android-x86 GUI</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91716">Bug 91716</a> - [bisected] piglit.shaders.glsl-vs-int-attrib regresses on 32 bit BYT, HSW, IVB, SNB</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91718">Bug 91718</a> - piglit.spec.arb_shader_image_load_store.invalid causes intermittent GPU HANG</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91719">Bug 91719</a> - [SNB,HSW,BYT] dEQP regressions associated with using NIR for vertex shaders</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91726">Bug 91726</a> - R600 asserts in tgsi_cmp/make_src_for_op3</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91780">Bug 91780</a> - Rendering issues with geometry shader</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91785">Bug 91785</a> - make check DispatchSanity_test.GLES31 regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91788">Bug 91788</a> - [HSW Regression] Synmark2_v6 Multithread performance case FPS reduced by 36%</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91847">Bug 91847</a> - glGenerateTextureMipmap not working (no errors) unless glActiveTexture(GL_TEXTURE1) is called before</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91857">Bug 91857</a> - Mesa 10.6.3 linker is slow</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91881">Bug 91881</a> - regression: GPU lockups since mesa-11.0.0_rc1 on RV620 (r600) driver</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91890">Bug 91890</a> - [nve7] witcher2: blurry image &amp; DATA_ERRORs (class 0xa097 mthd 0x2380/0x238c)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91898">Bug 91898</a> - src/util/mesa-sha1.c:250:25: fatal error: openssl/sha.h: No such file or directory</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91927">Bug 91927</a> - [SKL] [regression] piglit compressed textures tests fail  with kernel upgrade</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91930">Bug 91930</a> - Program with GtkGLArea widget does not redraw</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91970">Bug 91970</a> - [BSW regression] dEQP-GLES3.functional.shaders.precision.int.highp_mul_vertex</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91985">Bug 91985</a> - [regression, bisected] FTBFS with commit f9caabe8f1: R600_UCP_CONST_BUFFER is undefined</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91993">Bug 91993</a> - Graphical glitch in Astromenace (open-source game).</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92009">Bug 92009</a> - ES3-CTS.gtf.GL3Tests.packed_pixels.packed_pixels fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92033">Bug 92033</a> - [SNB,regression,dEQP,bisected] functional.shaders.random tests regressed</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92052">Bug 92052</a> - nir/nir_builder.h:79: error: expected primary-expression before ‘.’ token</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92054">Bug 92054</a> - make check gbm-symbols-check regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92066">Bug 92066</a> - [ILK,G45,regression] New assertion on BRW_MAX_MRF breaks ilk and g45</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92072">Bug 92072</a> - Wine breakage since d082c5324 (st/mesa: don't call st_validate_state in BlitFramebuffer)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92095">Bug 92095</a> - [Regression, bisected] arb_shader_atomic_counters.compiler.builtins.frag</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92122">Bug 92122</a> - [bisected, cts] Regression with Assault Android Cactus</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92124">Bug 92124</a> - shader_query.cpp:841:34: error: ‘strndup’ was not declared in this scope</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92183">Bug 92183</a> - linker.cpp:3187:46: error: ‘strtok_r’ was not declared in this scope</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92193">Bug 92193</a> - [SKL] ES2-CTS.gtf.GL2ExtensionTests.compressed_astc_texture.compressed_astc_texture fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92214">Bug 92214</a> - Flightgear crashes during splashboot with R600 driver, LLVM 3.7.0 and mesa 11.0.2</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92221">Bug 92221</a> - Unintended code changes in _mesa_base_tex_format commit</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92265">Bug 92265</a> - Black windows in weston after update mesa to 11.0.2-1</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92304">Bug 92304</a> - [cts] cts.shaders.negative conformance tests fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92363">Bug 92363</a> - [BSW/BDW] ogles1conform Gets test fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92437">Bug 92437</a> - osmesa: Expose GL entry points for Windows build, via .def file</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92438">Bug 92438</a> - Segfault in pushbuf_kref when running the android emulator (qemu) on nv50</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92476">Bug 92476</a> - [cts] ES2-CTS.gtf.GL2ExtensionTests.egl_image.egl_image fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92588">Bug 92588</a> - [HSW,BDW,BSW,SKL-Y][GLES 3.1 CTS] ES31-CTS.arrays_of_arrays.InteractionFunctionCalls2 - assert</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92621">Bug 92621</a> - [G965 ILK G45] Regression: 24 piglit regressions in glsl-1.10</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92623">Bug 92623</a> - Differences in prog_data ignored when caching fragment programs (causes hangs)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92634">Bug 92634</a> - gallium's vl_mpeg12_decoder does not work with st/va</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92639">Bug 92639</a> - [Regression bisected] Ogles1conform mustpass.c fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92641">Bug 92641</a> - [SKL BSW] [Regression] Ogles1conform userclip.c fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92645">Bug 92645</a> - kodi vdpau interop fails since  mesa,meta: move gl_texture_object::TargetIndex initializations</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92705">Bug 92705</a> - [clover] fail to build with llvm-svn/clang-svn 3.8</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92709">Bug 92709</a> - &quot;LLVM triggered Diagnostic Handler: unsupported call to function ldexpf in main&quot; when starting race in stuntrally</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92738">Bug 92738</a> - Randon R7 240 doesn't work on 16KiB page size platform</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92744">Bug 92744</a> - [g965 Regression bisected] Performance regression and piglit assertions due to liveness analysis</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92770">Bug 92770</a> - [SNB, regression, dEQP] deqp-gles3.functional.shaders.discard.dynamic_loop_texture</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92824">Bug 92824</a> - [regression, bisected] `make check` dispatch-sanity broken by GL_EXT_buffer_storage</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92849">Bug 92849</a> - [IVB HSW BDW] piglit image load/store load-from-cleared-image.shader_test fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92859">Bug 92859</a> - [regression, bisected] validate_intrinsic_instr: Assertion triggered</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92860">Bug 92860</a> - [radeonsi][bisected] st/mesa: implement ARB_copy_image - Corruption in ARK Survival Evolved</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92900">Bug 92900</a> - [regression bisected] About 700 piglit regressions is what could go wrong</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92909">Bug 92909</a> - Offset/alignment issue with layout std140 and vec3</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92985">Bug 92985</a> - Mac OS X build error &quot;ar: no archive members specified&quot;</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93015">Bug 93015</a> - Tonga Elemental segfault + VM faults since  radeon: implement r600_query_hw_get_result via function pointers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93048">Bug 93048</a> - [CTS regression] mesa af2723 breaks GL Conformance for debug extension</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93063">Bug 93063</a> - drm_helper.h:227:1: error: static declaration of ‘pipe_virgl_create_screen’ follows non-static declaration</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93091">Bug 93091</a> - [opencl] segfault when running any opencl programs (like clinfo)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93126">Bug 93126</a> - wrongly claim supporting GL_EXT_texture_rg</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93180">Bug 93180</a> - [regression] arb_separate_shader_objects.active sampler conflict fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93235">Bug 93235</a> - [regression] dispatch sanity broken by GetPointerv</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93266">Bug 93266</a> - gl_arb_shading_language_420pack does not allow binding of image variables</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<li>MPEG4 decoding has been disabled by default in the VAAPI driver</li>
-
-</div>
-</body>
-</html>

docs/relnotes/11.1.1.html

@@ -1,197 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.1.1 Release Notes / January 13, 2016</h1>
-
-<p>
-Mesa 11.1.1 is a bug fix release which fixes bugs found since the 11.1.0 release.
-</p>
-<p>
-Mesa 11.1.1 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-b15089817540ba0bffd0aad323ecf3a8ff6779568451827c7274890b4a269d58  mesa-11.1.1.tar.gz
-64db074fc514136b5fb3890111f0d50604db52f0b1e94ba3fcb0fe8668a7fd20  mesa-11.1.1.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91806">Bug 91806</a> - configure does not test whether assembler supports sse4.1</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92229">Bug 92229</a> - [APITRACE] SOMA have serious graphical errors</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92233">Bug 92233</a> - Unigine Heaven 4.0 silhuette run</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93004">Bug 93004</a> - Guild Wars 2 crash on nouveau DX11 cards</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93215">Bug 93215</a> - [Regression bisected] Ogles1conform Automatic mipmap generation test is fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93257">Bug 93257</a> - [SKL, bisected] ASTC dEQP tests segfault</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Brian Paul (1):</p>
-<ul>
-  <li>st/mesa: check state-&gt;mesa in early return check in st_validate_state()</li>
-</ul>
-
-<p>Dave Airlie (6):</p>
-<ul>
-  <li>mesa/varray: set double arrays to non-normalised.</li>
-  <li>mesa/shader: return correct attribute location for double matrix arrays</li>
-  <li>glsl: pass stage into mark function</li>
-  <li>glsl/fp64: add helper for dual slot double detection.</li>
-  <li>glsl: fix count_attribute_slots to allow for different 64-bit handling</li>
-  <li>glsl: only update doubles inputs for vertex inputs.</li>
-</ul>
-
-<p>Emil Velikov (4):</p>
-<ul>
-  <li>docs: add sha256 checksums for 11.0.1</li>
-  <li>cherry-ignore: drop the "re-enable" DCC on Stoney</li>
-  <li>cherry-ignore: don't pick a specific i965 formats patch</li>
-  <li>Update version to 11.1.1</li>
-</ul>
-
-<p>Eric Anholt (2):</p>
-<ul>
-  <li>vc4: Warn instead of abort()ing on exec ioctl failures.</li>
-  <li>vc4: Keep sample mask writes from being reordered after TLB writes</li>
-</ul>
-
-<p>Grazvydas Ignotas (1):</p>
-<ul>
-  <li>r600: fix constant buffer size programming</li>
-</ul>
-
-<p>Ian Romanick (1):</p>
-<ul>
-  <li>meta/generate_mipmap: Work-around GLES 1.x problem with GL_DRAW_FRAMEBUFFER</li>
-</ul>
-
-<p>Ilia Mirkin (9):</p>
-<ul>
-  <li>nv50/ir: can't have predication and immediates</li>
-  <li>gk104/ir: simplify and fool-proof texbar algorithm</li>
-  <li>glsl: assign varying locations to tess shaders when doing SSO</li>
-  <li>glx/dri3: a drawable might not be bound at wait time</li>
-  <li>nvc0: don't forget to reset VTX_TMP bufctx slot after blit completion</li>
-  <li>nv50/ir: float(s32 &amp; 0xff) = float(u8), not s8</li>
-  <li>nv50,nvc0: make sure there's pushbuf space and that we ref the bo early</li>
-  <li>nv50,nvc0: fix crash when increasing bsp bo size for h264</li>
-  <li>nvc0: scale up inter_bo size so that it's 16M for a 4K video</li>
-</ul>
-
-<p>Jonathan Gray (2):</p>
-<ul>
-  <li>configure.ac: use pkg-config for libelf</li>
-  <li>configure: check for python2.7 for PYTHON2</li>
-</ul>
-
-<p>Kenneth Graunke (5):</p>
-<ul>
-  <li>ralloc: Fix ralloc_adopt() to the old context's last child's parent.</li>
-  <li>drirc: Disable ARB_blend_func_extended for Heaven 4.0/Valley 1.0.</li>
-  <li>glsl: Fix varying struct locations when varying packing is disabled.</li>
-  <li>nvc0: Set winding order regardless of domain.</li>
-  <li>nir: Add a lower_fdiv option, turn fdiv into fmul/frcp.</li>
-</ul>
-
-<p>Marek Olšák (7):</p>
-<ul>
-  <li>tgsi/scan: add flag colors_written</li>
-  <li>r600g: write all MRTs only if there is exactly one output (fixes a hang)</li>
-  <li>radeonsi: don't call of u_prims_for_vertices for patches and rectangles</li>
-  <li>radeonsi: apply the streamout workaround to Fiji as well</li>
-  <li>gallium/radeon: fix Hyper-Z hangs by programming PA_SC_MODE_CNTL_1 correctly</li>
-  <li>program: add _mesa_reserve_parameter_storage</li>
-  <li>st/mesa: fix GLSL uniform updates for glBitmap &amp; glDrawPixels (v2)</li>
-</ul>
-
-<p>Mark Janes (1):</p>
-<ul>
-  <li>Add missing platform information for KBL</li>
-</ul>
-
-<p>Miklós Máté (1):</p>
-<ul>
-  <li>mesa: Don't leak ATIfs instructions in DeleteFragmentShader</li>
-</ul>
-
-<p>Neil Roberts (3):</p>
-<ul>
-  <li>i965: Add MESA_FORMAT_B8G8R8X8_SRGB to brw_format_for_mesa_format</li>
-  <li>i965: Add B8G8R8X8_SRGB to the alpha format override</li>
-  <li>i965: Fix crash when calling glViewport with no surface bound</li>
-</ul>
-
-<p>Nicolai Hähnle (2):</p>
-<ul>
-  <li>gallium/radeon: only dispose locally created target machine in radeon_llvm_compile</li>
-  <li>gallium/radeon: fix regression in a number of driver queries</li>
-</ul>
-
-<p>Oded Gabbay (1):</p>
-<ul>
-  <li>configura.ac: fix test for SSE4.1 assembler support</li>
-</ul>
-
-<p>Patrick Rudolph (2):</p>
-<ul>
-  <li>nv50,nvc0: fix use-after-free when vertex buffers are unbound</li>
-  <li>gallium/util: return correct number of bound vertex buffers</li>
-</ul>
-
-<p>Rob Herring (1):</p>
-<ul>
-  <li>freedreno/ir3: fix 32-bit builds with pointer-to-int-cast error enabled</li>
-</ul>
-
-<p>Samuel Pitoiset (3):</p>
-<ul>
-  <li>nvc0: free memory allocated by the prog which reads MP perf counters</li>
-  <li>nv50,nvc0: free memory allocated by performance metrics</li>
-  <li>nv50: free memory allocated by the prog which reads MP perf counters</li>
-</ul>
-
-<p>Sarah Sharp (1):</p>
-<ul>
-  <li>mesa: Add KBL PCI IDs and platform information.</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/11.1.2.html

@@ -1,182 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.1.2 Release Notes / February 10, 2016</h1>
-
-<p>
-Mesa 11.1.2 is a bug fix release which fixes bugs found since the 11.1.1 release.
-</p>
-<p>
-Mesa 11.1.2 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-ba0e7462b2936b86e6684c26fbb55519f8d9ad31d13a1c1e1afbe41e73466eea  mesa-11.1.2.tar.gz
-8f72aead896b340ba0f7a4a474bfaf71681f5d675592aec1cb7ba698e319148b  mesa-11.1.2.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91596">Bug 91596</a> - EGL_KHR_gl_colorspace (v2) causes problem with Android-x86 GUI</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93628">Bug 93628</a> - Exception: attempt to use unavailable module DRM when building MesaGL 11.1.0 on windows</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93648">Bug 93648</a> - Random lines being rendered when playing Dolphin (geometry shaders related, w/ apitrace)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93650">Bug 93650</a> - GL_ARB_separate_shader_objects is buggy (PCSX2)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93717">Bug 93717</a> - Meta mipmap generation can corrupt texture state</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93722">Bug 93722</a> - Segfault when compiling shader with a subroutine that takes a parameter</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93731">Bug 93731</a> - glUniformSubroutinesuiv segfaults when subroutine uniform is bound to a specific location</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93761">Bug 93761</a> - A conditional discard in a fragment shader causes no depth writing at all</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Ben Widawsky (1):</p>
-<ul>
-  <li>i965/bxt: Fix conservative wm thread counts.</li>
-</ul>
-
-<p>Dave Airlie (1):</p>
-<ul>
-  <li>glsl: fix subroutine lowering reusing actual parmaters</li>
-</ul>
-
-<p>Emil Velikov (6):</p>
-<ul>
-  <li>docs: add sha256 checksums for 11.1.1</li>
-  <li>cherry-ignore: drop the i965/kbl .num_slices patch</li>
-  <li>i915: correctly parse/set the context flags</li>
-  <li>targets/dri: android: use WHOLE static libraries</li>
-  <li>egl/dri2: expose srgb configs when KHR_gl_colorspace is available</li>
-  <li>Update version to 11.1.2</li>
-</ul>
-
-<p>Eric Anholt (2):</p>
-<ul>
-  <li>vc4: Don't record the seqno of a failed job submit.</li>
-  <li>vc4: Throttle outstanding rendering after submission.</li>
-</ul>
-
-<p>François Tigeot (1):</p>
-<ul>
-  <li>gallium: Add DragonFly support</li>
-</ul>
-
-<p>Grazvydas Ignotas (1):</p>
-<ul>
-  <li>r600g: don't leak driver const buffers</li>
-</ul>
-
-<p>Ian Romanick (2):</p>
-<ul>
-  <li>meta/blit: Restore GL_DEPTH_STENCIL_TEXTURE_MODE state for GL_TEXTURE_RECTANGLE</li>
-  <li>meta: Use internal functions to set texture parameters</li>
-</ul>
-
-<p>Ilia Mirkin (6):</p>
-<ul>
-  <li>st/mesa: use surface format to generate mipmaps when available</li>
-  <li>glsl: always compute proper varying type, irrespective of varying packing</li>
-  <li>nvc0: avoid crashing when there are holes in vertex array bindings</li>
-  <li>nv50,nvc0: fix buffer clearing to respect engine alignment requirements</li>
-  <li>nv50/ir: fix false global CSE on instructions with multiple defs</li>
-  <li>st/mesa: treat a write as a read for range purposes</li>
-</ul>
-
-<p>Jason Ekstrand (3):</p>
-<ul>
-  <li>i965/vec4: Use UW type for multiply into accumulator on GEN8+</li>
-  <li>i965/fs/generator: Take an actual shader stage rather than a string</li>
-  <li>i965/fs: Always set channel 2 of texture headers in some stages</li>
-</ul>
-
-<p>Jose Fonseca (2):</p>
-<ul>
-  <li>scons: Conditionally use DRM module on pipe-loader.</li>
-  <li>pipe-loader: Fix PATH_MAX define on MSVC.</li>
-</ul>
-
-<p>Karol Herbst (1):</p>
-<ul>
-  <li>nv50/ir: fix memory corruption when spilling and redoing RA</li>
-</ul>
-
-<p>Kenneth Graunke (2):</p>
-<ul>
-  <li>glsl: Make bitfield_insert/extract and bfi/bfm non-vectorizable.</li>
-  <li>glsl: Allow implicit int -&gt; uint conversions for bitwise operators (&amp;, ^, |).</li>
-</ul>
-
-<p>Leo Liu (2):</p>
-<ul>
-  <li>vl: add zig zag scan for list 4x4</li>
-  <li>st/omx/dec/h264: fix corruption when scaling matrix present flag set</li>
-</ul>
-
-<p>Marek Olšák (1):</p>
-<ul>
-  <li>radeonsi: don't miss changes to SPI_TMPRING_SIZE</li>
-</ul>
-
-<p>Nicolai Hähnle (11):</p>
-<ul>
-  <li>mesa/bufferobj: make _mesa_delete_buffer_object externally accessible</li>
-  <li>st/mesa: use _mesa_delete_buffer_object</li>
-  <li>radeon: use _mesa_delete_buffer_object</li>
-  <li>i915: use _mesa_delete_buffer_object</li>
-  <li>i965: use _mesa_delete_buffer_object</li>
-  <li>util/u_pstipple.c: copy immediates during transformation</li>
-  <li>radeonsi: extract the VGT_GS_MODE calculation into its own function</li>
-  <li>radeonsi: ensure that VGT_GS_MODE is sent when necessary</li>
-  <li>radeonsi: add DCC buffer for sampler views on new CS</li>
-  <li>st/mesa: use the correct address generation functions in st_TexSubImage blit</li>
-  <li>radeonsi: fix discard-only fragment shaders (11.1 version)</li>
-</ul>
-
-<p>Timothy Arceri (4):</p>
-<ul>
-  <li>glsl: fix segfault linking subroutine uniform with explicit location</li>
-  <li>mesa: fix segfault in glUniformSubroutinesuiv()</li>
-  <li>glsl: fix interface block error message</li>
-  <li>glsl: create helper to remove outer vertex index array used by some stages</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/11.2.0.html

@@ -1,296 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.2.0 Release Notes / 4 April 2016</h1>
-
-<p>
-Mesa 11.2.0 is a new development release.
-People who are concerned with stability and reliability should stick
-with a previous release or wait for Mesa 11.2.1.
-</p>
-<p>
-Mesa 11.2.0 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-dea3d8143929aad5c24ef0993ddb05807b30c284b488fc62903adfcc1c127887  mesa-11.2.0.tar.gz
-1c1fed2674abf3f16ed2623e9a5694d6752c293194e18462ebc644a19cfaafb2  mesa-11.2.0.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-
-<p>
-Note: some of the new features are only available with certain drivers.
-</p>
-
-<ul>
-<li>GL_ARB_arrays_of_arrays on all gallium drivers that provide GLSL 1.30</li>
-<li>GL_ARB_base_instance on freedreno/a4xx</li>
-<li>GL_ARB_compute_shader on i965</li>
-<li>GL_ARB_copy_image on r600</li>
-<li>GL_ARB_indirect_parameters on nvc0</li>
-<li>GL_ARB_query_buffer_object on nvc0</li>
-<li>GL_ARB_shader_atomic_counters on nvc0</li>
-<li>GL_ARB_shader_draw_parameters on i965, nvc0</li>
-<li>GL_ARB_shader_storage_buffer_object on nvc0</li>
-<li>GL_ARB_tessellation_shader on i965 and r600 (evergreen/cayman only)</li>
-<li>GL_ARB_texture_buffer_object_rgb32 on freedreno/a4xx</li>
-<li>GL_ARB_texture_buffer_range on freedreno/a4xx</li>
-<li>GL_ARB_texture_query_lod on freedreno/a4xx</li>
-<li>GL_ARB_texture_rgb10_a2ui on freedreno/a4xx</li>
-<li>GL_ARB_texture_view on freedreno/a4xx</li>
-<li>GL_ARB_vertex_type_10f_11f_11f_rev on freedreno/a4xx</li>
-<li>GL_KHR_texture_compression_astc_ldr on freedreno/a4xx</li>
-<li>GL_AMD_performance_monitor on radeonsi (CIK+ only)</li>
-<li>GL_ATI_meminfo on r600, radeonsi</li>
-<li>GL_NVX_gpu_memory_info on r600, radeonsi</li>
-<li>New OSMesaCreateContextAttribs() function (for creating core profile
-    contexts)</li>
-</ul>
-
-<h2>Bug fixes</h2>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=27512">Bug 27512</a> - Illegal instruction _mesa_x86_64_transform_points4_general</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=75165">Bug 75165</a> - compute.c:464:49: error: function definition is not allowed here</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79783">Bug 79783</a> - Distorted output in obs-studio where other vendors &quot;work&quot;</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89330">Bug 89330</a> - piglit glsl-1.50 invariant-qualifier-in-out-block-01 regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89969">Bug 89969</a> - nouveau: add support for chunk decoding in order to support vaapi (st/va)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90348">Bug 90348</a> - Spilling failure of b96 merged value</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91526">Bug 91526</a> - World of Warcraft (on Wine) has UI corruption with nouveau</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91596">Bug 91596</a> - EGL_KHR_gl_colorspace (v2) causes problem with Android-x86 GUI</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91806">Bug 91806</a> - configure does not test whether assembler supports sse4.1</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91927">Bug 91927</a> - [SKL] [regression] piglit compressed textures tests fail  with kernel upgrade</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92193">Bug 92193</a> - [SKL] ES2-CTS.gtf.GL2ExtensionTests.compressed_astc_texture.compressed_astc_texture fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92229">Bug 92229</a> - [APITRACE] SOMA have serious graphical errors</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92233">Bug 92233</a> - Unigine Heaven 4.0 silhuette run</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92363">Bug 92363</a> - [BSW/BDW] ogles1conform Gets test fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92438">Bug 92438</a> - Segfault in pushbuf_kref when running the android emulator (qemu) on nv50</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92589">Bug 92589</a> - [BDW BSW SKL CTS] ES31-CTS.texture_gather.* GPU_HANG</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92595">Bug 92595</a> - [HSW,BDW,SKL][GLES 3.1 CTS] Big difference in the results for the ES31-CTS.shader_bitfield_operation.* tests</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92609">Bug 92609</a> - [BDW, BSW] piglit sampling-2d-array-as-2d-layer fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92687">Bug 92687</a> - Add support for ARB_internalformat_query2</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92706">Bug 92706</a> - glBlitFramebuffer refuses to blit RGBA to RGB with MSAA</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92709">Bug 92709</a> - &quot;LLVM triggered Diagnostic Handler: unsupported call to function ldexpf in main&quot; when starting race in stuntrally</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92743">Bug 92743</a> - Centroid shouldn't have to match between the FS and the VS</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92759">Bug 92759</a> - [Regression, bisected] Visuals without alpha bits are not sRGB-capable</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92849">Bug 92849</a> - [IVB HSW BDW] piglit image load/store load-from-cleared-image.shader_test fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92909">Bug 92909</a> - Offset/alignment issue with layout std140 and vec3</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93004">Bug 93004</a> - Guild Wars 2 crash on nouveau DX11 cards</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93048">Bug 93048</a> - [CTS regression] mesa af2723 breaks GL Conformance for debug extension</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93063">Bug 93063</a> - drm_helper.h:227:1: error: static declaration of ‘pipe_virgl_create_screen’ follows non-static declaration</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93091">Bug 93091</a> - [opencl] segfault when running any opencl programs (like clinfo)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93092">Bug 93092</a> - lp_test_format regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93126">Bug 93126</a> - wrongly claim supporting GL_EXT_texture_rg</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93180">Bug 93180</a> - [regression] arb_separate_shader_objects.active sampler conflict fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93189">Bug 93189</a> - &quot;./util/u_inlines.h&quot;, line 83: operands have incompatible types: void &quot;:&quot; int</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93215">Bug 93215</a> - [Regression bisected] Ogles1conform Automatic mipmap generation test is fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93235">Bug 93235</a> - [regression] dispatch sanity broken by GetPointerv</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93257">Bug 93257</a> - [SKL, bisected] ASTC dEQP tests segfault</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93264">Bug 93264</a> - Tonga VM Faults since llvm ScheduleDAGInstrs: Rework schedule graph builder.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93266">Bug 93266</a> - gl_arb_shading_language_420pack does not allow binding of image variables</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93300">Bug 93300</a> - Two Worlds 2 renders water incorrectly</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93312">Bug 93312</a> - [SKL][GLES 3.1 CTS] ES31-CTS.layout_binding* GPU_HANG</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93320">Bug 93320</a> - [HSW,BDW,SKL][GLES 3.1 CTS] ES31-CTS.vertex_attrib_binding.advanced-bindingUpdate fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93322">Bug 93322</a> - [HSW,BDW,SKL][GLES 3.1 CTS] ES31-CTS.compute_shader.resource-ubo fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93323">Bug 93323</a> - [HSW,BDW,SKL][GLES 3.1 CTS]ES31-CTS.shader_image_load_store.basic-allTargets-store-fs fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93325">Bug 93325</a> - [HSW,BDW,SKL]ES31-CTS.explicit_uniform_location.uniform-loc-* 2 tests fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93339">Bug 93339</a> - glLinkProgram() should fail when a varying is never written to in a previous stage</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93348">Bug 93348</a> - [HSW,BDW,SKL][GLES 3.1 CTS] ES31-CTS.compute_shader.* segfault</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93358">Bug 93358</a> - [HSW] Unreal Elemental demo - assertion error in copy_image_with_blitter</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93387">Bug 93387</a> - inverse() shouldn’t be exposed in GLSL 1.20 and 1.30</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93388">Bug 93388</a> - [i965, regression, bisection] MESA_FORMAT_B8G8R8X8_SRGB changes break kwin</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93407">Bug 93407</a> - [SKL][GLES 3.1 CTS]ES31-CTS.compute_shader.resources-texture fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93410">Bug 93410</a> - [BDW,SKL][GLES 3.1 CTS]ES31-CTS.shader_image_load_store.negative-linkErrors fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93418">Bug 93418</a> - Geometry Shaders output wrong vertices on Sandy Bridge</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93426">Bug 93426</a> - [SKL,BDW,BSW,BXT] CTS regression: es2-cts.gtf.gl2fixedtests.buffer_objects.buffer_object,s</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93524">Bug 93524</a> - Clover doesn't build</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93526">Bug 93526</a> - GfxBench 4 tessellation demos misrender</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93532">Bug 93532</a> - [HSW,BDW,SKL][GLES 3.1 CTS] ES31-CTS.compute_shader.*. Regression, bisected.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93540">Bug 93540</a> - [BISECTED, HSW] Rendering issue in Heaven (and other benchmarks)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93560">Bug 93560</a> - opt_combine_constants failing fabsf(reg-&gt;f) == table.imm[i].val assertion</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93599">Bug 93599</a> - Strange green flashes with &quot;Metro: Last Light Redux&quot; + &quot;Metro 2033 Redux&quot; with Intel Mesa driver</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93648">Bug 93648</a> - Random lines being rendered when playing Dolphin (geometry shaders related, w/ apitrace)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93650">Bug 93650</a> - GL_ARB_separate_shader_objects is buggy (PCSX2)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93667">Bug 93667</a> - Crash in eglCreateImageKHR with huge texture size</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93696">Bug 93696</a> - [HSW,BDW;SKL][GLES 3.1 CTS]ES31-CTS.explicit_uniform_location.uniform-loc-mix-with-implicit-max-* fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93700">Bug 93700</a> - [SKL, regression] deqp-gles2.functional.texture.completeness</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93717">Bug 93717</a> - Meta mipmap generation can corrupt texture state</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93722">Bug 93722</a> - Segfault when compiling shader with a subroutine that takes a parameter</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93725">Bug 93725</a> - [HSW, regression, bisected] ES31-CTS.texture_gather.*depth*</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93731">Bug 93731</a> - glUniformSubroutinesuiv segfaults when subroutine uniform is bound to a specific location</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93761">Bug 93761</a> - A conditional discard in a fragment shader causes no depth writing at all</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93790">Bug 93790</a> - [HSW] Use after free with compute programs</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93792">Bug 93792</a> - [HSW] intel_mipmap_tree.c:1325: intel_miptree_copy_slice: Assertion `src_mt-&gt;format == dst_mt-&gt;format</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93813">Bug 93813</a> - Incorrect viewport range when GL_CLIP_ORIGIN is GL_UPPER_LEFT</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93840">Bug 93840</a> - [i965] Alien: Isolation fails with GL_ARB_compute_shader enabled</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93862">Bug 93862</a> - [Bisected] &quot;drm/amdgpu: fix amdgpu_bo_pin_restricted VRAM placing v2&quot; is bad</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93878">Bug 93878</a> - [llvmpipe][softpipe] piglit arb_gpu_shader_fp64-double-gettransformfeedbackvarying regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93957">Bug 93957</a> - [HSW] Mishandling of sample count when using an attachment-less framebuffer (assertion error)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93961">Bug 93961</a> - virgl build failure after 2016-02-01 changes - no previous prototype for 'virgl_drm_winsys_create'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93962">Bug 93962</a> - [HSW, regression, bisected, CTS] ES2-CTS.gtf.GL2FixedTests.scissor.scissor - segfault/asserts</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93989">Bug 93989</a> - build: flex-2.5.39 seems to be failing for glsl_lexer.ll</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94016">Bug 94016</a> - make check MesaExtensionsTest.AlphabeticallySorted regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94019">Bug 94019</a> - [bisected] 3D acceleration broken with gallium/radeon: just get num_tile_pipes from the winsys</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94050">Bug 94050</a> - test_vec4_register_coalesce regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94073">Bug 94073</a> - Miscompilation of abs_vec3_vert_xvary_ref.vert in WebGL conformance</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94081">Bug 94081</a> - [HSW] compute shader shared var + atomic op = fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94088">Bug 94088</a> - [llvmpipe] SIGFPE pthread_barrier_destroy.c:40</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94091">Bug 94091</a> - Tonga unreal elemental segfault since radeonsi: put image, fmask, and sampler descriptors into one array</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94100">Bug 94100</a> - [HSW] compute indirect dispatch with 0 work groups causes gpu hang</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94134">Bug 94134</a> - [regression] piglit.spec.arb_texture_view.sampling-2d-array-as-2d-layer assertion</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94139">Bug 94139</a> - [regression, HSW, IVB] piglit.spec.arb_compute_shader.minmax</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94150">Bug 94150</a> - UE4 Suntemple rendering errors</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94186">Bug 94186</a> - Crash when launching glxinfo and World of Warcraft with RV790</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94188">Bug 94188</a> - define (or undef) defined behaves stupidly</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94193">Bug 94193</a> - [llvmpipe] Line antialiasing looks different when GL_LINE_STIPPLE is enabled with pattern 0xffff</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94199">Bug 94199</a> - Shader abort/crash</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94253">Bug 94253</a> - [llvmpipe] piglit gl-1.0-swapbuffers-behavior regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94254">Bug 94254</a> - [llvmpipe] [softpipe] piglit read-front regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94257">Bug 94257</a> - [softpipe] piglit glx-copy-sub-buffer regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94274">Bug 94274</a> - [swrast] piglit arb_occlusion_query2-render regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94284">Bug 94284</a> - [radeonsi] outlast segfault on start</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94388">Bug 94388</a> - r600_blit.c:281: r600_decompress_depth_textures: Assertion `tex-&gt;is_depth &amp;&amp; !tex-&gt;is_flushing_texture' failed.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94412">Bug 94412</a> - Trine 3 misrender</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94481">Bug 94481</a> - softpipe - access violation in img_filter_2d_nearest</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94524">Bug 94524</a> - Wrong gl_TessLevelOuter interpretation for isolines</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94595">Bug 94595</a> - [Mesa AMD&amp;swrast] Texture views attached as framebuffers return their viewed tecture's color encoding and render incorrectly</li>
-
-</ul>
-
-<h2>Changes</h2>
-
-Microsoft Visual Studio 2013 or later is now required for building
-on Windows.
-Previously, Visual Studio 2008 and later were supported.
-
-TBD.
-
-</div>
-</body>
-</html>

docs/relnotes/11.2.1.html

@@ -1,119 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.2.1 Release Notes / April 17, 2016</h1>
-
-<p>
-Mesa 11.2.1 is a bug fix release which fixes bugs found since the 11.2.0 release.
-</p>
-<p>
-Mesa 11.2.1 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-cc2a024204564a71acc95cf262bf618fe49b1d77d351e5755eea705cadac5167  mesa-11.2.1.tar.gz
-a65207e9ae5c5f1c29f863c6a2cc98a7ab99762a24b82a248337f0ea9cfce01b  mesa-11.2.1.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93962">Bug 93962</a> - [HSW, regression, bisected, CTS] ES2-CTS.gtf.GL2FixedTests.scissor.scissor - segfault/asserts</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Brian Paul (2):</p>
-<ul>
-  <li>st/mesa: fix glReadBuffer() assertion failure</li>
-  <li>st/mesa: fix memleak in glDrawPixels cache code</li>
-</ul>
-
-<p>Christian Schmidbauer (1):</p>
-<ul>
-  <li>st/nine: specify WINAPI only for i386 and amd64</li>
-</ul>
-
-<p>Emil Velikov (3):</p>
-<ul>
-  <li>docs: add sha256 checksums for 11.2.0</li>
-  <li>configure.ac: update the path of the generated files</li>
-  <li>Update version to 11.2.1</li>
-</ul>
-
-<p>Ilia Mirkin (1):</p>
-<ul>
-  <li>glsl: allow usage of the keyword buffer before GLSL 430 / ESSL 310</li>
-</ul>
-
-<p>Iurie Salomov (1):</p>
-<ul>
-  <li>va: check null context in vlVaDestroyContext</li>
-</ul>
-
-<p>Jason Ekstrand (2):</p>
-<ul>
-  <li>i965/tiled_memcopy: Add aligned mem_copy parameters to the [de]tiling functions</li>
-  <li>i965/tiled_memcpy: Rework the RGBA -&gt; BGRA mem_copy functions</li>
-</ul>
-
-<p>Kenneth Graunke (3):</p>
-<ul>
-  <li>i965: Fix textureSize() depth value for 1 layer surfaces on Gen4-6.</li>
-  <li>i965: Use brw-&gt;urb.min_vs_urb_entries instead of 32 for BLORP.</li>
-  <li>glsl: Lower variable indexing of system value arrays unconditionally.</li>
-</ul>
-
-<p>Marek Olšák (1):</p>
-<ul>
-  <li>drirc: add a workaround for blackness in Warsow</li>
-</ul>
-
-<p>Nicolai Hähnle (1):</p>
-<ul>
-  <li>radeonsi: fix bounds check in si_create_vertex_elements</li>
-</ul>
-
-<p>Samuel Pitoiset (1):</p>
-<ul>
-  <li>nv50/ir: do not try to attach JOIN ops to ATOM</li>
-</ul>
-
-<p>Thomas Hindoe Paaboel Andersen (1):</p>
-<ul>
-  <li>st/va: avoid dereference after free in vlVaDestroyImage</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/11.2.2.html

@@ -1,209 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 11.2.2 Release Notes / May 9, 2016</h1>
-
-<p>
-Mesa 11.2.2 is a bug fix release which fixes bugs found since the 11.2.1 release.
-</p>
-<p>
-Mesa 11.2.2 implements the OpenGL 4.1 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 4.1.  OpenGL
-4.1 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-TBD
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92850">Bug 92850</a> - Segfault loading War Thunder</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=93767">Bug 93767</a> - Glitches with soft shadows and MSAA in Knights of the Old Republic 2</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94955">Bug 94955</a> - Uninitialized variables leads to random segfaults (valgrind log, apitrace attached)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=94994">Bug 94994</a> - OSMesaGetProcAdress always fails on mangled OSMesa</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=95026">Bug 95026</a> - Alien Isolation segfault after initial loading screen/video</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=95133">Bug 95133</a> - X-COM Enemy Within crashes when entering tactical mission with Bonaire</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=95164">Bug 95164</a> - GLSL compiler (linker I think) emits assertion upon call to glAttachShader</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=95251">Bug 95251</a> - vdpau decoder capabilities: not supported</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Boyuan Zhang (1):</p>
-<ul>
-  <li>radeon/uvd: alignment fix for decode message buffer</li>
-</ul>
-
-<p>Brian Paul (2):</p>
-<ul>
-  <li>st/mesa: fix sampler view leak in st_DrawAtlasBitmaps()</li>
-  <li>gallium/util: initialize pipe_framebuffer_state to zeros</li>
-</ul>
-
-<p>Chad Versace (1):</p>
-<ul>
-  <li>dri: Fix robust context creation via EGL attribute</li>
-</ul>
-
-<p>Egbert Eich (1):</p>
-<ul>
-  <li>dri2: Check for dummyContext to see if the glx_context is valid</li>
-</ul>
-
-<p>Emil Velikov (5):</p>
-<ul>
-  <li>docs: add sha256 checksums for 11.2.1</li>
-  <li>docs: update the sha256 checksums for 11.2.1</li>
-  <li>cherry-ignore: remove duplicate commit</li>
-  <li>cherry-ignore: ignore the GetSamplerParameterIuiv{EXT,OES} fixups</li>
-  <li>Update version to 11.2.2</li>
-</ul>
-
-<p>Eric Anholt (4):</p>
-<ul>
-  <li>vc4: Fix subimage accesses to LT textures.</li>
-  <li>vc4: Add support for rendering to cube map surfaces.</li>
-  <li>vc4: Fix tests for format supported with nr_samples == 1.</li>
-  <li>vc4: Make sure we recompile when sample_mask changes.</li>
-</ul>
-
-<p>Frederic Devernay (1):</p>
-<ul>
-  <li>glapi: fix _glapi_get_proc_address() for mangled function names</li>
-</ul>
-
-<p>Ilia Mirkin (2):</p>
-<ul>
-  <li>nvc0: fix retrieving query results into buffer for timestamps</li>
-  <li>nouveau/video: properly detect the decoder class for availability checks</li>
-</ul>
-
-<p>Jason Ekstrand (1):</p>
-<ul>
-  <li>i965/fs: Properly report regs_written from SAMPLEINFO</li>
-</ul>
-
-<p>Jonathan Gray (1):</p>
-<ul>
-  <li>egl/x11: authenticate before doing chipset id ioctls</li>
-</ul>
-
-<p>Jose Fonseca (1):</p>
-<ul>
-  <li>winsys/sw/xlib: use correct free function for xlib_dt-&gt;data</li>
-</ul>
-
-<p>Kenneth Graunke (3):</p>
-<ul>
-  <li>i965: Fix clear code for ignoring colormask for XRGB formats on Gen9+.</li>
-  <li>glsl: Convert lower_vec_index_to_swizzle to a rvalue visitor.</li>
-  <li>glsl: Lower vector_extracts to swizzles after lower_vector_derefs.</li>
-</ul>
-
-<p>Leo Liu (1):</p>
-<ul>
-  <li>radeon/uvd: fix tonga feedback buffer size</li>
-</ul>
-
-<p>Marek Olšák (1):</p>
-<ul>
-  <li>st/mesa: fix blit-based GetTexImage for non-finalized textures</li>
-</ul>
-
-<p>Nicolai Hähnle (5):</p>
-<ul>
-  <li>gallium/radeon: handle failure when mapping staging buffer</li>
-  <li>st/glsl_to_tgsi: reduce stack explosion in recursive expression visitor</li>
-  <li>gallium/radeon: fix crash in r600_set_streamout_targets</li>
-  <li>radeonsi: correct NULL-pointer check in si_upload_const_buffer</li>
-  <li>radeonsi: work around an MSAA fast stencil clear problem</li>
-</ul>
-
-<p>Oded Gabbay (4):</p>
-<ul>
-  <li>r600g/radeonsi: send endian info to format translation functions</li>
-  <li>r600g: set endianess of 16/32-bit buffers according to do_endian_swap</li>
-  <li>r600g: use do_endian_swap in color swapping functions</li>
-  <li>r600g: use do_endian_swap in texture swapping function</li>
-</ul>
-
-<p>Patrick Rudolph (1):</p>
-<ul>
-  <li>r600g: fix and optimize tgsi_cmp when using ABS and NEG modifier</li>
-</ul>
-
-<p>Roland Scheidegger (3):</p>
-<ul>
-  <li>llvmpipe: (trivial) initialize src1_alpha var to NULL</li>
-  <li>gallivm: fix bogus argument order to lp_build_sample_mipmap function</li>
-  <li>gallivm: make sampling more robust against bogus coordinates</li>
-</ul>
-
-<p>Samuel Pitoiset (6):</p>
-<ul>
-  <li>gk110/ir: do not overwrite def value with zero for EXCH ops</li>
-  <li>gk110/ir: make use of IMUL32I for all immediates</li>
-  <li>nvc0/ir: fix wrong emission of (a OP b) OP c</li>
-  <li>gk110/ir: add emission for (a OP b) OP c</li>
-  <li>nvc0: reduce GL_MAX_3D_TEXTURE_SIZE to 2048 on Kepler+</li>
-  <li>st/glsl_to_tgsi: fix potential crash when allocating temporaries</li>
-</ul>
-
-<p>Stefan Dirsch (1):</p>
-<ul>
-  <li>dri3: Check for dummyContext to see if the glx_context is valid</li>
-</ul>
-
-<p>Topi Pohjolainen (2):</p>
-<ul>
-  <li>i965/blorp/gen7: Prepare re-using for gen8</li>
-  <li>i965/blorp: Use 8k chunk size for urb allocation</li>
-</ul>
-
-<p>WuZhen (3):</p>
-<ul>
-  <li>tgsi: initialize stack allocated struct</li>
-  <li>winsys/sw/dri: use correct free function for dri_sw_dt-&gt;data</li>
-  <li>android: enable dlopen() on all architectures</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/7.10.html

@@ -1693,7 +1693,7 @@ bc644be551ed585fc4f66c16b64a91c9  MesaGLUT-7.10.tar.gz
   <li>llvmpipe: Special case complementary and identify blend factors in SoA.</li>
   <li>llvmpipe: Make rgb/alpha bland func/factors match, when there is no alpha.</li>
   <li>draw: Prevent clipped vertices overflow.</li>
-  <li>draw: Fulfil the new min_lod/max_lod/lod_bias/border_color dynamic state</li>
+  <li>draw: Fullfil the new min_lod/max_lod/lod_bias/border_color dynamic state</li>
   <li>gallivm: Fetch the lod from the dynamic state when min_lod == max_lod.</li>
   <li>gallivm: Remove dead experimental code.</li>
   <li>llvmpipe: Decouple sampler view and sampler state updates.</li>

docs/relnotes/7.6.html

@@ -48,7 +48,7 @@ c49c19c2bbef4f3b7f1389974dff25f4  MesaGLUT-7.6.zip
 
 <h2>New features</h2>
 <ul>
-<li>OpenVG front-end (state tracker for Gallium).
+<li><a href="../openvg.html">OpenVG</a> front-end (state tracker for Gallium).
 This was written by Zack Rusin at Tungsten Graphics.
 <li>GL_ARB_vertex_array_object and GL_APPLE_vertex_array_object extensions
     (supported in Gallium drivers, Intel DRI drivers, and software drivers)</li>

docs/shading.html

@@ -63,20 +63,6 @@ execution.  These are generally used for debugging.
 Example:  export MESA_GLSL=dump,nopt
 </p>
 
-<p>
-Shaders can be dumped and replaced on runtime for debugging purposes. Mesa 
-needs to be configured with '--with-sha1' to enable this functionality. This 
-feature is not currently supported by SCons build.
-
-This is controlled via following environment variables:
-<ul>
-<li><b>MESA_SHADER_DUMP_PATH</b> - path where shader sources are dumped
-<li><b>MESA_SHADER_READ_PATH</b> - path where replacement shaders are read
-</ul>
-Note, path set must exist before running for dumping or replacing to work. 
-When both are set, these paths should be different so the dumped shaders do 
-not clobber the replacement shaders.
-</p>
 
 <h2 id="support">GLSL Version</h2>
 

docs/sourcetree.html

@@ -133,8 +133,10 @@ each directory.
        <ul>
        <li><b>clover</b> - OpenCL state tracker
        <li><b>dri</b> - Meta state tracker for DRI drivers
+       <li><b>egl</b> - Meta state tracker for EGL drivers
        <li><b>glx</b> - Meta state tracker for GLX
        <li><b>vdpau</b> - VDPAU state tracker
+       <li><b>vega</b> - OpenVG 1.x state tracker
        <li><b>wgl</b> -
        <li><b>xorg</b> - Meta state tracker for Xorg video drivers
        <li><b>xvmc</b> - XvMC state tracker

docs/specs/EXT_shader_samples_identical.txt

@@ -1,176 +0,0 @@
-Name
-
-    EXT_shader_samples_identical
-
-Name Strings
-
-    GL_EXT_shader_samples_identical
-
-Contact
-
-    Ian Romanick, Intel (ian.d.romanick 'at' intel.com)
-
-Contributors
-
-    Chris Forbes, Mesa
-    Magnus Wendt, Intel
-    Neil S. Roberts, Intel
-    Graham Sellers, AMD
-
-Status
-
-    XXX - Not complete yet.
-
-Version
-
-    Last Modified Date: November 19, 2015
-    Revision: 6
-
-Number
-
-    TBD
-
-Dependencies
-
-    OpenGL 3.2, or OpenGL ES 3.1, or ARB_texture_multisample is required.
-
-    This extension is written against the OpenGL 4.5 (Core Profile)
-    Specification
-
-Overview
-
-    Multisampled antialiasing has become a common method for improving the
-    quality of rendered images.  Multisampling differs from supersampling in
-    that the color of a primitive that covers all or part of a pixel is
-    resolved once, regardless of the number of samples covered.  If a large
-    polygon is rendered, the colors of all samples in each interior pixel will
-    be the same.  This suggests a simple compression scheme that can reduce
-    the necessary memory bandwidth requirements.  In one such scheme, each
-    sample is stored in a separate slice of the multisample surface.  An
-    additional multisample control surface (MCS) contains a mapping from pixel
-    samples to slices.
-
-    If all the values stored in the MCS for a particular pixel are the same,
-    then all the samples have the same value.  Applications can take advantage
-    of this information to reduce the bandwidth of reading multisample
-    textures.  A custom multisample resolve filter could optimize resolving
-    pixels where every sample is identical by reading the color once.
-
-    color = texelFetch(sampler, coordinate, 0);
-    if (!textureSamplesIdenticalEXT(sampler, coordinate)) {
-        for (int i = 1; i < MAX_SAMPLES; i++) {
-            vec4 c = texelFetch(sampler, coordinate, i);
-
-            //... accumulate c into color
-
-        }
-    }
-
-New Procedures and Functions
-
-    None.
-
-New Tokens
-
-    None.
-
-Additions to the OpenGL 4.5 (Core Profile) Specification
-
-    None.
-
-Modifications to The OpenGL Shading Language Specification, Version 4.50.5
-
-    Including the following line in a shader can be used to control the
-    language features described in this extension:
-
-        #extension GL_EXT_shader_samples_identical
-
-    A new preprocessor #define is added to the OpenGL Shading Language:
-
-        #define GL_EXT_shader_samples_identical
-
-    Add to the table in section 8.7 "Texture Lookup Functions"
-
-    Syntax:
-
-        bool textureSamplesIdenticalEXT(gsampler2DMS sampler, ivec2 coord)
-
-        bool textureSamplesIdenticalEXT(gsampler2DMSArray sampler,
-                                        ivec3 coord)
-
-    Description:
-
-        Returns true if it can be determined that all samples within the texel
-        of the multisample texture bound to <sampler> at <coord> contain the
-        same values or false if this cannot be determined."
-
-Additions to the AGL/EGL/GLX/WGL Specifications
-
-    None
-
-Errors
-
-    None
-
-New State
-
-    None
-
-New Implementation Dependent State
-
-    None
-
-Issues
-
-    1) What should the new functions be called?
-
-    RESOLVED: textureSamplesIdenticalEXT.  Initially
-    textureAllSamplesIdenticalEXT was considered, but
-    textureSamplesIdenticalEXT is more similar to the existing textureSamples
-    function.
-
-    2) It seems like applications could implement additional optimization if
-       they were provided with raw MCS data.  Should this extension also
-       provide that data?
-
-    There are a number of challenges in providing raw MCS data.  The biggest
-    problem being that the amount of MCS data depends on the number of
-    samples, and that is not known at compile time.  Additionally, without new
-    texelFetch functions, applications would have difficulty utilizing the
-    information.
-
-    Another option is to have a function that returns an array of tuples of
-    sample number and count.  This also has difficulties with the maximum
-    array size not being known at compile time.
-
-    RESOLVED: Do not expose raw MCS data in this extension.
-
-    3) Should this extension also extend SPIR-V?
-
-    RESOLVED: Yes, but this has not yet been written.
-
-    4) Is it possible for textureSamplesIdenticalEXT to report false negatives?
-
-    RESOLVED: Yes.  It is possible that the underlying hardware may not detect
-    that separate writes of the same color to different samples of a pixel are
-    the same.  The shader function is at the whim of the underlying hardware
-    implementation.  It is also possible that a compressed multisample surface
-    is not used.  In that case the function will likely always return false.
-
-Revision History
-
-    Rev  Date        Author    Changes
-    ---  ----------  --------  ---------------------------------------------
-      1  2014/08/20  cforbes   Initial version
-      2  2015/10/23  idr       Change from MESA to EXT.  Rebase on OpenGL 4.5,
-                               and add dependency on OpenGL ES 3.1.  Initial
-                               draft of overview section and issues 1 through
-                               3.
-      3  2015/10/27  idr       Typo fixes.
-      4  2015/11/10  idr       Rename extension from EXT_shader_multisample_compression
-                               to EXT_shader_samples_identical.
-                               Add issue #4.
-      5  2015/11/18  idr       Fix some typos spotted by gsellers.  Change the
-                               name of the name of the function to
-                               textureSamplesIdenticalEXT.
-      6  2015/11/19  idr       Fix more typos spotted by Nicolai Hähnle.

docs/specs/MESA_image_dma_buf_export.txt

@@ -1,147 +0,0 @@
-Name
-
-    MESA_image_dma_buf_export
-
-Name Strings
-
-    EGL_MESA_image_dma_buf_export
-
-Contributors
-
-    Dave Airlie
-
-Contact
-
-    Dave Airlie (airlied 'at' redhat 'dot' com)
-
-Status
-
-    Complete, shipping.
-
-Version
-
-    Version 3, May 5, 2015
-
-Number
-
-    EGL Extension #87
-
-Dependencies
-
-    Requires EGL 1.4 or later.  This extension is written against the
-    wording of the EGL 1.4 specification.
-
-    EGL_KHR_base_image is required.
-
-    The EGL implementation must be running on a Linux kernel supporting the
-    dma_buf buffer sharing mechanism.
-
-Overview
-
-    This extension provides entry points for integrating EGLImage with the
-    dma-buf infrastructure.  The extension allows creating a Linux dma_buf
-    file descriptor or multiple file descriptors, in the case of multi-plane
-    YUV image, from an EGLImage.
-
-    It is designed to provide the complementary functionality to
-    EGL_EXT_image_dma_buf_import.
-
-IP Status
-
-    Open-source; freely implementable.
-
-New Types
-
-    This extension uses the 64-bit unsigned integer type EGLuint64KHR
-    first introduced by the EGL_KHR_stream extension, but does not
-    depend on that extension. The typedef may be reproduced separately
-    for this extension, if not already present in eglext.h.
-
-    typedef khronos_uint64_t EGLuint64KHR;
-
-New Procedures and Functions
-
-    EGLBoolean eglExportDMABUFImageQueryMESA(EGLDisplay dpy,
-                                  EGLImageKHR image,
-				  int *fourcc,
-				  int *num_planes,
-				  EGLuint64KHR *modifiers);
-
-    EGLBoolean eglExportDMABUFImageMESA(EGLDisplay dpy,
-                                        EGLImageKHR image,
-                                        int *fds,
-				        EGLint *strides,
-					EGLint *offsets);
-
-New Tokens
-
-    None
-
-
-Additions to the EGL 1.4 Specification:
-
-    To mirror the import extension, this extension attempts to return
-    enough information to enable an exported dma-buf to be imported
-    via eglCreateImageKHR and EGL_LINUX_DMA_BUF_EXT token.
-
-    Retrieving the information is a two step process, so two APIs
-    are required.
-
-    The first entrypoint
-       EGLBoolean eglExportDMABUFImageQueryMESA(EGLDisplay dpy,
-                                  EGLImageKHR image,
-				  int *fourcc,
-				  int *num_planes,
-				  EGLuint64KHR *modifiers);
-
-    is used to retrieve the pixel format of the buffer, as specified by
-    drm_fourcc.h, the number of planes in the image and the Linux
-    drm modifiers. <fourcc>, <num_planes> and <modifiers> may be NULL,
-    in which case no value is retrieved.
-
-    The second entrypoint retrieves the dma_buf file descriptors,
-    strides and offsets for the image. The caller should pass
-    arrays sized according to the num_planes values retrieved previously.
-    Passing arrays of the wrong size will have undefined results.
-    If the number of fds is less than the number of planes, then
-    subsequent fd slots should contain -1.
-
-        EGLBoolean eglExportDMABUFImageMESA(EGLDisplay dpy,
-                                         EGLImageKHR image,
-					 int *fds,
-                                         EGLint *strides,
-                                         EGLint *offsets);
-
-    <fds>, <strides>, <offsets> can be NULL if the infomatation isn't
-    required by the caller.
-
-Issues
-
-1. Should the API look more like an attribute getting API?
-
-ANSWER: No, from a user interface pov, having to iterate across calling
-the API up to 12 times using attribs seems like the wrong solution.
-
-2. Should the API take a plane and just get the fd/stride/offset for that
-   plane?
-
-ANSWER: UNKNOWN,this might be just as valid an API.
-
-3. Does ownership of the file descriptor remain with the app?
-
-ANSWER: Yes, the app is responsible for closing any fds retrieved.
-
-4. If number of planes and number of fds differ what should we do?
-
-ANSWER: Return -1 for the secondary slots, as this avoids having
-to dup the fd extra times to make the interface sane.
-
-Revision History
-
-    Version 3, May, 2015
-        Just use the KHR 64-bit type.
-    Version 2, March, 2015
-        Add a query interface (Dave Airlie)
-    Version 1, June 3, 2014
-        Initial draft (Dave Airlie)
-

docs/thanks.html

@@ -42,7 +42,9 @@ Tungsten Graphics, Inc. have supported the ongoing development of Mesa.
 <li>The
 <a href="http://www.mesa3d.org">Mesa</a>
 website is hosted by
-<a href="http://sourceforge.net">sourceforge.net</a>.
+<a href="http://sourceforge.net">
+<img src="http://sourceforge.net/sflogo.php?group_id=3&amp;type=1"
+width="88" height="31" align="bottom" alt="Sourceforge.net" border="0"></a>
 <br>
 <br>
 

docs/utilities.html

@@ -30,10 +30,6 @@
   <dt><a href="http://www.valgrind.org">Valgrind</a></dt>
   <dd>is a very useful tool for tracking down
   memory-related problems in your code.</dd>
-
-  <dt><a href="http:scan.coverity.com/projects/mesa">Coverity</a><dt>
-  <dd>provides static code analysis of Mesa.  If you create an account
-  you can see the results and try to fix outstanding issues.</dd>
 </dl>
 
 </div>

docs/versions.html

@@ -150,7 +150,7 @@ New features:
 Changes:
 <ul>
 <li>renamed aux.h as glaux.h (MS-DOS names can't start with aux)
-<li>most filenames are in 8.3 format to accommodate MS-DOS
+<li>most filenames are in 8.3 format to accomodate MS-DOS
 <li>use GLubytes to store arrays of colors instead of GLints
 </ul>
 
@@ -1224,7 +1224,7 @@ Bug fixes:
 </ul>
 Changes:
 <ul>
-<li>max texture units reduced to six to accommodate texture rectangles
+<li>max texture units reduced to six to accomodate texture rectangles
 <li>removed unfinished GL_MESA_sprite_point extension code
 </ul>
 

docs/viewperf.html

@@ -19,7 +19,6 @@
 <p>
 This page lists known issues with
 <a href="http://www.spec.org/gwpg/gpc.static/vp11info.html" target="_main">SPEC Viewperf 11</a>
-and <a href="https://www.spec.org/gwpg/gpc.static/vp12info.html" target="_main">SPEC Viewperf 12</a>
 when running on Mesa-based drivers.
 </p>
 
@@ -41,15 +40,13 @@ These issues have been reported to the SPEC organization in the hope that
 they'll be fixed in the future.
 </p>
 
-<h2><u>Viewperf 11</u></h2>
-
 <p>
-Some of the Viewperf 11 tests use a lot of memory.
+Some of the Viewperf tests use a lot of memory.
 At least 2GB of RAM is recommended.
 </p>
 
 
-<h3>Catia-03 test 2</h3>
+<h2>Catia-03 test 2</h2>
 
 <p>
 This test creates over 38000 vertex buffer objects.  On some systems
@@ -62,7 +59,7 @@ either in Viewperf or the Mesa driver.
 
 
 
-<h3>Catia-03 tests 3, 4, 8</h3>
+<h2>Catia-03 tests 3, 4, 8</h2>
 
 <p>
 These tests use features of the
@@ -82,7 +79,7 @@ Subsequent drawing calls become no-ops and the rendering is incorrect.
 
 
 
-<h3>sw-02 tests 1, 2, 4, 6</h3>
+<h2>sw-02 tests 1, 2, 4, 6</h2>
 
 <p>
 These tests depend on the
@@ -102,7 +99,7 @@ color.  This is probably due to some uninitialized state somewhere.
 
 
 
-<h3>sw-02 test 6</h3>
+<h2>sw-02 test 6</h2>
 
 <p>
 The lines drawn in this test appear in a random color.
@@ -114,7 +111,7 @@ situation, we get a random color.
 
 
 
-<h3>Lightwave-01 test 3</h3>
+<h2>Lightwave-01 test 3</h2>
 
 <p>
 This test uses a number of mipmapped textures, but the textures are
@@ -175,7 +172,7 @@ However, we have no plans to implement this work-around in Mesa.
 </p>
 
 
-<h3>Maya-03 test 2</h3>
+<h2>Maya-03 test 2</h2>
 
 <p>
 This test makes some unusual calls to glRotate.  For example:
@@ -207,7 +204,7 @@ and with a semi-random color (between white and black) since GL_FOG is enabled.
 </p>
 
 
-<h3>Proe-05 test 1</h3>
+<h2>Proe-05 test 1</h2>
 
 <p>
 This uses depth testing but there's two problems:
@@ -235,7 +232,7 @@ glClear is called so clearing the depth buffer would be a no-op anyway.
 </p>
 
 
-<h3>Proe-05 test 6</h3>
+<h2>Proe-05 test 6</h2>
 
 <p>
 This test draws an engine model with a two-pass algorithm.
@@ -264,86 +261,6 @@ blending with appropriate patterns/modes to ensure the same fragments
 are produced in both passes.
 </p>
 
-<h2><u>Viewperf 12</u></h2>
-
-<p>
-Note that Viewperf 12 only runs on 64-bit Windows 7 or later.
-</p>
-
-<h3>catia-04</h3>
-
-<p>
-One of the catia tests calls wglGetProcAddress() to get some
-GL_EXT_direct_state_access functions (such as glBindMultiTextureEXT) and some
-GL_NV_half_float functions (such as glMultiTexCoord3hNV).
-If the extension/function is not supported, wglGetProcAddress() can return NULL.
-Unfortunately, Viewperf doesn't check for null pointers and crashes when it
-later tries to use the pointer.
-</p>
-
-<p>
-Another catia test uses OpenGL 3.1's primitive restart feature.
-But when Viewperf creates an OpenGL context, it doesn't request version 3.1
-If the driver returns version 3.0 or earlier all the calls related to primitive
-restart generate an OpenGL error.
-Some of the rendering is then incorrect.
-</p>
-
-
-<h3>energy-01</h3>
-
-<p>
-This test creates a 3D luminance texture of size 1K x 1K x 1K.
-If the OpenGL driver/device doesn't support a texture of this size
-the glTexImage3D() call will fail with GL_INVALID_VALUE or GL_OUT_OF_MEMORY
-and all that's rendered is plain white polygons.
-Ideally, the test would use a proxy texture to determine the max 3D
-texture size.  But it does not do that.
-</p>
-
-<h3>maya-04</h3>
-
-<p>
-This test generates many GL_INVALID_OPERATION errors in its calls to
-glUniform().
-Causes include:
-<ul>
-<li> Trying to set float uniforms with glUniformi()
-<li> Trying to set float uniforms with glUniform3f()
-<li> Trying to set matrix uniforms with glUniform() instead of glUniformMatrix().
-</ul>
-<p>
-Apparently, the indexes returned by glGetUniformLocation() were hard-coded
-into the application trace when it was created.
-Since different implementations of glGetUniformLocation() may return different
-values for any given uniform name, subsequent calls to glUniform() will be
-invalid since they refer to the wrong uniform variables.
-This causes many OpenGL errors and leads to incorrect rendering.
-</p>
-
-<h3>medical-01</h3>
-
-<p>
-This test uses a single GLSL fragment shader which contains a GLSL 1.20
-array initializer statement, but it neglects to specify
-<code>#version 120</code> at the top of the shader code.
-So, the shader does not compile and all that's rendered is plain white polygons.
-</p>
-<p>
-Also, the test tries to create a very large 3D texture that may exceed
-the device driver's limit.
-When this happens, the glTexImage3D call fails and all that's rendered is
-a white box.
-</p>
-
-
-<h3>showcase-01</h3>
-
-<p>
-This is actually a DX11 test based on Autodesk's Showcase product.
-As such, it won't run with Mesa.
-</p>
-
 
 </div>
 </body>

docs/vmware-guest.html

@@ -26,31 +26,6 @@ VMware Workstation running on Linux or Windows and VMware Fusion running on
 MacOS are all supported.
 </p>
 
-<p>
-With the August 2015 Workstation 12 / Fusion 8 releases, OpenGL 3.3
-is supported in the guest.
-This requires:
-<ul>
-<li>The VM is configured for virtual hardware version 12.
-<li>The host OS, GPU and graphics driver supports DX11 (Windows) or
-    OpenGL 4.0 (Linux, Mac)
-<li>On Linux, the vmwgfx kernel module must be version 2.9.0 or later.
-<li>A recent version of Mesa with the updated svga gallium driver.
-</ul>
-</p>
-
-<p>
-Otherwise, OpenGL 2.1 is supported.
-</p>
-
-<p>
-OpenGL 3.3 support can be disabled by setting the environment variable
-SVGA_VGPU10=0.
-You will then have OpenGL 2.1 support.
-This may be useful to work around application bugs (such as incorrect use
-of the OpenGL 3.x core profile).
-</p>
-
 <p>
 Most modern Linux distros include the SVGA3D driver so end users shouldn't
 be concerned with this information.
@@ -148,33 +123,10 @@ To get the latest code from git:
 <h2>Building the Code</h2>
 
 <ul>
-<li>
-Determine where the GL-related libraries reside on your system and set
-the LIBDIR environment variable accordingly.
-<br><br>
-For 32-bit Ubuntu systems:
-<pre>
-  export LIBDIR=/usr/lib/i386-linux-gnu
-</pre>
-For 64-bit Ubuntu systems:
-<pre>
-  export LIBDIR=/usr/lib/x86_64-linux-gnu
-</pre>
-For 32-bit Fedora systems:
-<pre>
-  export LIBDIR=/usr/lib
-</pre>
-For 64-bit Fedora systems:
-<pre>
-  export LIBDIR=/usr/lib64
-</pre>
-
-</li>
-
-<li>Build libdrm:
+<li>Build libdrm: If you're on a 32-bit system, you should skip the --libdir configure option. Note also the comment about toolchain libdrm above. 
   <pre>
   cd $TOP/drm
-  ./autogen.sh --prefix=/usr --libdir=${LIBDIR}
+  ./autogen.sh --prefix=/usr --libdir=/usr/lib64
   make
   sudo make install
   </pre>
@@ -185,9 +137,12 @@ The libxatracker library is used exclusively by the X server to do render,
 copy and video acceleration:
 <br>
 The following configure options doesn't build the EGL system.
+<br>
+As before, if you're on a 32-bit system, you should skip the --libdir
+configure option.
   <pre>
   cd $TOP/mesa
-  ./autogen.sh --prefix=/usr --libdir=${LIBDIR} --with-gallium-drivers=svga --with-dri-drivers=swrast --enable-xa --disable-dri3 --enable-glx-tls
+  ./autogen.sh --prefix=/usr --libdir=/usr/lib64 --with-gallium-drivers=svga --with-dri-drivers= --enable-xa --disable-dri3
   make
   sudo make install
   </pre>
@@ -197,39 +152,25 @@ if they're not installed in your system.  You should be told what's missing.
 <br>
 <br>
 
-<li>xf86-video-vmware: Now, once libxatracker is installed, we proceed with
-building and replacing the current Xorg driver.
-First check if your system is 32- or 64-bit.
+<li>xf86-video-vmware: Now, once libxatracker is installed, we proceed with building and replacing the current Xorg driver. First check if your system is 32- or 64-bit. If you're building for a 32-bit system, you will not be needing the --libdir=/usr/lib64 option to autogen. 
   <pre>
   cd $TOP/xf86-video-vmware
-  ./autogen.sh --prefix=/usr --libdir=${LIBDIR}
+  ./autogen.sh --prefix=/usr --libdir=/usr/lib64
   make
   sudo make install
   </pre>
-
 <li>vmwgfx kernel module. First make sure that any old version of this kernel module is removed from the system by issuing
-<pre>
+  <pre>
   sudo rm /lib/modules/`uname -r`/kernel/drivers/gpu/drm/vmwgfx.ko*
-</pre>
-Build and install:
-<pre>
+  </pre>
+Then 
+  <pre>
   cd $TOP/vmwgfx
   make
   sudo make install
-  sudo depmod -a
-</pre>
-If you're using a Ubuntu OS:
-<pre>
-  sudo update-initramfs -u
-</pre>
-If you're using a Fedora OS:
-<pre>
-  sudo dracut --force
-</pre>
-Add 'vmwgfx' to the /etc/modules file:
-<pre>
-  echo vmwgfx | sudo tee -a /etc/modules
-</pre>
+  sudo cp 00-vmwgfx.rules /etc/udev/rules.d
+  sudo depmod -ae
+  </pre>
 
 Note: some distros put DRM kernel drivers in different directories.
 For example, sometimes vmwgfx.ko might be found in
@@ -286,16 +227,6 @@ If you don't see this, try setting this environment variable:
 then rerun glxinfo and examine the output for error messages.
 </p>
 
-<p>
-If OpenGL 3.3 is not working (you only get OpenGL 2.1):
-</p>
-<ul>
-<li>Make sure the VM uses hardware version 12.
-<li>Make sure the vmwgfx kernel module is version 2.9.0 or later.
-<li>Check the vmware.log file for errors.
-<li>Run 'dmesg | grep vmwgfx' and look for "DX: yes".
-
-
 </div>
 </body>
 </html>

doxygen/.gitignore

@@ -1,4 +1,3 @@
-*.db
 *.tag
 *.tmp
 agpgart

doxygen/Makefile

@@ -33,4 +33,3 @@ subset: $(SUBSET:.doxy=.tag)
 clean:
 	-rm -rf $(FULL:.doxy=) $(SUBSET:.doxy=)
 	-rm -rf *.tag
-	-rm -rf *.db

include/D3D9/d3d9types.h

@@ -178,17 +178,11 @@ typedef struct _RGNDATA {
 #undef WINAPI
 #endif /* WINAPI*/
 
-#ifdef __GNUC__
-  #if (defined(__x86_64__) && !defined(__ILP32__)) || defined(_M_X64)
-    #define WINAPI __attribute__((ms_abi))
-  #elif defined(__i386) || defined(_M_IX86)
-    #define WINAPI __attribute__((__stdcall__))
-  #else /* neither amd64 nor i386 */
-    #define WINAPI
-  #endif
-#else /* __GNUC__ */
-  #define WINAPI
-#endif
+#if defined(__x86_64__) || defined(_M_X64)
+#define WINAPI __attribute__((ms_abi))
+#else /* x86_64 */
+#define WINAPI __attribute__((__stdcall__))
+#endif /* x86_64 */
 
 /* Implementation caps */
 #define D3DPRESENT_BACK_BUFFERS_MAX    3
@@ -233,7 +227,6 @@ typedef struct _RGNDATA {
 #define D3DERR_DRIVERINVALIDCALL         MAKE_D3DHRESULT(2157)
 #define D3DERR_DEVICEREMOVED             MAKE_D3DHRESULT(2160)
 #define D3DERR_DEVICEHUNG                MAKE_D3DHRESULT(2164)
-#define S_PRESENT_OCCLUDED               MAKE_D3DSTATUS(2168)
 
 /********************************************************
  * Bitmasks                                             *

include/EGL/egl.h

@@ -1,12 +1,11 @@
-#ifndef __egl_h_
-#define __egl_h_ 1
-
-#ifdef __cplusplus
-extern "C" {
-#endif
+/* -*- mode: c; tab-width: 8; -*- */
+/* vi: set sw=4 ts=8: */
+/* Reference version of egl.h for EGL 1.4.
+ * $Revision: 9356 $ on $Date: 2009-10-21 02:52:25 -0700 (Wed, 21 Oct 2009) $
+ */
 
 /*
-** Copyright (c) 2013-2014 The Khronos Group Inc.
+** Copyright (c) 2007-2009 The Khronos Group Inc.
 **
 ** Permission is hereby granted, free of charge, to any person obtaining a
 ** copy of this software and/or associated documentation files (the
@@ -27,277 +26,304 @@ extern "C" {
 ** TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
 ** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS.
 */
-/*
-** This header is generated from the Khronos OpenGL / OpenGL ES XML
-** API Registry. The current version of the Registry, generator scripts
-** used to make the header, and the header can be found at
-**   http://www.opengl.org/registry/
-**
-** Khronos $Revision: 31039 $ on $Date: 2015-05-04 17:01:57 -0700 (Mon, 04 May 2015) $
-*/
 
+#ifndef __egl_h_
+#define __egl_h_
+
+/* All platform-dependent types and macro boilerplate (such as EGLAPI
+ * and EGLAPIENTRY) should go in eglplatform.h.
+ */
 #include <EGL/eglplatform.h>
 
-/* Generated on date 20150504 */
+#ifdef __cplusplus
+extern "C" {
+#endif
 
-/* Generated C header for:
- * API: egl
- * Versions considered: .*
- * Versions emitted: .*
- * Default extensions included: None
- * Additional extensions included: _nomatch_^
- * Extensions removed: _nomatch_^
+/* EGL Types */
+/* EGLint is defined in eglplatform.h */
+typedef unsigned int EGLBoolean;
+typedef unsigned int EGLenum;
+typedef void *EGLConfig;
+typedef void *EGLContext;
+typedef void *EGLDisplay;
+typedef void *EGLSurface;
+typedef void *EGLClientBuffer;
+
+/* EGL Versioning */
+#define EGL_VERSION_1_0			1
+#define EGL_VERSION_1_1			1
+#define EGL_VERSION_1_2			1
+#define EGL_VERSION_1_3			1
+#define EGL_VERSION_1_4			1
+
+/* EGL Enumerants. Bitmasks and other exceptional cases aside, most
+ * enums are assigned unique values starting at 0x3000.
  */
 
-#ifndef EGL_VERSION_1_0
-#define EGL_VERSION_1_0 1
-typedef unsigned int EGLBoolean;
-typedef void *EGLDisplay;
-#include <KHR/khrplatform.h>
-#include <EGL/eglplatform.h>
-typedef void *EGLConfig;
-typedef void *EGLSurface;
-typedef void *EGLContext;
+/* EGL aliases */
+#define EGL_FALSE			0
+#define EGL_TRUE			1
+
+/* Out-of-band handle values */
+#define EGL_DEFAULT_DISPLAY		((EGLNativeDisplayType)0)
+#define EGL_NO_CONTEXT			((EGLContext)0)
+#define EGL_NO_DISPLAY			((EGLDisplay)0)
+#define EGL_NO_SURFACE			((EGLSurface)0)
+
+/* Out-of-band attribute value */
+#define EGL_DONT_CARE			((EGLint)-1)
+
+/* Errors / GetError return values */
+#define EGL_SUCCESS			0x3000
+#define EGL_NOT_INITIALIZED		0x3001
+#define EGL_BAD_ACCESS			0x3002
+#define EGL_BAD_ALLOC			0x3003
+#define EGL_BAD_ATTRIBUTE		0x3004
+#define EGL_BAD_CONFIG			0x3005
+#define EGL_BAD_CONTEXT			0x3006
+#define EGL_BAD_CURRENT_SURFACE		0x3007
+#define EGL_BAD_DISPLAY			0x3008
+#define EGL_BAD_MATCH			0x3009
+#define EGL_BAD_NATIVE_PIXMAP		0x300A
+#define EGL_BAD_NATIVE_WINDOW		0x300B
+#define EGL_BAD_PARAMETER		0x300C
+#define EGL_BAD_SURFACE			0x300D
+#define EGL_CONTEXT_LOST		0x300E	/* EGL 1.1 - IMG_power_management */
+
+/* Reserved 0x300F-0x301F for additional errors */
+
+/* Config attributes */
+#define EGL_BUFFER_SIZE			0x3020
+#define EGL_ALPHA_SIZE			0x3021
+#define EGL_BLUE_SIZE			0x3022
+#define EGL_GREEN_SIZE			0x3023
+#define EGL_RED_SIZE			0x3024
+#define EGL_DEPTH_SIZE			0x3025
+#define EGL_STENCIL_SIZE		0x3026
+#define EGL_CONFIG_CAVEAT		0x3027
+#define EGL_CONFIG_ID			0x3028
+#define EGL_LEVEL			0x3029
+#define EGL_MAX_PBUFFER_HEIGHT		0x302A
+#define EGL_MAX_PBUFFER_PIXELS		0x302B
+#define EGL_MAX_PBUFFER_WIDTH		0x302C
+#define EGL_NATIVE_RENDERABLE		0x302D
+#define EGL_NATIVE_VISUAL_ID		0x302E
+#define EGL_NATIVE_VISUAL_TYPE		0x302F
+#define EGL_SAMPLES			0x3031
+#define EGL_SAMPLE_BUFFERS		0x3032
+#define EGL_SURFACE_TYPE		0x3033
+#define EGL_TRANSPARENT_TYPE		0x3034
+#define EGL_TRANSPARENT_BLUE_VALUE	0x3035
+#define EGL_TRANSPARENT_GREEN_VALUE	0x3036
+#define EGL_TRANSPARENT_RED_VALUE	0x3037
+#define EGL_NONE			0x3038	/* Attrib list terminator */
+#define EGL_BIND_TO_TEXTURE_RGB		0x3039
+#define EGL_BIND_TO_TEXTURE_RGBA	0x303A
+#define EGL_MIN_SWAP_INTERVAL		0x303B
+#define EGL_MAX_SWAP_INTERVAL		0x303C
+#define EGL_LUMINANCE_SIZE		0x303D
+#define EGL_ALPHA_MASK_SIZE		0x303E
+#define EGL_COLOR_BUFFER_TYPE		0x303F
+#define EGL_RENDERABLE_TYPE		0x3040
+#define EGL_MATCH_NATIVE_PIXMAP		0x3041	/* Pseudo-attribute (not queryable) */
+#define EGL_CONFORMANT			0x3042
+
+/* Reserved 0x3041-0x304F for additional config attributes */
+
+/* Config attribute values */
+#define EGL_SLOW_CONFIG			0x3050	/* EGL_CONFIG_CAVEAT value */
+#define EGL_NON_CONFORMANT_CONFIG	0x3051	/* EGL_CONFIG_CAVEAT value */
+#define EGL_TRANSPARENT_RGB		0x3052	/* EGL_TRANSPARENT_TYPE value */
+#define EGL_RGB_BUFFER			0x308E	/* EGL_COLOR_BUFFER_TYPE value */
+#define EGL_LUMINANCE_BUFFER		0x308F	/* EGL_COLOR_BUFFER_TYPE value */
+
+/* More config attribute values, for EGL_TEXTURE_FORMAT */
+#define EGL_NO_TEXTURE			0x305C
+#define EGL_TEXTURE_RGB			0x305D
+#define EGL_TEXTURE_RGBA		0x305E
+#define EGL_TEXTURE_2D			0x305F
+
+/* Config attribute mask bits */
+#define EGL_PBUFFER_BIT			0x0001	/* EGL_SURFACE_TYPE mask bits */
+#define EGL_PIXMAP_BIT			0x0002	/* EGL_SURFACE_TYPE mask bits */
+#define EGL_WINDOW_BIT			0x0004	/* EGL_SURFACE_TYPE mask bits */
+#define EGL_VG_COLORSPACE_LINEAR_BIT	0x0020	/* EGL_SURFACE_TYPE mask bits */
+#define EGL_VG_ALPHA_FORMAT_PRE_BIT	0x0040	/* EGL_SURFACE_TYPE mask bits */
+#define EGL_MULTISAMPLE_RESOLVE_BOX_BIT 0x0200	/* EGL_SURFACE_TYPE mask bits */
+#define EGL_SWAP_BEHAVIOR_PRESERVED_BIT 0x0400	/* EGL_SURFACE_TYPE mask bits */
+
+#define EGL_OPENGL_ES_BIT		0x0001	/* EGL_RENDERABLE_TYPE mask bits */
+#define EGL_OPENVG_BIT			0x0002	/* EGL_RENDERABLE_TYPE mask bits */
+#define EGL_OPENGL_ES2_BIT		0x0004	/* EGL_RENDERABLE_TYPE mask bits */
+#define EGL_OPENGL_BIT			0x0008	/* EGL_RENDERABLE_TYPE mask bits */
+
+/* QueryString targets */
+#define EGL_VENDOR			0x3053
+#define EGL_VERSION			0x3054
+#define EGL_EXTENSIONS			0x3055
+#define EGL_CLIENT_APIS			0x308D
+
+/* QuerySurface / SurfaceAttrib / CreatePbufferSurface targets */
+#define EGL_HEIGHT			0x3056
+#define EGL_WIDTH			0x3057
+#define EGL_LARGEST_PBUFFER		0x3058
+#define EGL_TEXTURE_FORMAT		0x3080
+#define EGL_TEXTURE_TARGET		0x3081
+#define EGL_MIPMAP_TEXTURE		0x3082
+#define EGL_MIPMAP_LEVEL		0x3083
+#define EGL_RENDER_BUFFER		0x3086
+#define EGL_VG_COLORSPACE		0x3087
+#define EGL_VG_ALPHA_FORMAT		0x3088
+#define EGL_HORIZONTAL_RESOLUTION	0x3090
+#define EGL_VERTICAL_RESOLUTION		0x3091
+#define EGL_PIXEL_ASPECT_RATIO		0x3092
+#define EGL_SWAP_BEHAVIOR		0x3093
+#define EGL_MULTISAMPLE_RESOLVE		0x3099
+
+/* EGL_RENDER_BUFFER values / BindTexImage / ReleaseTexImage buffer targets */
+#define EGL_BACK_BUFFER			0x3084
+#define EGL_SINGLE_BUFFER		0x3085
+
+/* OpenVG color spaces */
+#define EGL_VG_COLORSPACE_sRGB		0x3089	/* EGL_VG_COLORSPACE value */
+#define EGL_VG_COLORSPACE_LINEAR	0x308A	/* EGL_VG_COLORSPACE value */
+
+/* OpenVG alpha formats */
+#define EGL_VG_ALPHA_FORMAT_NONPRE	0x308B	/* EGL_ALPHA_FORMAT value */
+#define EGL_VG_ALPHA_FORMAT_PRE		0x308C	/* EGL_ALPHA_FORMAT value */
+
+/* Constant scale factor by which fractional display resolutions &
+ * aspect ratio are scaled when queried as integer values.
+ */
+#define EGL_DISPLAY_SCALING		10000
+
+/* Unknown display resolution/aspect ratio */
+#define EGL_UNKNOWN			((EGLint)-1)
+
+/* Back buffer swap behaviors */
+#define EGL_BUFFER_PRESERVED		0x3094	/* EGL_SWAP_BEHAVIOR value */
+#define EGL_BUFFER_DESTROYED		0x3095	/* EGL_SWAP_BEHAVIOR value */
+
+/* CreatePbufferFromClientBuffer buffer types */
+#define EGL_OPENVG_IMAGE		0x3096
+
+/* QueryContext targets */
+#define EGL_CONTEXT_CLIENT_TYPE		0x3097
+
+/* CreateContext attributes */
+#define EGL_CONTEXT_CLIENT_VERSION	0x3098
+
+/* Multisample resolution behaviors */
+#define EGL_MULTISAMPLE_RESOLVE_DEFAULT 0x309A	/* EGL_MULTISAMPLE_RESOLVE value */
+#define EGL_MULTISAMPLE_RESOLVE_BOX	0x309B	/* EGL_MULTISAMPLE_RESOLVE value */
+
+/* BindAPI/QueryAPI targets */
+#define EGL_OPENGL_ES_API		0x30A0
+#define EGL_OPENVG_API			0x30A1
+#define EGL_OPENGL_API			0x30A2
+
+/* GetCurrentSurface targets */
+#define EGL_DRAW			0x3059
+#define EGL_READ			0x305A
+
+/* WaitNative engines */
+#define EGL_CORE_NATIVE_ENGINE		0x305B
+
+/* EGL 1.2 tokens renamed for consistency in EGL 1.3 */
+#define EGL_COLORSPACE			EGL_VG_COLORSPACE
+#define EGL_ALPHA_FORMAT		EGL_VG_ALPHA_FORMAT
+#define EGL_COLORSPACE_sRGB		EGL_VG_COLORSPACE_sRGB
+#define EGL_COLORSPACE_LINEAR		EGL_VG_COLORSPACE_LINEAR
+#define EGL_ALPHA_FORMAT_NONPRE		EGL_VG_ALPHA_FORMAT_NONPRE
+#define EGL_ALPHA_FORMAT_PRE		EGL_VG_ALPHA_FORMAT_PRE
+
+/* EGL extensions must request enum blocks from the Khronos
+ * API Registrar, who maintains the enumerant registry. Submit
+ * a bug in Khronos Bugzilla against task "Registry".
+ */
+
+
+
+/* EGL Functions */
+
+EGLAPI EGLint EGLAPIENTRY eglGetError(void);
+
+EGLAPI EGLDisplay EGLAPIENTRY eglGetDisplay(EGLNativeDisplayType display_id);
+EGLAPI EGLBoolean EGLAPIENTRY eglInitialize(EGLDisplay dpy, EGLint *major, EGLint *minor);
+EGLAPI EGLBoolean EGLAPIENTRY eglTerminate(EGLDisplay dpy);
+
+EGLAPI const char * EGLAPIENTRY eglQueryString(EGLDisplay dpy, EGLint name);
+
+EGLAPI EGLBoolean EGLAPIENTRY eglGetConfigs(EGLDisplay dpy, EGLConfig *configs,
+			 EGLint config_size, EGLint *num_config);
+EGLAPI EGLBoolean EGLAPIENTRY eglChooseConfig(EGLDisplay dpy, const EGLint *attrib_list,
+			   EGLConfig *configs, EGLint config_size,
+			   EGLint *num_config);
+EGLAPI EGLBoolean EGLAPIENTRY eglGetConfigAttrib(EGLDisplay dpy, EGLConfig config,
+			      EGLint attribute, EGLint *value);
+
+EGLAPI EGLSurface EGLAPIENTRY eglCreateWindowSurface(EGLDisplay dpy, EGLConfig config,
+				  EGLNativeWindowType win,
+				  const EGLint *attrib_list);
+EGLAPI EGLSurface EGLAPIENTRY eglCreatePbufferSurface(EGLDisplay dpy, EGLConfig config,
+				   const EGLint *attrib_list);
+EGLAPI EGLSurface EGLAPIENTRY eglCreatePixmapSurface(EGLDisplay dpy, EGLConfig config,
+				  EGLNativePixmapType pixmap,
+				  const EGLint *attrib_list);
+EGLAPI EGLBoolean EGLAPIENTRY eglDestroySurface(EGLDisplay dpy, EGLSurface surface);
+EGLAPI EGLBoolean EGLAPIENTRY eglQuerySurface(EGLDisplay dpy, EGLSurface surface,
+			   EGLint attribute, EGLint *value);
+
+EGLAPI EGLBoolean EGLAPIENTRY eglBindAPI(EGLenum api);
+EGLAPI EGLenum EGLAPIENTRY eglQueryAPI(void);
+
+EGLAPI EGLBoolean EGLAPIENTRY eglWaitClient(void);
+
+EGLAPI EGLBoolean EGLAPIENTRY eglReleaseThread(void);
+
+EGLAPI EGLSurface EGLAPIENTRY eglCreatePbufferFromClientBuffer(
+	      EGLDisplay dpy, EGLenum buftype, EGLClientBuffer buffer,
+	      EGLConfig config, const EGLint *attrib_list);
+
+EGLAPI EGLBoolean EGLAPIENTRY eglSurfaceAttrib(EGLDisplay dpy, EGLSurface surface,
+			    EGLint attribute, EGLint value);
+EGLAPI EGLBoolean EGLAPIENTRY eglBindTexImage(EGLDisplay dpy, EGLSurface surface, EGLint buffer);
+EGLAPI EGLBoolean EGLAPIENTRY eglReleaseTexImage(EGLDisplay dpy, EGLSurface surface, EGLint buffer);
+
+
+EGLAPI EGLBoolean EGLAPIENTRY eglSwapInterval(EGLDisplay dpy, EGLint interval);
+
+
+EGLAPI EGLContext EGLAPIENTRY eglCreateContext(EGLDisplay dpy, EGLConfig config,
+			    EGLContext share_context,
+			    const EGLint *attrib_list);
+EGLAPI EGLBoolean EGLAPIENTRY eglDestroyContext(EGLDisplay dpy, EGLContext ctx);
+EGLAPI EGLBoolean EGLAPIENTRY eglMakeCurrent(EGLDisplay dpy, EGLSurface draw,
+			  EGLSurface read, EGLContext ctx);
+
+EGLAPI EGLContext EGLAPIENTRY eglGetCurrentContext(void);
+EGLAPI EGLSurface EGLAPIENTRY eglGetCurrentSurface(EGLint readdraw);
+EGLAPI EGLDisplay EGLAPIENTRY eglGetCurrentDisplay(void);
+EGLAPI EGLBoolean EGLAPIENTRY eglQueryContext(EGLDisplay dpy, EGLContext ctx,
+			   EGLint attribute, EGLint *value);
+
+EGLAPI EGLBoolean EGLAPIENTRY eglWaitGL(void);
+EGLAPI EGLBoolean EGLAPIENTRY eglWaitNative(EGLint engine);
+EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffers(EGLDisplay dpy, EGLSurface surface);
+EGLAPI EGLBoolean EGLAPIENTRY eglCopyBuffers(EGLDisplay dpy, EGLSurface surface,
+			  EGLNativePixmapType target);
+
+/* This is a generic function pointer type, whose name indicates it must
+ * be cast to the proper type *and calling convention* before use.
+ */
 typedef void (*__eglMustCastToProperFunctionPointerType)(void);
-#define EGL_ALPHA_SIZE                    0x3021
-#define EGL_BAD_ACCESS                    0x3002
-#define EGL_BAD_ALLOC                     0x3003
-#define EGL_BAD_ATTRIBUTE                 0x3004
-#define EGL_BAD_CONFIG                    0x3005
-#define EGL_BAD_CONTEXT                   0x3006
-#define EGL_BAD_CURRENT_SURFACE           0x3007
-#define EGL_BAD_DISPLAY                   0x3008
-#define EGL_BAD_MATCH                     0x3009
-#define EGL_BAD_NATIVE_PIXMAP             0x300A
-#define EGL_BAD_NATIVE_WINDOW             0x300B
-#define EGL_BAD_PARAMETER                 0x300C
-#define EGL_BAD_SURFACE                   0x300D
-#define EGL_BLUE_SIZE                     0x3022
-#define EGL_BUFFER_SIZE                   0x3020
-#define EGL_CONFIG_CAVEAT                 0x3027
-#define EGL_CONFIG_ID                     0x3028
-#define EGL_CORE_NATIVE_ENGINE            0x305B
-#define EGL_DEPTH_SIZE                    0x3025
-#define EGL_DONT_CARE                     ((EGLint)-1)
-#define EGL_DRAW                          0x3059
-#define EGL_EXTENSIONS                    0x3055
-#define EGL_FALSE                         0
-#define EGL_GREEN_SIZE                    0x3023
-#define EGL_HEIGHT                        0x3056
-#define EGL_LARGEST_PBUFFER               0x3058
-#define EGL_LEVEL                         0x3029
-#define EGL_MAX_PBUFFER_HEIGHT            0x302A
-#define EGL_MAX_PBUFFER_PIXELS            0x302B
-#define EGL_MAX_PBUFFER_WIDTH             0x302C
-#define EGL_NATIVE_RENDERABLE             0x302D
-#define EGL_NATIVE_VISUAL_ID              0x302E
-#define EGL_NATIVE_VISUAL_TYPE            0x302F
-#define EGL_NONE                          0x3038
-#define EGL_NON_CONFORMANT_CONFIG         0x3051
-#define EGL_NOT_INITIALIZED               0x3001
-#define EGL_NO_CONTEXT                    ((EGLContext)0)
-#define EGL_NO_DISPLAY                    ((EGLDisplay)0)
-#define EGL_NO_SURFACE                    ((EGLSurface)0)
-#define EGL_PBUFFER_BIT                   0x0001
-#define EGL_PIXMAP_BIT                    0x0002
-#define EGL_READ                          0x305A
-#define EGL_RED_SIZE                      0x3024
-#define EGL_SAMPLES                       0x3031
-#define EGL_SAMPLE_BUFFERS                0x3032
-#define EGL_SLOW_CONFIG                   0x3050
-#define EGL_STENCIL_SIZE                  0x3026
-#define EGL_SUCCESS                       0x3000
-#define EGL_SURFACE_TYPE                  0x3033
-#define EGL_TRANSPARENT_BLUE_VALUE        0x3035
-#define EGL_TRANSPARENT_GREEN_VALUE       0x3036
-#define EGL_TRANSPARENT_RED_VALUE         0x3037
-#define EGL_TRANSPARENT_RGB               0x3052
-#define EGL_TRANSPARENT_TYPE              0x3034
-#define EGL_TRUE                          1
-#define EGL_VENDOR                        0x3053
-#define EGL_VERSION                       0x3054
-#define EGL_WIDTH                         0x3057
-#define EGL_WINDOW_BIT                    0x0004
-EGLAPI EGLBoolean EGLAPIENTRY eglChooseConfig (EGLDisplay dpy, const EGLint *attrib_list, EGLConfig *configs, EGLint config_size, EGLint *num_config);
-EGLAPI EGLBoolean EGLAPIENTRY eglCopyBuffers (EGLDisplay dpy, EGLSurface surface, EGLNativePixmapType target);
-EGLAPI EGLContext EGLAPIENTRY eglCreateContext (EGLDisplay dpy, EGLConfig config, EGLContext share_context, const EGLint *attrib_list);
-EGLAPI EGLSurface EGLAPIENTRY eglCreatePbufferSurface (EGLDisplay dpy, EGLConfig config, const EGLint *attrib_list);
-EGLAPI EGLSurface EGLAPIENTRY eglCreatePixmapSurface (EGLDisplay dpy, EGLConfig config, EGLNativePixmapType pixmap, const EGLint *attrib_list);
-EGLAPI EGLSurface EGLAPIENTRY eglCreateWindowSurface (EGLDisplay dpy, EGLConfig config, EGLNativeWindowType win, const EGLint *attrib_list);
-EGLAPI EGLBoolean EGLAPIENTRY eglDestroyContext (EGLDisplay dpy, EGLContext ctx);
-EGLAPI EGLBoolean EGLAPIENTRY eglDestroySurface (EGLDisplay dpy, EGLSurface surface);
-EGLAPI EGLBoolean EGLAPIENTRY eglGetConfigAttrib (EGLDisplay dpy, EGLConfig config, EGLint attribute, EGLint *value);
-EGLAPI EGLBoolean EGLAPIENTRY eglGetConfigs (EGLDisplay dpy, EGLConfig *configs, EGLint config_size, EGLint *num_config);
-EGLAPI EGLDisplay EGLAPIENTRY eglGetCurrentDisplay (void);
-EGLAPI EGLSurface EGLAPIENTRY eglGetCurrentSurface (EGLint readdraw);
-EGLAPI EGLDisplay EGLAPIENTRY eglGetDisplay (EGLNativeDisplayType display_id);
-EGLAPI EGLint EGLAPIENTRY eglGetError (void);
-EGLAPI __eglMustCastToProperFunctionPointerType EGLAPIENTRY eglGetProcAddress (const char *procname);
-EGLAPI EGLBoolean EGLAPIENTRY eglInitialize (EGLDisplay dpy, EGLint *major, EGLint *minor);
-EGLAPI EGLBoolean EGLAPIENTRY eglMakeCurrent (EGLDisplay dpy, EGLSurface draw, EGLSurface read, EGLContext ctx);
-EGLAPI EGLBoolean EGLAPIENTRY eglQueryContext (EGLDisplay dpy, EGLContext ctx, EGLint attribute, EGLint *value);
-EGLAPI const char *EGLAPIENTRY eglQueryString (EGLDisplay dpy, EGLint name);
-EGLAPI EGLBoolean EGLAPIENTRY eglQuerySurface (EGLDisplay dpy, EGLSurface surface, EGLint attribute, EGLint *value);
-EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffers (EGLDisplay dpy, EGLSurface surface);
-EGLAPI EGLBoolean EGLAPIENTRY eglTerminate (EGLDisplay dpy);
-EGLAPI EGLBoolean EGLAPIENTRY eglWaitGL (void);
-EGLAPI EGLBoolean EGLAPIENTRY eglWaitNative (EGLint engine);
-#endif /* EGL_VERSION_1_0 */
 
-#ifndef EGL_VERSION_1_1
-#define EGL_VERSION_1_1 1
-#define EGL_BACK_BUFFER                   0x3084
-#define EGL_BIND_TO_TEXTURE_RGB           0x3039
-#define EGL_BIND_TO_TEXTURE_RGBA          0x303A
-#define EGL_CONTEXT_LOST                  0x300E
-#define EGL_MIN_SWAP_INTERVAL             0x303B
-#define EGL_MAX_SWAP_INTERVAL             0x303C
-#define EGL_MIPMAP_TEXTURE                0x3082
-#define EGL_MIPMAP_LEVEL                  0x3083
-#define EGL_NO_TEXTURE                    0x305C
-#define EGL_TEXTURE_2D                    0x305F
-#define EGL_TEXTURE_FORMAT                0x3080
-#define EGL_TEXTURE_RGB                   0x305D
-#define EGL_TEXTURE_RGBA                  0x305E
-#define EGL_TEXTURE_TARGET                0x3081
-EGLAPI EGLBoolean EGLAPIENTRY eglBindTexImage (EGLDisplay dpy, EGLSurface surface, EGLint buffer);
-EGLAPI EGLBoolean EGLAPIENTRY eglReleaseTexImage (EGLDisplay dpy, EGLSurface surface, EGLint buffer);
-EGLAPI EGLBoolean EGLAPIENTRY eglSurfaceAttrib (EGLDisplay dpy, EGLSurface surface, EGLint attribute, EGLint value);
-EGLAPI EGLBoolean EGLAPIENTRY eglSwapInterval (EGLDisplay dpy, EGLint interval);
-#endif /* EGL_VERSION_1_1 */
-
-#ifndef EGL_VERSION_1_2
-#define EGL_VERSION_1_2 1
-typedef unsigned int EGLenum;
-typedef void *EGLClientBuffer;
-#define EGL_ALPHA_FORMAT                  0x3088
-#define EGL_ALPHA_FORMAT_NONPRE           0x308B
-#define EGL_ALPHA_FORMAT_PRE              0x308C
-#define EGL_ALPHA_MASK_SIZE               0x303E
-#define EGL_BUFFER_PRESERVED              0x3094
-#define EGL_BUFFER_DESTROYED              0x3095
-#define EGL_CLIENT_APIS                   0x308D
-#define EGL_COLORSPACE                    0x3087
-#define EGL_COLORSPACE_sRGB               0x3089
-#define EGL_COLORSPACE_LINEAR             0x308A
-#define EGL_COLOR_BUFFER_TYPE             0x303F
-#define EGL_CONTEXT_CLIENT_TYPE           0x3097
-#define EGL_DISPLAY_SCALING               10000
-#define EGL_HORIZONTAL_RESOLUTION         0x3090
-#define EGL_LUMINANCE_BUFFER              0x308F
-#define EGL_LUMINANCE_SIZE                0x303D
-#define EGL_OPENGL_ES_BIT                 0x0001
-#define EGL_OPENVG_BIT                    0x0002
-#define EGL_OPENGL_ES_API                 0x30A0
-#define EGL_OPENVG_API                    0x30A1
-#define EGL_OPENVG_IMAGE                  0x3096
-#define EGL_PIXEL_ASPECT_RATIO            0x3092
-#define EGL_RENDERABLE_TYPE               0x3040
-#define EGL_RENDER_BUFFER                 0x3086
-#define EGL_RGB_BUFFER                    0x308E
-#define EGL_SINGLE_BUFFER                 0x3085
-#define EGL_SWAP_BEHAVIOR                 0x3093
-#define EGL_UNKNOWN                       ((EGLint)-1)
-#define EGL_VERTICAL_RESOLUTION           0x3091
-EGLAPI EGLBoolean EGLAPIENTRY eglBindAPI (EGLenum api);
-EGLAPI EGLenum EGLAPIENTRY eglQueryAPI (void);
-EGLAPI EGLSurface EGLAPIENTRY eglCreatePbufferFromClientBuffer (EGLDisplay dpy, EGLenum buftype, EGLClientBuffer buffer, EGLConfig config, const EGLint *attrib_list);
-EGLAPI EGLBoolean EGLAPIENTRY eglReleaseThread (void);
-EGLAPI EGLBoolean EGLAPIENTRY eglWaitClient (void);
-#endif /* EGL_VERSION_1_2 */
-
-#ifndef EGL_VERSION_1_3
-#define EGL_VERSION_1_3 1
-#define EGL_CONFORMANT                    0x3042
-#define EGL_CONTEXT_CLIENT_VERSION        0x3098
-#define EGL_MATCH_NATIVE_PIXMAP           0x3041
-#define EGL_OPENGL_ES2_BIT                0x0004
-#define EGL_VG_ALPHA_FORMAT               0x3088
-#define EGL_VG_ALPHA_FORMAT_NONPRE        0x308B
-#define EGL_VG_ALPHA_FORMAT_PRE           0x308C
-#define EGL_VG_ALPHA_FORMAT_PRE_BIT       0x0040
-#define EGL_VG_COLORSPACE                 0x3087
-#define EGL_VG_COLORSPACE_sRGB            0x3089
-#define EGL_VG_COLORSPACE_LINEAR          0x308A
-#define EGL_VG_COLORSPACE_LINEAR_BIT      0x0020
-#endif /* EGL_VERSION_1_3 */
-
-#ifndef EGL_VERSION_1_4
-#define EGL_VERSION_1_4 1
-#define EGL_DEFAULT_DISPLAY               ((EGLNativeDisplayType)0)
-#define EGL_MULTISAMPLE_RESOLVE_BOX_BIT   0x0200
-#define EGL_MULTISAMPLE_RESOLVE           0x3099
-#define EGL_MULTISAMPLE_RESOLVE_DEFAULT   0x309A
-#define EGL_MULTISAMPLE_RESOLVE_BOX       0x309B
-#define EGL_OPENGL_API                    0x30A2
-#define EGL_OPENGL_BIT                    0x0008
-#define EGL_SWAP_BEHAVIOR_PRESERVED_BIT   0x0400
-EGLAPI EGLContext EGLAPIENTRY eglGetCurrentContext (void);
-#endif /* EGL_VERSION_1_4 */
-
-#ifndef EGL_VERSION_1_5
-#define EGL_VERSION_1_5 1
-typedef void *EGLSync;
-typedef intptr_t EGLAttrib;
-typedef khronos_utime_nanoseconds_t EGLTime;
-typedef void *EGLImage;
-#define EGL_CONTEXT_MAJOR_VERSION         0x3098
-#define EGL_CONTEXT_MINOR_VERSION         0x30FB
-#define EGL_CONTEXT_OPENGL_PROFILE_MASK   0x30FD
-#define EGL_CONTEXT_OPENGL_RESET_NOTIFICATION_STRATEGY 0x31BD
-#define EGL_NO_RESET_NOTIFICATION         0x31BE
-#define EGL_LOSE_CONTEXT_ON_RESET         0x31BF
-#define EGL_CONTEXT_OPENGL_CORE_PROFILE_BIT 0x00000001
-#define EGL_CONTEXT_OPENGL_COMPATIBILITY_PROFILE_BIT 0x00000002
-#define EGL_CONTEXT_OPENGL_DEBUG          0x31B0
-#define EGL_CONTEXT_OPENGL_FORWARD_COMPATIBLE 0x31B1
-#define EGL_CONTEXT_OPENGL_ROBUST_ACCESS  0x31B2
-#define EGL_OPENGL_ES3_BIT                0x00000040
-#define EGL_CL_EVENT_HANDLE               0x309C
-#define EGL_SYNC_CL_EVENT                 0x30FE
-#define EGL_SYNC_CL_EVENT_COMPLETE        0x30FF
-#define EGL_SYNC_PRIOR_COMMANDS_COMPLETE  0x30F0
-#define EGL_SYNC_TYPE                     0x30F7
-#define EGL_SYNC_STATUS                   0x30F1
-#define EGL_SYNC_CONDITION                0x30F8
-#define EGL_SIGNALED                      0x30F2
-#define EGL_UNSIGNALED                    0x30F3
-#define EGL_SYNC_FLUSH_COMMANDS_BIT       0x0001
-#define EGL_FOREVER                       0xFFFFFFFFFFFFFFFFull
-#define EGL_TIMEOUT_EXPIRED               0x30F5
-#define EGL_CONDITION_SATISFIED           0x30F6
-#define EGL_NO_SYNC                       ((EGLSync)0)
-#define EGL_SYNC_FENCE                    0x30F9
-#define EGL_GL_COLORSPACE                 0x309D
-#define EGL_GL_COLORSPACE_SRGB            0x3089
-#define EGL_GL_COLORSPACE_LINEAR          0x308A
-#define EGL_GL_RENDERBUFFER               0x30B9
-#define EGL_GL_TEXTURE_2D                 0x30B1
-#define EGL_GL_TEXTURE_LEVEL              0x30BC
-#define EGL_GL_TEXTURE_3D                 0x30B2
-#define EGL_GL_TEXTURE_ZOFFSET            0x30BD
-#define EGL_GL_TEXTURE_CUBE_MAP_POSITIVE_X 0x30B3
-#define EGL_GL_TEXTURE_CUBE_MAP_NEGATIVE_X 0x30B4
-#define EGL_GL_TEXTURE_CUBE_MAP_POSITIVE_Y 0x30B5
-#define EGL_GL_TEXTURE_CUBE_MAP_NEGATIVE_Y 0x30B6
-#define EGL_GL_TEXTURE_CUBE_MAP_POSITIVE_Z 0x30B7
-#define EGL_GL_TEXTURE_CUBE_MAP_NEGATIVE_Z 0x30B8
-#define EGL_IMAGE_PRESERVED               0x30D2
-#define EGL_NO_IMAGE                      ((EGLImage)0)
-EGLAPI EGLSync EGLAPIENTRY eglCreateSync (EGLDisplay dpy, EGLenum type, const EGLAttrib *attrib_list);
-EGLAPI EGLBoolean EGLAPIENTRY eglDestroySync (EGLDisplay dpy, EGLSync sync);
-EGLAPI EGLint EGLAPIENTRY eglClientWaitSync (EGLDisplay dpy, EGLSync sync, EGLint flags, EGLTime timeout);
-EGLAPI EGLBoolean EGLAPIENTRY eglGetSyncAttrib (EGLDisplay dpy, EGLSync sync, EGLint attribute, EGLAttrib *value);
-EGLAPI EGLImage EGLAPIENTRY eglCreateImage (EGLDisplay dpy, EGLContext ctx, EGLenum target, EGLClientBuffer buffer, const EGLAttrib *attrib_list);
-EGLAPI EGLBoolean EGLAPIENTRY eglDestroyImage (EGLDisplay dpy, EGLImage image);
-EGLAPI EGLDisplay EGLAPIENTRY eglGetPlatformDisplay (EGLenum platform, void *native_display, const EGLAttrib *attrib_list);
-EGLAPI EGLSurface EGLAPIENTRY eglCreatePlatformWindowSurface (EGLDisplay dpy, EGLConfig config, void *native_window, const EGLAttrib *attrib_list);
-EGLAPI EGLSurface EGLAPIENTRY eglCreatePlatformPixmapSurface (EGLDisplay dpy, EGLConfig config, void *native_pixmap, const EGLAttrib *attrib_list);
-EGLAPI EGLBoolean EGLAPIENTRY eglWaitSync (EGLDisplay dpy, EGLSync sync, EGLint flags);
-#endif /* EGL_VERSION_1_5 */
+/* Now, define eglGetProcAddress using the generic function ptr. type */
+EGLAPI __eglMustCastToProperFunctionPointerType EGLAPIENTRY
+       eglGetProcAddress(const char *procname);
 
 #ifdef __cplusplus
 }
 #endif
 
-#endif
+#endif /* __egl_h_ */

include/EGL/eglext.h

@@ -6,7 +6,7 @@ extern "C" {
 #endif
 
 /*
-** Copyright (c) 2013-2014 The Khronos Group Inc.
+** Copyright (c) 2013 The Khronos Group Inc.
 **
 ** Permission is hereby granted, free of charge, to any person obtaining a
 ** copy of this software and/or associated documentation files (the
@@ -33,12 +33,12 @@ extern "C" {
 ** used to make the header, and the header can be found at
 **   http://www.opengl.org/registry/
 **
-** Khronos $Revision$ on $Date$
+** Khronos $Revision: 24567 $ on $Date: 2013-12-18 09:50:17 -0800 (Wed, 18 Dec 2013) $
 */
 
 #include <EGL/eglplatform.h>
 
-#define EGL_EGLEXT_VERSION 20150508
+#define EGL_EGLEXT_VERSION 20131218
 
 /* Generated C header for:
  * API: egl
@@ -94,28 +94,12 @@ EGLAPI EGLSyncKHR EGLAPIENTRY eglCreateSync64KHR (EGLDisplay dpy, EGLenum type,
 #define EGL_OPENGL_ES3_BIT_KHR            0x00000040
 #endif /* EGL_KHR_create_context */
 
-#ifndef EGL_KHR_create_context_no_error
-#define EGL_KHR_create_context_no_error 1
-#define EGL_CONTEXT_OPENGL_NO_ERROR_KHR   0x31B3
-#endif /* EGL_KHR_create_context_no_error */
-
 #ifndef EGL_KHR_fence_sync
 #define EGL_KHR_fence_sync 1
-typedef khronos_utime_nanoseconds_t EGLTimeKHR;
 #ifdef KHRONOS_SUPPORT_INT64
 #define EGL_SYNC_PRIOR_COMMANDS_COMPLETE_KHR 0x30F0
 #define EGL_SYNC_CONDITION_KHR            0x30F8
 #define EGL_SYNC_FENCE_KHR                0x30F9
-typedef EGLSyncKHR (EGLAPIENTRYP PFNEGLCREATESYNCKHRPROC) (EGLDisplay dpy, EGLenum type, const EGLint *attrib_list);
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLDESTROYSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync);
-typedef EGLint (EGLAPIENTRYP PFNEGLCLIENTWAITSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint flags, EGLTimeKHR timeout);
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETSYNCATTRIBKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint attribute, EGLint *value);
-#ifdef EGL_EGLEXT_PROTOTYPES
-EGLAPI EGLSyncKHR EGLAPIENTRY eglCreateSyncKHR (EGLDisplay dpy, EGLenum type, const EGLint *attrib_list);
-EGLAPI EGLBoolean EGLAPIENTRY eglDestroySyncKHR (EGLDisplay dpy, EGLSyncKHR sync);
-EGLAPI EGLint EGLAPIENTRY eglClientWaitSyncKHR (EGLDisplay dpy, EGLSyncKHR sync, EGLint flags, EGLTimeKHR timeout);
-EGLAPI EGLBoolean EGLAPIENTRY eglGetSyncAttribKHR (EGLDisplay dpy, EGLSyncKHR sync, EGLint attribute, EGLint *value);
-#endif
 #endif /* KHRONOS_SUPPORT_INT64 */
 #endif /* EGL_KHR_fence_sync */
 
@@ -223,38 +207,9 @@ EGLAPI EGLBoolean EGLAPIENTRY eglQuerySurface64KHR (EGLDisplay dpy, EGLSurface s
 #endif
 #endif /* EGL_KHR_lock_surface3 */
 
-#ifndef EGL_KHR_partial_update
-#define EGL_KHR_partial_update 1
-#define EGL_BUFFER_AGE_KHR                0x313D
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLSETDAMAGEREGIONKHRPROC) (EGLDisplay dpy, EGLSurface surface, EGLint *rects, EGLint n_rects);
-#ifdef EGL_EGLEXT_PROTOTYPES
-EGLAPI EGLBoolean EGLAPIENTRY eglSetDamageRegionKHR (EGLDisplay dpy, EGLSurface surface, EGLint *rects, EGLint n_rects);
-#endif
-#endif /* EGL_KHR_partial_update */
-
-#ifndef EGL_KHR_platform_android
-#define EGL_KHR_platform_android 1
-#define EGL_PLATFORM_ANDROID_KHR          0x3141
-#endif /* EGL_KHR_platform_android */
-
-#ifndef EGL_KHR_platform_gbm
-#define EGL_KHR_platform_gbm 1
-#define EGL_PLATFORM_GBM_KHR              0x31D7
-#endif /* EGL_KHR_platform_gbm */
-
-#ifndef EGL_KHR_platform_wayland
-#define EGL_KHR_platform_wayland 1
-#define EGL_PLATFORM_WAYLAND_KHR          0x31D8
-#endif /* EGL_KHR_platform_wayland */
-
-#ifndef EGL_KHR_platform_x11
-#define EGL_KHR_platform_x11 1
-#define EGL_PLATFORM_X11_KHR              0x31D5
-#define EGL_PLATFORM_X11_SCREEN_KHR       0x31D6
-#endif /* EGL_KHR_platform_x11 */
-
 #ifndef EGL_KHR_reusable_sync
 #define EGL_KHR_reusable_sync 1
+typedef khronos_utime_nanoseconds_t EGLTimeKHR;
 #ifdef KHRONOS_SUPPORT_INT64
 #define EGL_SYNC_STATUS_KHR               0x30F1
 #define EGL_SIGNALED_KHR                  0x30F2
@@ -266,9 +221,17 @@ EGLAPI EGLBoolean EGLAPIENTRY eglSetDamageRegionKHR (EGLDisplay dpy, EGLSurface
 #define EGL_SYNC_FLUSH_COMMANDS_BIT_KHR   0x0001
 #define EGL_FOREVER_KHR                   0xFFFFFFFFFFFFFFFFull
 #define EGL_NO_SYNC_KHR                   ((EGLSyncKHR)0)
+typedef EGLSyncKHR (EGLAPIENTRYP PFNEGLCREATESYNCKHRPROC) (EGLDisplay dpy, EGLenum type, const EGLint *attrib_list);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLDESTROYSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync);
+typedef EGLint (EGLAPIENTRYP PFNEGLCLIENTWAITSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint flags, EGLTimeKHR timeout);
 typedef EGLBoolean (EGLAPIENTRYP PFNEGLSIGNALSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLenum mode);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETSYNCATTRIBKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint attribute, EGLint *value);
 #ifdef EGL_EGLEXT_PROTOTYPES
+EGLAPI EGLSyncKHR EGLAPIENTRY eglCreateSyncKHR (EGLDisplay dpy, EGLenum type, const EGLint *attrib_list);
+EGLAPI EGLBoolean EGLAPIENTRY eglDestroySyncKHR (EGLDisplay dpy, EGLSyncKHR sync);
+EGLAPI EGLint EGLAPIENTRY eglClientWaitSyncKHR (EGLDisplay dpy, EGLSyncKHR sync, EGLint flags, EGLTimeKHR timeout);
 EGLAPI EGLBoolean EGLAPIENTRY eglSignalSyncKHR (EGLDisplay dpy, EGLSyncKHR sync, EGLenum mode);
+EGLAPI EGLBoolean EGLAPIENTRY eglGetSyncAttribKHR (EGLDisplay dpy, EGLSyncKHR sync, EGLint attribute, EGLint *value);
 #endif
 #endif /* KHRONOS_SUPPORT_INT64 */
 #endif /* EGL_KHR_reusable_sync */
@@ -370,14 +333,6 @@ EGLAPI EGLSurface EGLAPIENTRY eglCreateStreamProducerSurfaceKHR (EGLDisplay dpy,
 #define EGL_KHR_surfaceless_context 1
 #endif /* EGL_KHR_surfaceless_context */
 
-#ifndef EGL_KHR_swap_buffers_with_damage
-#define EGL_KHR_swap_buffers_with_damage 1
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLSWAPBUFFERSWITHDAMAGEKHRPROC) (EGLDisplay dpy, EGLSurface surface, EGLint *rects, EGLint n_rects);
-#ifdef EGL_EGLEXT_PROTOTYPES
-EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffersWithDamageKHR (EGLDisplay dpy, EGLSurface surface, EGLint *rects, EGLint n_rects);
-#endif
-#endif /* EGL_KHR_swap_buffers_with_damage */
-
 #ifndef EGL_KHR_vg_parent_image
 #define EGL_KHR_vg_parent_image 1
 #define EGL_VG_PARENT_IMAGE_KHR           0x30BA
@@ -434,12 +389,6 @@ EGLAPI EGLint EGLAPIENTRY eglDupNativeFenceFDANDROID (EGLDisplay dpy, EGLSyncKHR
 #define EGL_D3D_TEXTURE_2D_SHARE_HANDLE_ANGLE 0x3200
 #endif /* EGL_ANGLE_d3d_share_handle_client_buffer */
 
-#ifndef EGL_ANGLE_device_d3d
-#define EGL_ANGLE_device_d3d 1
-#define EGL_D3D9_DEVICE_ANGLE             0x33A0
-#define EGL_D3D11_DEVICE_ANGLE            0x33A1
-#endif /* EGL_ANGLE_device_d3d */
-
 #ifndef EGL_ANGLE_query_surface_pointer
 #define EGL_ANGLE_query_surface_pointer 1
 typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYSURFACEPOINTERANGLEPROC) (EGLDisplay dpy, EGLSurface surface, EGLint attribute, void **value);
@@ -452,11 +401,6 @@ EGLAPI EGLBoolean EGLAPIENTRY eglQuerySurfacePointerANGLE (EGLDisplay dpy, EGLSu
 #define EGL_ANGLE_surface_d3d_texture_2d_share_handle 1
 #endif /* EGL_ANGLE_surface_d3d_texture_2d_share_handle */
 
-#ifndef EGL_ANGLE_window_fixed_size
-#define EGL_ANGLE_window_fixed_size 1
-#define EGL_FIXED_SIZE_ANGLE              0x3201
-#endif /* EGL_ANGLE_window_fixed_size */
-
 #ifndef EGL_ARM_pixmap_multisample_discard
 #define EGL_ARM_pixmap_multisample_discard 1
 #define EGL_DISCARD_SAMPLES_ARM           0x3286
@@ -479,42 +423,6 @@ EGLAPI EGLBoolean EGLAPIENTRY eglQuerySurfacePointerANGLE (EGLDisplay dpy, EGLSu
 #define EGL_LOSE_CONTEXT_ON_RESET_EXT     0x31BF
 #endif /* EGL_EXT_create_context_robustness */
 
-#ifndef EGL_EXT_device_base
-#define EGL_EXT_device_base 1
-typedef void *EGLDeviceEXT;
-#define EGL_NO_DEVICE_EXT                 ((EGLDeviceEXT)(0))
-#define EGL_BAD_DEVICE_EXT                0x322B
-#define EGL_DEVICE_EXT                    0x322C
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYDEVICEATTRIBEXTPROC) (EGLDeviceEXT device, EGLint attribute, EGLAttrib *value);
-typedef const char *(EGLAPIENTRYP PFNEGLQUERYDEVICESTRINGEXTPROC) (EGLDeviceEXT device, EGLint name);
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYDEVICESEXTPROC) (EGLint max_devices, EGLDeviceEXT *devices, EGLint *num_devices);
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYDISPLAYATTRIBEXTPROC) (EGLDisplay dpy, EGLint attribute, EGLAttrib *value);
-#ifdef EGL_EGLEXT_PROTOTYPES
-EGLAPI EGLBoolean EGLAPIENTRY eglQueryDeviceAttribEXT (EGLDeviceEXT device, EGLint attribute, EGLAttrib *value);
-EGLAPI const char *EGLAPIENTRY eglQueryDeviceStringEXT (EGLDeviceEXT device, EGLint name);
-EGLAPI EGLBoolean EGLAPIENTRY eglQueryDevicesEXT (EGLint max_devices, EGLDeviceEXT *devices, EGLint *num_devices);
-EGLAPI EGLBoolean EGLAPIENTRY eglQueryDisplayAttribEXT (EGLDisplay dpy, EGLint attribute, EGLAttrib *value);
-#endif
-#endif /* EGL_EXT_device_base */
-
-#ifndef EGL_EXT_device_drm
-#define EGL_EXT_device_drm 1
-#define EGL_DRM_DEVICE_FILE_EXT           0x3233
-#endif /* EGL_EXT_device_drm */
-
-#ifndef EGL_EXT_device_enumeration
-#define EGL_EXT_device_enumeration 1
-#endif /* EGL_EXT_device_enumeration */
-
-#ifndef EGL_EXT_device_openwf
-#define EGL_EXT_device_openwf 1
-#define EGL_OPENWF_DEVICE_ID_EXT          0x3237
-#endif /* EGL_EXT_device_openwf */
-
-#ifndef EGL_EXT_device_query
-#define EGL_EXT_device_query 1
-#endif /* EGL_EXT_device_query */
-
 #ifndef EGL_EXT_image_dma_buf_import
 #define EGL_EXT_image_dma_buf_import 1
 #define EGL_LINUX_DMA_BUF_EXT             0x3270
@@ -546,48 +454,6 @@ EGLAPI EGLBoolean EGLAPIENTRY eglQueryDisplayAttribEXT (EGLDisplay dpy, EGLint a
 #define EGL_MULTIVIEW_VIEW_COUNT_EXT      0x3134
 #endif /* EGL_EXT_multiview_window */
 
-#ifndef EGL_EXT_output_base
-#define EGL_EXT_output_base 1
-typedef void *EGLOutputLayerEXT;
-typedef void *EGLOutputPortEXT;
-#define EGL_NO_OUTPUT_LAYER_EXT           ((EGLOutputLayerEXT)0)
-#define EGL_NO_OUTPUT_PORT_EXT            ((EGLOutputPortEXT)0)
-#define EGL_BAD_OUTPUT_LAYER_EXT          0x322D
-#define EGL_BAD_OUTPUT_PORT_EXT           0x322E
-#define EGL_SWAP_INTERVAL_EXT             0x322F
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETOUTPUTLAYERSEXTPROC) (EGLDisplay dpy, const EGLAttrib *attrib_list, EGLOutputLayerEXT *layers, EGLint max_layers, EGLint *num_layers);
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETOUTPUTPORTSEXTPROC) (EGLDisplay dpy, const EGLAttrib *attrib_list, EGLOutputPortEXT *ports, EGLint max_ports, EGLint *num_ports);
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLOUTPUTLAYERATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint attribute, EGLAttrib value);
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYOUTPUTLAYERATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint attribute, EGLAttrib *value);
-typedef const char *(EGLAPIENTRYP PFNEGLQUERYOUTPUTLAYERSTRINGEXTPROC) (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint name);
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLOUTPUTPORTATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputPortEXT port, EGLint attribute, EGLAttrib value);
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYOUTPUTPORTATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputPortEXT port, EGLint attribute, EGLAttrib *value);
-typedef const char *(EGLAPIENTRYP PFNEGLQUERYOUTPUTPORTSTRINGEXTPROC) (EGLDisplay dpy, EGLOutputPortEXT port, EGLint name);
-#ifdef EGL_EGLEXT_PROTOTYPES
-EGLAPI EGLBoolean EGLAPIENTRY eglGetOutputLayersEXT (EGLDisplay dpy, const EGLAttrib *attrib_list, EGLOutputLayerEXT *layers, EGLint max_layers, EGLint *num_layers);
-EGLAPI EGLBoolean EGLAPIENTRY eglGetOutputPortsEXT (EGLDisplay dpy, const EGLAttrib *attrib_list, EGLOutputPortEXT *ports, EGLint max_ports, EGLint *num_ports);
-EGLAPI EGLBoolean EGLAPIENTRY eglOutputLayerAttribEXT (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint attribute, EGLAttrib value);
-EGLAPI EGLBoolean EGLAPIENTRY eglQueryOutputLayerAttribEXT (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint attribute, EGLAttrib *value);
-EGLAPI const char *EGLAPIENTRY eglQueryOutputLayerStringEXT (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint name);
-EGLAPI EGLBoolean EGLAPIENTRY eglOutputPortAttribEXT (EGLDisplay dpy, EGLOutputPortEXT port, EGLint attribute, EGLAttrib value);
-EGLAPI EGLBoolean EGLAPIENTRY eglQueryOutputPortAttribEXT (EGLDisplay dpy, EGLOutputPortEXT port, EGLint attribute, EGLAttrib *value);
-EGLAPI const char *EGLAPIENTRY eglQueryOutputPortStringEXT (EGLDisplay dpy, EGLOutputPortEXT port, EGLint name);
-#endif
-#endif /* EGL_EXT_output_base */
-
-#ifndef EGL_EXT_output_drm
-#define EGL_EXT_output_drm 1
-#define EGL_DRM_CRTC_EXT                  0x3234
-#define EGL_DRM_PLANE_EXT                 0x3235
-#define EGL_DRM_CONNECTOR_EXT             0x3236
-#endif /* EGL_EXT_output_drm */
-
-#ifndef EGL_EXT_output_openwf
-#define EGL_EXT_output_openwf 1
-#define EGL_OPENWF_PIPELINE_ID_EXT        0x3238
-#define EGL_OPENWF_PORT_ID_EXT            0x3239
-#endif /* EGL_EXT_output_openwf */
-
 #ifndef EGL_EXT_platform_base
 #define EGL_EXT_platform_base 1
 typedef EGLDisplay (EGLAPIENTRYP PFNEGLGETPLATFORMDISPLAYEXTPROC) (EGLenum platform, void *native_display, const EGLint *attrib_list);
@@ -600,11 +466,6 @@ EGLAPI EGLSurface EGLAPIENTRY eglCreatePlatformPixmapSurfaceEXT (EGLDisplay dpy,
 #endif
 #endif /* EGL_EXT_platform_base */
 
-#ifndef EGL_EXT_platform_device
-#define EGL_EXT_platform_device 1
-#define EGL_PLATFORM_DEVICE_EXT           0x313F
-#endif /* EGL_EXT_platform_device */
-
 #ifndef EGL_EXT_platform_wayland
 #define EGL_EXT_platform_wayland 1
 #define EGL_PLATFORM_WAYLAND_EXT          0x31D8
@@ -616,19 +477,6 @@ EGLAPI EGLSurface EGLAPIENTRY eglCreatePlatformPixmapSurfaceEXT (EGLDisplay dpy,
 #define EGL_PLATFORM_X11_SCREEN_EXT       0x31D6
 #endif /* EGL_EXT_platform_x11 */
 
-#ifndef EGL_EXT_protected_surface
-#define EGL_EXT_protected_surface 1
-#define EGL_PROTECTED_CONTENT_EXT         0x32C0
-#endif /* EGL_EXT_protected_surface */
-
-#ifndef EGL_EXT_stream_consumer_egloutput
-#define EGL_EXT_stream_consumer_egloutput 1
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLSTREAMCONSUMEROUTPUTEXTPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLOutputLayerEXT layer);
-#ifdef EGL_EGLEXT_PROTOTYPES
-EGLAPI EGLBoolean EGLAPIENTRY eglStreamConsumerOutputEXT (EGLDisplay dpy, EGLStreamKHR stream, EGLOutputLayerEXT layer);
-#endif
-#endif /* EGL_EXT_stream_consumer_egloutput */
-
 #ifndef EGL_EXT_swap_buffers_with_damage
 #define EGL_EXT_swap_buffers_with_damage 1
 typedef EGLBoolean (EGLAPIENTRYP PFNEGLSWAPBUFFERSWITHDAMAGEEXTPROC) (EGLDisplay dpy, EGLSurface surface, EGLint *rects, EGLint n_rects);
@@ -637,35 +485,6 @@ EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffersWithDamageEXT (EGLDisplay dpy, EGLSu
 #endif
 #endif /* EGL_EXT_swap_buffers_with_damage */
 
-#ifndef EGL_EXT_yuv_surface
-#define EGL_EXT_yuv_surface 1
-#define EGL_YUV_ORDER_EXT                 0x3301
-#define EGL_YUV_NUMBER_OF_PLANES_EXT      0x3311
-#define EGL_YUV_SUBSAMPLE_EXT             0x3312
-#define EGL_YUV_DEPTH_RANGE_EXT           0x3317
-#define EGL_YUV_CSC_STANDARD_EXT          0x330A
-#define EGL_YUV_PLANE_BPP_EXT             0x331A
-#define EGL_YUV_BUFFER_EXT                0x3300
-#define EGL_YUV_ORDER_YUV_EXT             0x3302
-#define EGL_YUV_ORDER_YVU_EXT             0x3303
-#define EGL_YUV_ORDER_YUYV_EXT            0x3304
-#define EGL_YUV_ORDER_UYVY_EXT            0x3305
-#define EGL_YUV_ORDER_YVYU_EXT            0x3306
-#define EGL_YUV_ORDER_VYUY_EXT            0x3307
-#define EGL_YUV_ORDER_AYUV_EXT            0x3308
-#define EGL_YUV_SUBSAMPLE_4_2_0_EXT       0x3313
-#define EGL_YUV_SUBSAMPLE_4_2_2_EXT       0x3314
-#define EGL_YUV_SUBSAMPLE_4_4_4_EXT       0x3315
-#define EGL_YUV_DEPTH_RANGE_LIMITED_EXT   0x3318
-#define EGL_YUV_DEPTH_RANGE_FULL_EXT      0x3319
-#define EGL_YUV_CSC_STANDARD_601_EXT      0x330B
-#define EGL_YUV_CSC_STANDARD_709_EXT      0x330C
-#define EGL_YUV_CSC_STANDARD_2020_EXT     0x330D
-#define EGL_YUV_PLANE_BPP_0_EXT           0x331B
-#define EGL_YUV_PLANE_BPP_8_EXT           0x331C
-#define EGL_YUV_PLANE_BPP_10_EXT          0x331D
-#endif /* EGL_EXT_yuv_surface */
-
 #ifndef EGL_HI_clientpixmap
 #define EGL_HI_clientpixmap 1
 struct EGLClientPixmapHI {
@@ -714,42 +533,11 @@ EGLAPI EGLBoolean EGLAPIENTRY eglExportDRMImageMESA (EGLDisplay dpy, EGLImageKHR
 #endif
 #endif /* EGL_MESA_drm_image */
 
-#ifndef EGL_MESA_image_dma_buf_export
-#define EGL_MESA_image_dma_buf_export 1
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLEXPORTDMABUFIMAGEQUERYMESAPROC) (EGLDisplay dpy, EGLImageKHR image, int *fourcc, int *num_planes, EGLuint64KHR *modifiers);
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLEXPORTDMABUFIMAGEMESAPROC) (EGLDisplay dpy, EGLImageKHR image, int *fds, EGLint *strides, EGLint *offsets);
-#ifdef EGL_EGLEXT_PROTOTYPES
-EGLAPI EGLBoolean EGLAPIENTRY eglExportDMABUFImageQueryMESA (EGLDisplay dpy, EGLImageKHR image, int *fourcc, int *num_planes, EGLuint64KHR *modifiers);
-EGLAPI EGLBoolean EGLAPIENTRY eglExportDMABUFImageMESA (EGLDisplay dpy, EGLImageKHR image, int *fds, EGLint *strides, EGLint *offsets);
-#endif
-#endif /* EGL_MESA_image_dma_buf_export */
-
 #ifndef EGL_MESA_platform_gbm
 #define EGL_MESA_platform_gbm 1
 #define EGL_PLATFORM_GBM_MESA             0x31D7
 #endif /* EGL_MESA_platform_gbm */
 
-#ifndef EGL_NOK_swap_region
-#define EGL_NOK_swap_region 1
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLSWAPBUFFERSREGIONNOKPROC) (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint *rects);
-#ifdef EGL_EGLEXT_PROTOTYPES
-EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffersRegionNOK (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint *rects);
-#endif
-#endif /* EGL_NOK_swap_region */
-
-#ifndef EGL_NOK_swap_region2
-#define EGL_NOK_swap_region2 1
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLSWAPBUFFERSREGION2NOKPROC) (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint *rects);
-#ifdef EGL_EGLEXT_PROTOTYPES
-EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffersRegion2NOK (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint *rects);
-#endif
-#endif /* EGL_NOK_swap_region2 */
-
-#ifndef EGL_NOK_texture_from_pixmap
-#define EGL_NOK_texture_from_pixmap 1
-#define EGL_Y_INVERTED_NOK                0x307F
-#endif /* EGL_NOK_texture_from_pixmap */
-
 #ifndef EGL_NV_3dvision_surface
 #define EGL_NV_3dvision_surface 1
 #define EGL_AUTO_STEREO_NV                0x3136
@@ -768,13 +556,6 @@ EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffersRegion2NOK (EGLDisplay dpy, EGLSurfa
 #define EGL_COVERAGE_SAMPLE_RESOLVE_NONE_NV 0x3133
 #endif /* EGL_NV_coverage_sample_resolve */
 
-#ifndef EGL_NV_cuda_event
-#define EGL_NV_cuda_event 1
-#define EGL_CUDA_EVENT_HANDLE_NV          0x323B
-#define EGL_SYNC_CUDA_EVENT_NV            0x323C
-#define EGL_SYNC_CUDA_EVENT_COMPLETE_NV   0x323D
-#endif /* EGL_NV_cuda_event */
-
 #ifndef EGL_NV_depth_nonlinear
 #define EGL_NV_depth_nonlinear 1
 #define EGL_DEPTH_ENCODING_NV             0x30E2
@@ -782,11 +563,6 @@ EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffersRegion2NOK (EGLDisplay dpy, EGLSurfa
 #define EGL_DEPTH_ENCODING_NONLINEAR_NV   0x30E3
 #endif /* EGL_NV_depth_nonlinear */
 
-#ifndef EGL_NV_device_cuda
-#define EGL_NV_device_cuda 1
-#define EGL_CUDA_DEVICE_NV                0x323A
-#endif /* EGL_NV_device_cuda */
-
 #ifndef EGL_NV_native_query
 #define EGL_NV_native_query 1
 typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYNATIVEDISPLAYNVPROC) (EGLDisplay dpy, EGLNativeDisplayType *display_id);
@@ -869,16 +645,6 @@ EGLAPI EGLuint64NV EGLAPIENTRY eglGetSystemTimeNV (void);
 #endif /* KHRONOS_SUPPORT_INT64 */
 #endif /* EGL_NV_system_time */
 
-#ifndef EGL_TIZEN_image_native_buffer
-#define EGL_TIZEN_image_native_buffer 1
-#define EGL_NATIVE_BUFFER_TIZEN           0x32A0
-#endif /* EGL_TIZEN_image_native_buffer */
-
-#ifndef EGL_TIZEN_image_native_surface
-#define EGL_TIZEN_image_native_surface 1
-#define EGL_NATIVE_SURFACE_TIZEN          0x32A1
-#endif /* EGL_TIZEN_image_native_surface */
-
 #include <EGL/eglmesaext.h>
 #include <EGL/eglextchromium.h>
 

include/EGL/eglmesaext.h

@@ -34,6 +34,63 @@ extern "C" {
 
 #include <EGL/eglplatform.h>
 
+/* EGL_MESA_screen extension  >>> PRELIMINARY <<< */
+#ifndef EGL_MESA_screen_surface
+#define EGL_MESA_screen_surface 1
+
+#define EGL_BAD_SCREEN_MESA                    0x4000
+#define EGL_BAD_MODE_MESA                      0x4001
+#define EGL_SCREEN_COUNT_MESA                  0x4002
+#define EGL_SCREEN_POSITION_MESA               0x4003
+#define EGL_SCREEN_POSITION_GRANULARITY_MESA   0x4004
+#define EGL_MODE_ID_MESA                       0x4005
+#define EGL_REFRESH_RATE_MESA                  0x4006
+#define EGL_OPTIMAL_MESA                       0x4007
+#define EGL_INTERLACED_MESA                    0x4008
+#define EGL_SCREEN_BIT_MESA                    0x08
+
+typedef khronos_uint32_t EGLScreenMESA;
+typedef khronos_uint32_t EGLModeMESA;
+
+#ifdef EGL_EGLEXT_PROTOTYPES
+EGLAPI EGLBoolean EGLAPIENTRY eglChooseModeMESA(EGLDisplay dpy, EGLScreenMESA screen, const EGLint *attrib_list, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
+EGLAPI EGLBoolean EGLAPIENTRY eglGetModesMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
+EGLAPI EGLBoolean EGLAPIENTRY eglGetModeAttribMESA(EGLDisplay dpy, EGLModeMESA mode, EGLint attribute, EGLint *value);
+EGLAPI EGLBoolean EGLAPIENTRY eglGetScreensMESA(EGLDisplay dpy, EGLScreenMESA *screens, EGLint max_screens, EGLint *num_screens);
+EGLAPI EGLSurface EGLAPIENTRY eglCreateScreenSurfaceMESA(EGLDisplay dpy, EGLConfig config, const EGLint *attrib_list);
+EGLAPI EGLBoolean EGLAPIENTRY eglShowScreenSurfaceMESA(EGLDisplay dpy, EGLint screen, EGLSurface surface, EGLModeMESA mode);
+EGLAPI EGLBoolean EGLAPIENTRY eglScreenPositionMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLint x, EGLint y);
+EGLAPI EGLBoolean EGLAPIENTRY eglQueryScreenMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLint attribute, EGLint *value);
+EGLAPI EGLBoolean EGLAPIENTRY eglQueryScreenSurfaceMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLSurface *surface);
+EGLAPI EGLBoolean EGLAPIENTRY eglQueryScreenModeMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *mode);
+EGLAPI const char * EGLAPIENTRY eglQueryModeStringMESA(EGLDisplay dpy, EGLModeMESA mode);
+#endif /* EGL_EGLEXT_PROTOTYPES */
+
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLCHOOSEMODEMESA) (EGLDisplay dpy, EGLScreenMESA screen, const EGLint *attrib_list, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETMODESMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLGetModeATTRIBMESA) (EGLDisplay dpy, EGLModeMESA mode, EGLint attribute, EGLint *value);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETSCRREENSMESA) (EGLDisplay dpy, EGLScreenMESA *screens, EGLint max_screens, EGLint *num_screens);
+typedef EGLSurface (EGLAPIENTRYP PFNEGLCREATESCREENSURFACEMESA) (EGLDisplay dpy, EGLConfig config, const EGLint *attrib_list);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLSHOWSCREENSURFACEMESA) (EGLDisplay dpy, EGLint screen, EGLSurface surface, EGLModeMESA mode);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLSCREENPOSIITONMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLint x, EGLint y);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYSCREENMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLint attribute, EGLint *value);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYSCREENSURFACEMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLSurface *surface);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYSCREENMODEMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *mode);
+typedef const char * (EGLAPIENTRYP PFNEGLQUERYMODESTRINGMESA) (EGLDisplay dpy, EGLModeMESA mode);
+
+#endif /* EGL_MESA_screen_surface */
+
+#ifndef EGL_MESA_copy_context
+#define EGL_MESA_copy_context 1
+
+#ifdef EGL_EGLEXT_PROTOTYPES
+EGLAPI EGLBoolean EGLAPIENTRY eglCopyContextMESA(EGLDisplay dpy, EGLContext source, EGLContext dest, EGLint mask);
+#endif /* EGL_EGLEXT_PROTOTYPES */
+
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLCOPYCONTEXTMESA) (EGLDisplay dpy, EGLContext source, EGLContext dest, EGLint mask);
+
+#endif /* EGL_MESA_copy_context */
+
 #ifndef EGL_MESA_drm_display
 #define EGL_MESA_drm_display 1
 
@@ -87,8 +144,26 @@ typedef struct wl_buffer * (EGLAPIENTRYP PFNEGLCREATEWAYLANDBUFFERFROMIMAGEWL) (
 
 #endif
 
-/* remnant of EGL_NOK_swap_region kept for compatibility because of a non-standard type name */
+#ifndef EGL_NOK_swap_region
+#define EGL_NOK_swap_region 1
+
+#ifdef EGL_EGLEXT_PROTOTYPES
+EGLAPI EGLBoolean EGLAPIENTRY eglSwapBuffersRegionNOK(EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint* rects);
+#endif
+
 typedef EGLBoolean (EGLAPIENTRYP PFNEGLSWAPBUFFERSREGIONNOK) (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint* rects);
+#endif
+
+#ifndef EGL_NOK_texture_from_pixmap
+#define EGL_NOK_texture_from_pixmap 1
+
+#define EGL_Y_INVERTED_NOK			0x307F
+#endif /* EGL_NOK_texture_from_pixmap */
+
+#ifndef EGL_ANDROID_image_native_buffer
+#define EGL_ANDROID_image_native_buffer 1
+#define EGL_NATIVE_BUFFER_ANDROID       0x3140  /* eglCreateImageKHR target */
+#endif
 
 #ifndef EGL_MESA_configless_context
 #define EGL_MESA_configless_context 1

include/EGL/eglplatform.h

@@ -2,7 +2,7 @@
 #define __eglplatform_h_
 
 /*
-** Copyright (c) 2007-2013 The Khronos Group Inc.
+** Copyright (c) 2007-2009 The Khronos Group Inc.
 **
 ** Permission is hereby granted, free of charge, to any person obtaining a
 ** copy of this software and/or associated documentation files (the
@@ -25,7 +25,7 @@
 */
 
 /* Platform-specific types and definitions for egl.h
- * $Revision: 30994 $ on $Date: 2015-04-30 13:36:48 -0700 (Thu, 30 Apr 2015) $
+ * $Revision: 12306 $ on $Date: 2010-08-25 09:51:28 -0700 (Wed, 25 Aug 2010) $
  *
  * Adopters may modify khrplatform.h and this file to suit their platform.
  * You are encouraged to submit all modifications to the Khronos group so that
@@ -95,17 +95,16 @@ typedef struct gbm_device  *EGLNativeDisplayType;
 typedef struct gbm_bo      *EGLNativePixmapType;
 typedef void               *EGLNativeWindowType;
 
-#elif defined(__ANDROID__) || defined(ANDROID)
-
-#include <android/native_window.h>
+#elif defined(ANDROID) /* Android */
 
+struct ANativeWindow;
 struct egl_native_pixmap_t;
 
-typedef struct ANativeWindow*           EGLNativeWindowType;
-typedef struct egl_native_pixmap_t*     EGLNativePixmapType;
-typedef void*                           EGLNativeDisplayType;
+typedef struct ANativeWindow        *EGLNativeWindowType;
+typedef struct egl_native_pixmap_t  *EGLNativePixmapType;
+typedef void                        *EGLNativeDisplayType;
 
-#elif defined(__unix__) || defined(__APPLE__)
+#elif defined(__unix__)
 
 #if defined(MESA_EGL_NO_X11_HEADERS)
 
@@ -132,7 +131,9 @@ typedef khronos_uintptr_t	 EGLNativePixmapType;
 typedef khronos_uintptr_t	 EGLNativeWindowType;
 
 #else
+
 #error "Platform not recognized"
+
 #endif
 
 /* EGL 1.2 types, renamed for consistency in EGL 1.3 */

include/GL/glext.h

@@ -6,7 +6,7 @@ extern "C" {
 #endif
 
 /*
-** Copyright (c) 2013-2015 The Khronos Group Inc.
+** Copyright (c) 2013-2014 The Khronos Group Inc.
 **
 ** Permission is hereby granted, free of charge, to any person obtaining a
 ** copy of this software and/or associated documentation files (the
@@ -33,7 +33,7 @@ extern "C" {
 ** used to make the header, and the header can be found at
 **   http://www.opengl.org/registry/
 **
-** Khronos $Revision: 31811 $ on $Date: 2015-08-10 17:01:11 +1000 (Mon, 10 Aug 2015) $
+** Khronos $Revision: 29735 $ on $Date: 2015-02-02 19:00:01 -0800 (Mon, 02 Feb 2015) $
 */
 
 #if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__)
@@ -53,7 +53,7 @@ extern "C" {
 #define GLAPI extern
 #endif
 
-#define GL_GLEXT_VERSION 20150809
+#define GL_GLEXT_VERSION 20150202
 
 /* Generated C header for:
  * API: gl
@@ -1041,22 +1041,6 @@ typedef unsigned short GLhalf;
 #define GL_COLOR_ATTACHMENT13             0x8CED
 #define GL_COLOR_ATTACHMENT14             0x8CEE
 #define GL_COLOR_ATTACHMENT15             0x8CEF
-#define GL_COLOR_ATTACHMENT16             0x8CF0
-#define GL_COLOR_ATTACHMENT17             0x8CF1
-#define GL_COLOR_ATTACHMENT18             0x8CF2
-#define GL_COLOR_ATTACHMENT19             0x8CF3
-#define GL_COLOR_ATTACHMENT20             0x8CF4
-#define GL_COLOR_ATTACHMENT21             0x8CF5
-#define GL_COLOR_ATTACHMENT22             0x8CF6
-#define GL_COLOR_ATTACHMENT23             0x8CF7
-#define GL_COLOR_ATTACHMENT24             0x8CF8
-#define GL_COLOR_ATTACHMENT25             0x8CF9
-#define GL_COLOR_ATTACHMENT26             0x8CFA
-#define GL_COLOR_ATTACHMENT27             0x8CFB
-#define GL_COLOR_ATTACHMENT28             0x8CFC
-#define GL_COLOR_ATTACHMENT29             0x8CFD
-#define GL_COLOR_ATTACHMENT30             0x8CFE
-#define GL_COLOR_ATTACHMENT31             0x8CFF
 #define GL_DEPTH_ATTACHMENT               0x8D00
 #define GL_STENCIL_ATTACHMENT             0x8D20
 #define GL_FRAMEBUFFER                    0x8D40
@@ -2875,17 +2859,6 @@ GLAPI void APIENTRY glTextureBarrier (void);
 #define GL_ARB_ES3_1_compatibility 1
 #endif /* GL_ARB_ES3_1_compatibility */
 
-#ifndef GL_ARB_ES3_2_compatibility
-#define GL_ARB_ES3_2_compatibility 1
-#define GL_PRIMITIVE_BOUNDING_BOX_ARB     0x92BE
-#define GL_MULTISAMPLE_LINE_WIDTH_RANGE_ARB 0x9381
-#define GL_MULTISAMPLE_LINE_WIDTH_GRANULARITY_ARB 0x9382
-typedef void (APIENTRYP PFNGLPRIMITIVEBOUNDINGBOXARBPROC) (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW);
-#ifdef GL_GLEXT_PROTOTYPES
-GLAPI void APIENTRY glPrimitiveBoundingBoxARB (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW);
-#endif
-#endif /* GL_ARB_ES3_2_compatibility */
-
 #ifndef GL_ARB_ES3_compatibility
 #define GL_ARB_ES3_compatibility 1
 #endif /* GL_ARB_ES3_compatibility */
@@ -3299,10 +3272,6 @@ GLAPI GLboolean APIENTRY glIsProgramARB (GLuint program);
 #define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_ARB 0x8B8B
 #endif /* GL_ARB_fragment_shader */
 
-#ifndef GL_ARB_fragment_shader_interlock
-#define GL_ARB_fragment_shader_interlock 1
-#endif /* GL_ARB_fragment_shader_interlock */
-
 #ifndef GL_ARB_framebuffer_no_attachments
 #define GL_ARB_framebuffer_no_attachments 1
 #endif /* GL_ARB_framebuffer_no_attachments */
@@ -3363,91 +3332,6 @@ GLAPI void APIENTRY glFramebufferTextureFaceARB (GLenum target, GLenum attachmen
 #define GL_ARB_gpu_shader_fp64 1
 #endif /* GL_ARB_gpu_shader_fp64 */
 
-#ifndef GL_ARB_gpu_shader_int64
-#define GL_ARB_gpu_shader_int64 1
-#define GL_INT64_ARB                      0x140E
-#define GL_INT64_VEC2_ARB                 0x8FE9
-#define GL_INT64_VEC3_ARB                 0x8FEA
-#define GL_INT64_VEC4_ARB                 0x8FEB
-#define GL_UNSIGNED_INT64_VEC2_ARB        0x8FF5
-#define GL_UNSIGNED_INT64_VEC3_ARB        0x8FF6
-#define GL_UNSIGNED_INT64_VEC4_ARB        0x8FF7
-typedef void (APIENTRYP PFNGLUNIFORM1I64ARBPROC) (GLint location, GLint64 x);
-typedef void (APIENTRYP PFNGLUNIFORM2I64ARBPROC) (GLint location, GLint64 x, GLint64 y);
-typedef void (APIENTRYP PFNGLUNIFORM3I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z);
-typedef void (APIENTRYP PFNGLUNIFORM4I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w);
-typedef void (APIENTRYP PFNGLUNIFORM1I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value);
-typedef void (APIENTRYP PFNGLUNIFORM2I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value);
-typedef void (APIENTRYP PFNGLUNIFORM3I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value);
-typedef void (APIENTRYP PFNGLUNIFORM4I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value);
-typedef void (APIENTRYP PFNGLUNIFORM1UI64ARBPROC) (GLint location, GLuint64 x);
-typedef void (APIENTRYP PFNGLUNIFORM2UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y);
-typedef void (APIENTRYP PFNGLUNIFORM3UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z);
-typedef void (APIENTRYP PFNGLUNIFORM4UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w);
-typedef void (APIENTRYP PFNGLUNIFORM1UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value);
-typedef void (APIENTRYP PFNGLUNIFORM2UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value);
-typedef void (APIENTRYP PFNGLUNIFORM3UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value);
-typedef void (APIENTRYP PFNGLUNIFORM4UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value);
-typedef void (APIENTRYP PFNGLGETUNIFORMI64VARBPROC) (GLuint program, GLint location, GLint64 *params);
-typedef void (APIENTRYP PFNGLGETUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLuint64 *params);
-typedef void (APIENTRYP PFNGLGETNUNIFORMI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLint64 *params);
-typedef void (APIENTRYP PFNGLGETNUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint64 *params);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64ARBPROC) (GLuint program, GLint location, GLint64 x);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64ARBPROC) (GLuint program, GLint location, GLuint64 x);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
-typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
-#ifdef GL_GLEXT_PROTOTYPES
-GLAPI void APIENTRY glUniform1i64ARB (GLint location, GLint64 x);
-GLAPI void APIENTRY glUniform2i64ARB (GLint location, GLint64 x, GLint64 y);
-GLAPI void APIENTRY glUniform3i64ARB (GLint location, GLint64 x, GLint64 y, GLint64 z);
-GLAPI void APIENTRY glUniform4i64ARB (GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w);
-GLAPI void APIENTRY glUniform1i64vARB (GLint location, GLsizei count, const GLint64 *value);
-GLAPI void APIENTRY glUniform2i64vARB (GLint location, GLsizei count, const GLint64 *value);
-GLAPI void APIENTRY glUniform3i64vARB (GLint location, GLsizei count, const GLint64 *value);
-GLAPI void APIENTRY glUniform4i64vARB (GLint location, GLsizei count, const GLint64 *value);
-GLAPI void APIENTRY glUniform1ui64ARB (GLint location, GLuint64 x);
-GLAPI void APIENTRY glUniform2ui64ARB (GLint location, GLuint64 x, GLuint64 y);
-GLAPI void APIENTRY glUniform3ui64ARB (GLint location, GLuint64 x, GLuint64 y, GLuint64 z);
-GLAPI void APIENTRY glUniform4ui64ARB (GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w);
-GLAPI void APIENTRY glUniform1ui64vARB (GLint location, GLsizei count, const GLuint64 *value);
-GLAPI void APIENTRY glUniform2ui64vARB (GLint location, GLsizei count, const GLuint64 *value);
-GLAPI void APIENTRY glUniform3ui64vARB (GLint location, GLsizei count, const GLuint64 *value);
-GLAPI void APIENTRY glUniform4ui64vARB (GLint location, GLsizei count, const GLuint64 *value);
-GLAPI void APIENTRY glGetUniformi64vARB (GLuint program, GLint location, GLint64 *params);
-GLAPI void APIENTRY glGetUniformui64vARB (GLuint program, GLint location, GLuint64 *params);
-GLAPI void APIENTRY glGetnUniformi64vARB (GLuint program, GLint location, GLsizei bufSize, GLint64 *params);
-GLAPI void APIENTRY glGetnUniformui64vARB (GLuint program, GLint location, GLsizei bufSize, GLuint64 *params);
-GLAPI void APIENTRY glProgramUniform1i64ARB (GLuint program, GLint location, GLint64 x);
-GLAPI void APIENTRY glProgramUniform2i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y);
-GLAPI void APIENTRY glProgramUniform3i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z);
-GLAPI void APIENTRY glProgramUniform4i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w);
-GLAPI void APIENTRY glProgramUniform1i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value);
-GLAPI void APIENTRY glProgramUniform2i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value);
-GLAPI void APIENTRY glProgramUniform3i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value);
-GLAPI void APIENTRY glProgramUniform4i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value);
-GLAPI void APIENTRY glProgramUniform1ui64ARB (GLuint program, GLint location, GLuint64 x);
-GLAPI void APIENTRY glProgramUniform2ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y);
-GLAPI void APIENTRY glProgramUniform3ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z);
-GLAPI void APIENTRY glProgramUniform4ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w);
-GLAPI void APIENTRY glProgramUniform1ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
-GLAPI void APIENTRY glProgramUniform2ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
-GLAPI void APIENTRY glProgramUniform3ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
-GLAPI void APIENTRY glProgramUniform4ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value);
-#endif
-#endif /* GL_ARB_gpu_shader_int64 */
-
 #ifndef GL_ARB_half_float_pixel
 #define GL_ARB_half_float_pixel 1
 typedef unsigned short GLhalfARB;
@@ -3827,16 +3711,6 @@ GLAPI void APIENTRY glGetQueryObjectuivARB (GLuint id, GLenum pname, GLuint *par
 #define GL_ARB_occlusion_query2 1
 #endif /* GL_ARB_occlusion_query2 */
 
-#ifndef GL_ARB_parallel_shader_compile
-#define GL_ARB_parallel_shader_compile 1
-#define GL_MAX_SHADER_COMPILER_THREADS_ARB 0x91B0
-#define GL_COMPLETION_STATUS_ARB          0x91B1
-typedef void (APIENTRYP PFNGLMAXSHADERCOMPILERTHREADSARBPROC) (GLuint count);
-#ifdef GL_GLEXT_PROTOTYPES
-GLAPI void APIENTRY glMaxShaderCompilerThreadsARB (GLuint count);
-#endif
-#endif /* GL_ARB_parallel_shader_compile */
-
 #ifndef GL_ARB_pipeline_statistics_query
 #define GL_ARB_pipeline_statistics_query 1
 #define GL_VERTICES_SUBMITTED_ARB         0x82EE
@@ -3879,10 +3753,6 @@ GLAPI void APIENTRY glPointParameterfvARB (GLenum pname, const GLfloat *params);
 #define GL_COORD_REPLACE_ARB              0x8862
 #endif /* GL_ARB_point_sprite */
 
-#ifndef GL_ARB_post_depth_coverage
-#define GL_ARB_post_depth_coverage 1
-#endif /* GL_ARB_post_depth_coverage */
-
 #ifndef GL_ARB_program_interface_query
 #define GL_ARB_program_interface_query 1
 #endif /* GL_ARB_program_interface_query */
@@ -3956,26 +3826,6 @@ GLAPI void APIENTRY glGetnMinmaxARB (GLenum target, GLboolean reset, GLenum form
 #define GL_ARB_robustness_isolation 1
 #endif /* GL_ARB_robustness_isolation */
 
-#ifndef GL_ARB_sample_locations
-#define GL_ARB_sample_locations 1
-#define GL_SAMPLE_LOCATION_SUBPIXEL_BITS_ARB 0x933D
-#define GL_SAMPLE_LOCATION_PIXEL_GRID_WIDTH_ARB 0x933E
-#define GL_SAMPLE_LOCATION_PIXEL_GRID_HEIGHT_ARB 0x933F
-#define GL_PROGRAMMABLE_SAMPLE_LOCATION_TABLE_SIZE_ARB 0x9340
-#define GL_SAMPLE_LOCATION_ARB            0x8E50
-#define GL_PROGRAMMABLE_SAMPLE_LOCATION_ARB 0x9341
-#define GL_FRAMEBUFFER_PROGRAMMABLE_SAMPLE_LOCATIONS_ARB 0x9342
-#define GL_FRAMEBUFFER_SAMPLE_LOCATION_PIXEL_GRID_ARB 0x9343
-typedef void (APIENTRYP PFNGLFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLenum target, GLuint start, GLsizei count, const GLfloat *v);
-typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v);
-typedef void (APIENTRYP PFNGLEVALUATEDEPTHVALUESARBPROC) (void);
-#ifdef GL_GLEXT_PROTOTYPES
-GLAPI void APIENTRY glFramebufferSampleLocationsfvARB (GLenum target, GLuint start, GLsizei count, const GLfloat *v);
-GLAPI void APIENTRY glNamedFramebufferSampleLocationsfvARB (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v);
-GLAPI void APIENTRY glEvaluateDepthValuesARB (void);
-#endif
-#endif /* GL_ARB_sample_locations */
-
 #ifndef GL_ARB_sample_shading
 #define GL_ARB_sample_shading 1
 #define GL_SAMPLE_SHADING_ARB             0x8C36
@@ -4002,26 +3852,14 @@ GLAPI void APIENTRY glMinSampleShadingARB (GLfloat value);
 #define GL_ARB_separate_shader_objects 1
 #endif /* GL_ARB_separate_shader_objects */
 
-#ifndef GL_ARB_shader_atomic_counter_ops
-#define GL_ARB_shader_atomic_counter_ops 1
-#endif /* GL_ARB_shader_atomic_counter_ops */
-
 #ifndef GL_ARB_shader_atomic_counters
 #define GL_ARB_shader_atomic_counters 1
 #endif /* GL_ARB_shader_atomic_counters */
 
-#ifndef GL_ARB_shader_ballot
-#define GL_ARB_shader_ballot 1
-#endif /* GL_ARB_shader_ballot */
-
 #ifndef GL_ARB_shader_bit_encoding
 #define GL_ARB_shader_bit_encoding 1
 #endif /* GL_ARB_shader_bit_encoding */
 
-#ifndef GL_ARB_shader_clock
-#define GL_ARB_shader_clock 1
-#endif /* GL_ARB_shader_clock */
-
 #ifndef GL_ARB_shader_draw_parameters
 #define GL_ARB_shader_draw_parameters 1
 #endif /* GL_ARB_shader_draw_parameters */
@@ -4041,12 +3879,7 @@ GLAPI void APIENTRY glMinSampleShadingARB (GLfloat value);
 #ifndef GL_ARB_shader_objects
 #define GL_ARB_shader_objects 1
 #ifdef __APPLE__
-#ifdef BUILDING_MESA
-/* Avoid uint <-> void* warnings */
-typedef unsigned long GLhandleARB;
-#else
 typedef void *GLhandleARB;
-#endif
 #else
 typedef unsigned int GLhandleARB;
 #endif
@@ -4191,10 +4024,6 @@ GLAPI void APIENTRY glGetShaderSourceARB (GLhandleARB obj, GLsizei maxLength, GL
 #define GL_ARB_shader_texture_lod 1
 #endif /* GL_ARB_shader_texture_lod */
 
-#ifndef GL_ARB_shader_viewport_layer_array
-#define GL_ARB_shader_viewport_layer_array 1
-#endif /* GL_ARB_shader_viewport_layer_array */
-
 #ifndef GL_ARB_shading_language_100
 #define GL_ARB_shading_language_100 1
 #define GL_SHADING_LANGUAGE_VERSION_ARB   0x8B8C
@@ -4268,20 +4097,12 @@ GLAPI void APIENTRY glNamedBufferPageCommitmentARB (GLuint buffer, GLintptr offs
 #define GL_MAX_SPARSE_3D_TEXTURE_SIZE_ARB 0x9199
 #define GL_MAX_SPARSE_ARRAY_TEXTURE_LAYERS_ARB 0x919A
 #define GL_SPARSE_TEXTURE_FULL_ARRAY_CUBE_MIPMAPS_ARB 0x91A9
-typedef void (APIENTRYP PFNGLTEXPAGECOMMITMENTARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit);
+typedef void (APIENTRYP PFNGLTEXPAGECOMMITMENTARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident);
 #ifdef GL_GLEXT_PROTOTYPES
-GLAPI void APIENTRY glTexPageCommitmentARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit);
+GLAPI void APIENTRY glTexPageCommitmentARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident);
 #endif
 #endif /* GL_ARB_sparse_texture */
 
-#ifndef GL_ARB_sparse_texture2
-#define GL_ARB_sparse_texture2 1
-#endif /* GL_ARB_sparse_texture2 */
-
-#ifndef GL_ARB_sparse_texture_clamp
-#define GL_ARB_sparse_texture_clamp 1
-#endif /* GL_ARB_sparse_texture_clamp */
-
 #ifndef GL_ARB_stencil_texturing
 #define GL_ARB_stencil_texturing 1
 #endif /* GL_ARB_stencil_texturing */
@@ -4434,12 +4255,6 @@ GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, void
 #define GL_DOT3_RGBA_ARB                  0x86AF
 #endif /* GL_ARB_texture_env_dot3 */
 
-#ifndef GL_ARB_texture_filter_minmax
-#define GL_ARB_texture_filter_minmax 1
-#define GL_TEXTURE_REDUCTION_MODE_ARB     0x9366
-#define GL_WEIGHTED_AVERAGE_ARB           0x9367
-#endif /* GL_ARB_texture_filter_minmax */
-
 #ifndef GL_ARB_texture_float
 #define GL_ARB_texture_float 1
 #define GL_TEXTURE_RED_TYPE_ARB           0x8C10
@@ -4934,11 +4749,6 @@ GLAPI void APIENTRY glBlendBarrierKHR (void);
 #define GL_KHR_debug 1
 #endif /* GL_KHR_debug */
 
-#ifndef GL_KHR_no_error
-#define GL_KHR_no_error 1
-#define GL_CONTEXT_FLAG_NO_ERROR_BIT_KHR  0x00000008
-#endif /* GL_KHR_no_error */
-
 #ifndef GL_KHR_robust_buffer_access_behavior
 #define GL_KHR_robust_buffer_access_behavior 1
 #endif /* GL_KHR_robust_buffer_access_behavior */
@@ -5081,6 +4891,7 @@ typedef void (APIENTRYP PFNGLPOINTPARAMETERXVOESPROC) (GLenum pname, const GLfix
 typedef void (APIENTRYP PFNGLPOINTSIZEXOESPROC) (GLfixed size);
 typedef void (APIENTRYP PFNGLPOLYGONOFFSETXOESPROC) (GLfixed factor, GLfixed units);
 typedef void (APIENTRYP PFNGLROTATEXOESPROC) (GLfixed angle, GLfixed x, GLfixed y, GLfixed z);
+typedef void (APIENTRYP PFNGLSAMPLECOVERAGEOESPROC) (GLfixed value, GLboolean invert);
 typedef void (APIENTRYP PFNGLSCALEXOESPROC) (GLfixed x, GLfixed y, GLfixed z);
 typedef void (APIENTRYP PFNGLTEXENVXOESPROC) (GLenum target, GLenum pname, GLfixed param);
 typedef void (APIENTRYP PFNGLTEXENVXVOESPROC) (GLenum target, GLenum pname, const GLfixed *params);
@@ -5185,6 +4996,7 @@ GLAPI void APIENTRY glPointParameterxvOES (GLenum pname, const GLfixed *params);
 GLAPI void APIENTRY glPointSizexOES (GLfixed size);
 GLAPI void APIENTRY glPolygonOffsetxOES (GLfixed factor, GLfixed units);
 GLAPI void APIENTRY glRotatexOES (GLfixed angle, GLfixed x, GLfixed y, GLfixed z);
+GLAPI void APIENTRY glSampleCoverageOES (GLfixed value, GLboolean invert);
 GLAPI void APIENTRY glScalexOES (GLfixed x, GLfixed y, GLfixed z);
 GLAPI void APIENTRY glTexEnvxOES (GLenum target, GLenum pname, GLfixed param);
 GLAPI void APIENTRY glTexEnvxvOES (GLenum target, GLenum pname, const GLfixed *params);
@@ -6898,7 +6710,7 @@ typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBLFORMATEXTPROC) (GLuint vaob
 typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBBINDINGEXTPROC) (GLuint vaobj, GLuint attribindex, GLuint bindingindex);
 typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXBINDINGDIVISOREXTPROC) (GLuint vaobj, GLuint bindingindex, GLuint divisor);
 typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBLOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset);
-typedef void (APIENTRYP PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit);
+typedef void (APIENTRYP PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident);
 typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBDIVISOREXTPROC) (GLuint vaobj, GLuint index, GLuint divisor);
 #ifdef GL_GLEXT_PROTOTYPES
 GLAPI void APIENTRY glMatrixLoadfEXT (GLenum mode, const GLfloat *m);
@@ -7154,7 +6966,7 @@ GLAPI void APIENTRY glVertexArrayVertexAttribLFormatEXT (GLuint vaobj, GLuint at
 GLAPI void APIENTRY glVertexArrayVertexAttribBindingEXT (GLuint vaobj, GLuint attribindex, GLuint bindingindex);
 GLAPI void APIENTRY glVertexArrayVertexBindingDivisorEXT (GLuint vaobj, GLuint bindingindex, GLuint divisor);
 GLAPI void APIENTRY glVertexArrayVertexAttribLOffsetEXT (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset);
-GLAPI void APIENTRY glTexturePageCommitmentEXT (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit);
+GLAPI void APIENTRY glTexturePageCommitmentEXT (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident);
 GLAPI void APIENTRY glVertexArrayVertexAttribDivisorEXT (GLuint vaobj, GLuint index, GLuint divisor);
 #endif
 #endif /* GL_EXT_direct_state_access */
@@ -8818,14 +8630,6 @@ GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum sfactorRGB, GLenum dfactorRG
 #define GL_INTEL_fragment_shader_ordering 1
 #endif /* GL_INTEL_fragment_shader_ordering */
 
-#ifndef GL_INTEL_framebuffer_CMAA
-#define GL_INTEL_framebuffer_CMAA 1
-typedef void (APIENTRYP PFNGLAPPLYFRAMEBUFFERATTACHMENTCMAAINTELPROC) (void);
-#ifdef GL_GLEXT_PROTOTYPES
-GLAPI void APIENTRY glApplyFramebufferAttachmentCMAAINTEL (void);
-#endif
-#endif /* GL_INTEL_framebuffer_CMAA */
-
 #ifndef GL_INTEL_map_texture
 #define GL_INTEL_map_texture 1
 #define GL_TEXTURE_MEMORY_LAYOUT_INTEL    0x83FF
@@ -9130,65 +8934,6 @@ GLAPI void APIENTRY glBlendBarrierNV (void);
 #define GL_NV_blend_square 1
 #endif /* GL_NV_blend_square */
 
-#ifndef GL_NV_command_list
-#define GL_NV_command_list 1
-#define GL_TERMINATE_SEQUENCE_COMMAND_NV  0x0000
-#define GL_NOP_COMMAND_NV                 0x0001
-#define GL_DRAW_ELEMENTS_COMMAND_NV       0x0002
-#define GL_DRAW_ARRAYS_COMMAND_NV         0x0003
-#define GL_DRAW_ELEMENTS_STRIP_COMMAND_NV 0x0004
-#define GL_DRAW_ARRAYS_STRIP_COMMAND_NV   0x0005
-#define GL_DRAW_ELEMENTS_INSTANCED_COMMAND_NV 0x0006
-#define GL_DRAW_ARRAYS_INSTANCED_COMMAND_NV 0x0007
-#define GL_ELEMENT_ADDRESS_COMMAND_NV     0x0008
-#define GL_ATTRIBUTE_ADDRESS_COMMAND_NV   0x0009
-#define GL_UNIFORM_ADDRESS_COMMAND_NV     0x000A
-#define GL_BLEND_COLOR_COMMAND_NV         0x000B
-#define GL_STENCIL_REF_COMMAND_NV         0x000C
-#define GL_LINE_WIDTH_COMMAND_NV          0x000D
-#define GL_POLYGON_OFFSET_COMMAND_NV      0x000E
-#define GL_ALPHA_REF_COMMAND_NV           0x000F
-#define GL_VIEWPORT_COMMAND_NV            0x0010
-#define GL_SCISSOR_COMMAND_NV             0x0011
-#define GL_FRONT_FACE_COMMAND_NV          0x0012
-typedef void (APIENTRYP PFNGLCREATESTATESNVPROC) (GLsizei n, GLuint *states);
-typedef void (APIENTRYP PFNGLDELETESTATESNVPROC) (GLsizei n, const GLuint *states);
-typedef GLboolean (APIENTRYP PFNGLISSTATENVPROC) (GLuint state);
-typedef void (APIENTRYP PFNGLSTATECAPTURENVPROC) (GLuint state, GLenum mode);
-typedef GLuint (APIENTRYP PFNGLGETCOMMANDHEADERNVPROC) (GLenum tokenID, GLuint size);
-typedef GLushort (APIENTRYP PFNGLGETSTAGEINDEXNVPROC) (GLenum shadertype);
-typedef void (APIENTRYP PFNGLDRAWCOMMANDSNVPROC) (GLenum primitiveMode, GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, GLuint count);
-typedef void (APIENTRYP PFNGLDRAWCOMMANDSADDRESSNVPROC) (GLenum primitiveMode, const GLuint64 *indirects, const GLsizei *sizes, GLuint count);
-typedef void (APIENTRYP PFNGLDRAWCOMMANDSSTATESNVPROC) (GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count);
-typedef void (APIENTRYP PFNGLDRAWCOMMANDSSTATESADDRESSNVPROC) (const GLuint64 *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count);
-typedef void (APIENTRYP PFNGLCREATECOMMANDLISTSNVPROC) (GLsizei n, GLuint *lists);
-typedef void (APIENTRYP PFNGLDELETECOMMANDLISTSNVPROC) (GLsizei n, const GLuint *lists);
-typedef GLboolean (APIENTRYP PFNGLISCOMMANDLISTNVPROC) (GLuint list);
-typedef void (APIENTRYP PFNGLLISTDRAWCOMMANDSSTATESCLIENTNVPROC) (GLuint list, GLuint segment, const void **indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count);
-typedef void (APIENTRYP PFNGLCOMMANDLISTSEGMENTSNVPROC) (GLuint list, GLuint segments);
-typedef void (APIENTRYP PFNGLCOMPILECOMMANDLISTNVPROC) (GLuint list);
-typedef void (APIENTRYP PFNGLCALLCOMMANDLISTNVPROC) (GLuint list);
-#ifdef GL_GLEXT_PROTOTYPES
-GLAPI void APIENTRY glCreateStatesNV (GLsizei n, GLuint *states);
-GLAPI void APIENTRY glDeleteStatesNV (GLsizei n, const GLuint *states);
-GLAPI GLboolean APIENTRY glIsStateNV (GLuint state);
-GLAPI void APIENTRY glStateCaptureNV (GLuint state, GLenum mode);
-GLAPI GLuint APIENTRY glGetCommandHeaderNV (GLenum tokenID, GLuint size);
-GLAPI GLushort APIENTRY glGetStageIndexNV (GLenum shadertype);
-GLAPI void APIENTRY glDrawCommandsNV (GLenum primitiveMode, GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, GLuint count);
-GLAPI void APIENTRY glDrawCommandsAddressNV (GLenum primitiveMode, const GLuint64 *indirects, const GLsizei *sizes, GLuint count);
-GLAPI void APIENTRY glDrawCommandsStatesNV (GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count);
-GLAPI void APIENTRY glDrawCommandsStatesAddressNV (const GLuint64 *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count);
-GLAPI void APIENTRY glCreateCommandListsNV (GLsizei n, GLuint *lists);
-GLAPI void APIENTRY glDeleteCommandListsNV (GLsizei n, const GLuint *lists);
-GLAPI GLboolean APIENTRY glIsCommandListNV (GLuint list);
-GLAPI void APIENTRY glListDrawCommandsStatesClientNV (GLuint list, GLuint segment, const void **indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count);
-GLAPI void APIENTRY glCommandListSegmentsNV (GLuint list, GLuint segments);
-GLAPI void APIENTRY glCompileCommandListNV (GLuint list);
-GLAPI void APIENTRY glCallCommandListNV (GLuint list);
-#endif
-#endif /* GL_NV_command_list */
-
 #ifndef GL_NV_compute_program5
 #define GL_NV_compute_program5 1
 #define GL_COMPUTE_PROGRAM_NV             0x90FB
@@ -9221,17 +8966,6 @@ GLAPI void APIENTRY glSubpixelPrecisionBiasNV (GLuint xbits, GLuint ybits);
 #endif
 #endif /* GL_NV_conservative_raster */
 
-#ifndef GL_NV_conservative_raster_dilate
-#define GL_NV_conservative_raster_dilate 1
-#define GL_CONSERVATIVE_RASTER_DILATE_NV  0x9379
-#define GL_CONSERVATIVE_RASTER_DILATE_RANGE_NV 0x937A
-#define GL_CONSERVATIVE_RASTER_DILATE_GRANULARITY_NV 0x937B
-typedef void (APIENTRYP PFNGLCONSERVATIVERASTERPARAMETERFNVPROC) (GLenum pname, GLfloat value);
-#ifdef GL_GLEXT_PROTOTYPES
-GLAPI void APIENTRY glConservativeRasterParameterfNV (GLenum pname, GLfloat value);
-#endif
-#endif /* GL_NV_conservative_raster_dilate */
-
 #ifndef GL_NV_copy_depth_to_color
 #define GL_NV_copy_depth_to_color 1
 #define GL_DEPTH_STENCIL_TO_RGBA_NV       0x886E
@@ -11111,21 +10845,6 @@ GLAPI void APIENTRY glVideoCaptureStreamParameterdvNV (GLuint video_capture_slot
 #define GL_FORMAT_SUBSAMPLE_244_244_OML   0x8983
 #endif /* GL_OML_subsample */
 
-#ifndef GL_OVR_multiview
-#define GL_OVR_multiview 1
-#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_NUM_VIEWS_OVR 0x9630
-#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_BASE_VIEW_INDEX_OVR 0x9632
-#define GL_MAX_VIEWS_OVR                  0x9631
-typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREMULTIVIEWOVRPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews);
-#ifdef GL_GLEXT_PROTOTYPES
-GLAPI void APIENTRY glFramebufferTextureMultiviewOVR (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews);
-#endif
-#endif /* GL_OVR_multiview */
-
-#ifndef GL_OVR_multiview2
-#define GL_OVR_multiview2 1
-#endif /* GL_OVR_multiview2 */
-
 #ifndef GL_PGI_misc_hints
 #define GL_PGI_misc_hints 1
 #define GL_PREFER_DOUBLEBUFFER_HINT_PGI   0x1A1F8

include/GL/glx.h

@@ -368,6 +368,18 @@ extern Bool glXDrawableAttribARB(Display *dpy, GLXDrawable draw, const int *attr
 #endif /* GLX_ARB_render_texture */
 
 
+/*
+ * Remove this when glxext.h is updated.
+ */
+#ifndef GLX_NV_float_buffer
+#define GLX_NV_float_buffer 1
+
+#define GLX_FLOAT_COMPONENTS_NV         0x20B0
+
+#endif /* GLX_NV_float_buffer */
+
+
+
 /*
  * #?. GLX_MESA_swap_frame_usage
  */
@@ -403,6 +415,86 @@ typedef int (*PFNGLXGETSWAPINTERVALMESAPROC)(void);
 #endif /* GLX_MESA_swap_control */
 
 
+
+/*
+ * #?. GLX_EXT_texture_from_pixmap
+ * XXX not finished?
+ */
+#ifndef GLX_EXT_texture_from_pixmap
+#define GLX_EXT_texture_from_pixmap 1
+
+#define GLX_BIND_TO_TEXTURE_RGB_EXT        0x20D0
+#define GLX_BIND_TO_TEXTURE_RGBA_EXT       0x20D1
+#define GLX_BIND_TO_MIPMAP_TEXTURE_EXT     0x20D2
+#define GLX_BIND_TO_TEXTURE_TARGETS_EXT    0x20D3
+#define GLX_Y_INVERTED_EXT                 0x20D4
+
+#define GLX_TEXTURE_FORMAT_EXT             0x20D5
+#define GLX_TEXTURE_TARGET_EXT             0x20D6
+#define GLX_MIPMAP_TEXTURE_EXT             0x20D7
+
+#define GLX_TEXTURE_FORMAT_NONE_EXT        0x20D8
+#define GLX_TEXTURE_FORMAT_RGB_EXT         0x20D9
+#define GLX_TEXTURE_FORMAT_RGBA_EXT        0x20DA
+
+#define GLX_TEXTURE_1D_BIT_EXT             0x00000001
+#define GLX_TEXTURE_2D_BIT_EXT             0x00000002
+#define GLX_TEXTURE_RECTANGLE_BIT_EXT      0x00000004
+
+#define GLX_TEXTURE_1D_EXT                 0x20DB
+#define GLX_TEXTURE_2D_EXT                 0x20DC
+#define GLX_TEXTURE_RECTANGLE_EXT          0x20DD
+
+#define GLX_FRONT_LEFT_EXT                 0x20DE
+#define GLX_FRONT_RIGHT_EXT                0x20DF
+#define GLX_BACK_LEFT_EXT                  0x20E0
+#define GLX_BACK_RIGHT_EXT                 0x20E1
+#define GLX_FRONT_EXT                      GLX_FRONT_LEFT_EXT
+#define GLX_BACK_EXT                       GLX_BACK_LEFT_EXT
+#define GLX_AUX0_EXT                       0x20E2
+#define GLX_AUX1_EXT                       0x20E3 
+#define GLX_AUX2_EXT                       0x20E4 
+#define GLX_AUX3_EXT                       0x20E5 
+#define GLX_AUX4_EXT                       0x20E6 
+#define GLX_AUX5_EXT                       0x20E7 
+#define GLX_AUX6_EXT                       0x20E8
+#define GLX_AUX7_EXT                       0x20E9 
+#define GLX_AUX8_EXT                       0x20EA 
+#define GLX_AUX9_EXT                       0x20EB
+
+extern void glXBindTexImageEXT(Display *dpy, GLXDrawable drawable, int buffer, const int *attrib_list);
+extern void glXReleaseTexImageEXT(Display *dpy, GLXDrawable drawable, int buffer);
+
+#endif /* GLX_EXT_texture_from_pixmap */
+
+
+#ifndef GLX_MESA_query_renderer
+#define GLX_MESA_query_renderer 1
+
+#define GLX_RENDERER_VENDOR_ID_MESA                      0x8183
+#define GLX_RENDERER_DEVICE_ID_MESA                      0x8184
+#define GLX_RENDERER_VERSION_MESA                        0x8185
+#define GLX_RENDERER_ACCELERATED_MESA                    0x8186
+#define GLX_RENDERER_VIDEO_MEMORY_MESA                   0x8187
+#define GLX_RENDERER_UNIFIED_MEMORY_ARCHITECTURE_MESA    0x8188
+#define GLX_RENDERER_PREFERRED_PROFILE_MESA              0x8189
+#define GLX_RENDERER_OPENGL_CORE_PROFILE_VERSION_MESA    0x818A
+#define GLX_RENDERER_OPENGL_COMPATIBILITY_PROFILE_VERSION_MESA    0x818B
+#define GLX_RENDERER_OPENGL_ES_PROFILE_VERSION_MESA      0x818C
+#define GLX_RENDERER_OPENGL_ES2_PROFILE_VERSION_MESA     0x818D
+#define GLX_RENDERER_ID_MESA                             0x818E
+
+Bool glXQueryRendererIntegerMESA(Display *dpy, int screen, int renderer, int attribute, unsigned int *value);
+Bool glXQueryCurrentRendererIntegerMESA(int attribute, unsigned int *value);
+const char *glXQueryRendererStringMESA(Display *dpy, int screen, int renderer, int attribute);
+const char *glXQueryCurrentRendererStringMESA(int attribute);
+
+typedef Bool (*PFNGLXQUERYRENDERERINTEGERMESAPROC) (Display *dpy, int screen, int renderer, int attribute, unsigned int *value);
+typedef Bool (*PFNGLXQUERYCURRENTRENDERERINTEGERMESAPROC) (int attribute, unsigned int *value);
+typedef const char *(*PFNGLXQUERYRENDERERSTRINGMESAPROC) (Display *dpy, int screen, int renderer, int attribute);
+typedef const char *(*PFNGLXQUERYCURRENTRENDERERSTRINGMESAPROC) (int attribute);
+#endif /* GLX_MESA_query_renderer */
+
 /*** Should these go here, or in another header? */
 /*
 ** GLX Events

include/GL/internal/dri_interface.h

@@ -40,7 +40,14 @@
 #ifndef DRI_INTERFACE_H
 #define DRI_INTERFACE_H
 
-#ifdef HAVE_LIBDRM
+/* For archs with no drm.h */
+#if defined(__APPLE__) || defined(__CYGWIN__) || defined(__GNU__)
+#ifndef __NOT_HAVE_DRM_H
+#define __NOT_HAVE_DRM_H
+#endif
+#endif
+
+#ifndef __NOT_HAVE_DRM_H
 #include <drm.h>
 #else
 typedef unsigned int drm_context_t;
@@ -78,7 +85,6 @@ typedef struct __DRIdri2ExtensionRec		__DRIdri2Extension;
 typedef struct __DRIdri2LoaderExtensionRec	__DRIdri2LoaderExtension;
 typedef struct __DRI2flushExtensionRec	__DRI2flushExtension;
 typedef struct __DRI2throttleExtensionRec	__DRI2throttleExtension;
-typedef struct __DRI2fenceExtensionRec          __DRI2fenceExtension;
 
 
 typedef struct __DRIimageLoaderExtensionRec     __DRIimageLoaderExtension;
@@ -333,65 +339,6 @@ struct __DRI2throttleExtensionRec {
 		    enum __DRI2throttleReason reason);
 };
 
-
-/**
- * Extension for fences / synchronization objects.
- */
-
-#define __DRI2_FENCE "DRI2_Fence"
-#define __DRI2_FENCE_VERSION 1
-
-#define __DRI2_FENCE_TIMEOUT_INFINITE     0xffffffffffffffffllu
-
-#define __DRI2_FENCE_FLAG_FLUSH_COMMANDS  (1 << 0)
-
-struct __DRI2fenceExtensionRec {
-   __DRIextension base;
-
-   /**
-    * Create and insert a fence into the command stream of the context.
-    */
-   void *(*create_fence)(__DRIcontext *ctx);
-
-   /**
-    * Get a fence associated with the OpenCL event object.
-    * This can be NULL, meaning that OpenCL interoperability is not supported.
-    */
-   void *(*get_fence_from_cl_event)(__DRIscreen *screen, intptr_t cl_event);
-
-   /**
-    * Destroy a fence.
-    */
-   void (*destroy_fence)(__DRIscreen *screen, void *fence);
-
-   /**
-    * This function waits and doesn't return until the fence is signalled
-    * or the timeout expires. It returns true if the fence has been signaled.
-    *
-    * \param ctx     the context where commands are flushed
-    * \param fence   the fence
-    * \param flags   a combination of __DRI2_FENCE_FLAG_xxx flags
-    * \param timeout the timeout in ns or __DRI2_FENCE_TIMEOUT_INFINITE
-    */
-   GLboolean (*client_wait_sync)(__DRIcontext *ctx, void *fence,
-                                 unsigned flags, uint64_t timeout);
-
-   /**
-    * This function enqueues a wait command into the command stream of
-    * the context and then returns. When the execution reaches the wait
-    * command, no further execution will be done in the context until
-    * the fence is signaled. This is a no-op if the device doesn't support
-    * parallel execution of contexts.
-    *
-    * \param ctx     the context where the waiting is done
-    * \param fence   the fence
-    * \param flags   a combination of __DRI2_FENCE_FLAG_xxx flags that make
-    *                sense with this function (right now there are none)
-    */
-   void (*server_wait_sync)(__DRIcontext *ctx, void *fence, unsigned flags);
-};
-
-
 /*@}*/
 
 /**
@@ -495,7 +442,7 @@ struct __DRIdamageExtensionRec {
  * SWRast Loader extension.
  */
 #define __DRI_SWRAST_LOADER "DRI_SWRastLoader"
-#define __DRI_SWRAST_LOADER_VERSION 3
+#define __DRI_SWRAST_LOADER_VERSION 2
 struct __DRIswrastLoaderExtensionRec {
     __DRIextension base;
 
@@ -528,15 +475,6 @@ struct __DRIswrastLoaderExtensionRec {
     void (*putImage2)(__DRIdrawable *drawable, int op,
                       int x, int y, int width, int height, int stride,
                       char *data, void *loaderPrivate);
-
-   /**
-     * Put image to drawable
-     *
-     * \since 3
-     */
-   void (*getImage2)(__DRIdrawable *readable,
-		     int x, int y, int width, int height, int stride,
-		     char *data, void *loaderPrivate);
 };
 
 /**
@@ -1068,7 +1006,7 @@ struct __DRIdri2ExtensionRec {
  * extensions.
  */
 #define __DRI_IMAGE "DRI_IMAGE"
-#define __DRI_IMAGE_VERSION 11
+#define __DRI_IMAGE_VERSION 10
 
 /**
  * These formats correspond to the similarly named MESA_FORMAT_*
@@ -1103,15 +1041,12 @@ struct __DRIdri2ExtensionRec {
 
 
 /**
- * Four CC formats that matches with WL_DRM_FORMAT_* from wayland_drm.h,
- * GBM_FORMAT_* from gbm.h, and DRM_FORMAT_* from drm_fourcc.h. Used with
- * createImageFromNames.
+ * Four CC formats that matches with WL_DRM_FORMAT_* from wayland_drm.h
+ * and GBM_FORMAT_* from gbm.h, used with createImageFromNames.
  *
  * \since 5
  */
 
-#define __DRI_IMAGE_FOURCC_R8		0x20203852
-#define __DRI_IMAGE_FOURCC_GR88		0x38385247
 #define __DRI_IMAGE_FOURCC_RGB565	0x36314752
 #define __DRI_IMAGE_FOURCC_ARGB8888	0x34325241
 #define __DRI_IMAGE_FOURCC_XRGB8888	0x34325258
@@ -1146,8 +1081,6 @@ struct __DRIdri2ExtensionRec {
 #define __DRI_IMAGE_COMPONENTS_Y_U_V	0x3003
 #define __DRI_IMAGE_COMPONENTS_Y_UV	0x3004
 #define __DRI_IMAGE_COMPONENTS_Y_XUXV	0x3005
-#define __DRI_IMAGE_COMPONENTS_R	0x3006
-#define __DRI_IMAGE_COMPONENTS_RG	0x3007
 
 
 /**
@@ -1164,8 +1097,6 @@ struct __DRIdri2ExtensionRec {
 #define __DRI_IMAGE_ATTRIB_FD           0x2007 /* available in versions
                                                 * 7+. Each query will return a
                                                 * new fd. */
-#define __DRI_IMAGE_ATTRIB_FOURCC       0x2008 /* available in versions 11 */
-#define __DRI_IMAGE_ATTRIB_NUM_PLANES   0x2009 /* available in versions 11 */
 
 enum __DRIYUVColorSpace {
    __DRI_YUV_COLOR_SPACE_UNDEFINED = 0,
@@ -1187,8 +1118,7 @@ enum __DRIChromaSiting {
 };
 
 /**
- * \name Reasons that __DRIimageExtensionRec::createImageFromTexture or
- * __DRIimageExtensionRec::createImageFromDmaBufs might fail
+ * \name Reasons that __DRIimageExtensionRec::createImageFromTexture might fail
  */
 /*@{*/
 /** Success! */
@@ -1197,14 +1127,11 @@ enum __DRIChromaSiting {
 /** Memory allocation failure */
 #define __DRI_IMAGE_ERROR_BAD_ALLOC     1
 
-/** Client requested an invalid attribute */
+/** Client requested an invalid attribute for a texture object  */
 #define __DRI_IMAGE_ERROR_BAD_MATCH     2
 
 /** Client requested an invalid texture object */
 #define __DRI_IMAGE_ERROR_BAD_PARAMETER 3
-
-/** Client requested an invalid pitch and/or offset */
-#define __DRI_IMAGE_ERROR_BAD_ACCESS    4
 /*@}*/
 
 /**
@@ -1455,11 +1382,6 @@ typedef struct __DRIDriverVtableExtensionRec {
 #define __DRI2_RENDERER_OPENGL_COMPATIBILITY_PROFILE_VERSION  0x0008
 #define __DRI2_RENDERER_OPENGL_ES_PROFILE_VERSION             0x0009
 #define __DRI2_RENDERER_OPENGL_ES2_PROFILE_VERSION            0x000a
-#define __DRI2_RENDERER_HAS_TEXTURE_3D                        0x000b
-/* Whether there is an sRGB format support for every supported 32-bit UNORM
- * color format.
- */
-#define __DRI2_RENDERER_HAS_FRAMEBUFFER_SRGB                  0x000c
 
 typedef struct __DRI2rendererQueryExtensionRec __DRI2rendererQueryExtension;
 struct __DRI2rendererQueryExtensionRec {

include/GL/osmesa.h

@@ -41,8 +41,10 @@
  *   OSMesaGetIntegerv - return OSMesa state parameters
  *
  *
- * The limits on the width and height of an image buffer can be retrieved
- * via OSMesaGetIntegerv(OSMESA_MAX_WIDTH/OSMESA_MAX_HEIGHT).
+ * The limits on the width and height of an image buffer are MAX_WIDTH and
+ * MAX_HEIGHT as defined in Mesa/src/config.h.  Defaults are 1280 and 1024.
+ * You can increase them as needed but beware that many temporary arrays in
+ * Mesa are dimensioned by MAX_WIDTH or MAX_HEIGHT.
  */
 
 
@@ -58,8 +60,8 @@ extern "C" {
 #include <GL/gl.h>
 
 
-#define OSMESA_MAJOR_VERSION 11
-#define OSMESA_MINOR_VERSION 2
+#define OSMESA_MAJOR_VERSION 10
+#define OSMESA_MINOR_VERSION 0
 #define OSMESA_PATCH_VERSION 0
 
 
@@ -95,18 +97,6 @@ extern "C" {
 #define OSMESA_MAX_WIDTH	0x24  /* new in 4.0 */
 #define OSMESA_MAX_HEIGHT	0x25  /* new in 4.0 */
 
-/*
- * Accepted in OSMesaCreateContextAttrib's attribute list.
- */
-#define OSMESA_DEPTH_BITS            0x30
-#define OSMESA_STENCIL_BITS          0x31
-#define OSMESA_ACCUM_BITS            0x32
-#define OSMESA_PROFILE               0x33
-#define OSMESA_CORE_PROFILE          0x34
-#define OSMESA_COMPAT_PROFILE        0x35
-#define OSMESA_CONTEXT_MAJOR_VERSION 0x36
-#define OSMESA_CONTEXT_MINOR_VERSION 0x37
-
 
 typedef struct osmesa_context *OSMesaContext;
 
@@ -139,35 +129,6 @@ OSMesaCreateContextExt( GLenum format, GLint depthBits, GLint stencilBits,
                         GLint accumBits, OSMesaContext sharelist);
 
 
-/*
- * Create an Off-Screen Mesa rendering context with attribute list.
- * The list is composed of (attribute, value) pairs and terminated with
- * attribute==0.  Supported Attributes:
- *
- * Attributes                    Values
- * --------------------------------------------------------------------------
- * OSMESA_FORMAT                 OSMESA_RGBA*, OSMESA_BGRA, OSMESA_ARGB, etc.
- * OSMESA_DEPTH_BITS             0*, 16, 24, 32
- * OSMESA_STENCIL_BITS           0*, 8
- * OSMESA_ACCUM_BITS             0*, 16
- * OSMESA_PROFILE                OSMESA_COMPAT_PROFILE*, OSMESA_CORE_PROFILE
- * OSMESA_CONTEXT_MAJOR_VERSION  1*, 2, 3
- * OSMESA_CONTEXT_MINOR_VERSION  0+
- *
- * Note: * = default value
- *
- * We return a context version >= what's specified by OSMESA_CONTEXT_MAJOR/
- * MINOR_VERSION for the given profile.  For example, if you request a GL 1.4
- * compat profile, you might get a GL 3.0 compat profile.
- * Otherwise, null is returned if the version/profile is not supported.
- *
- * New in Mesa 11.2
- */
-GLAPI OSMesaContext GLAPIENTRY
-OSMesaCreateContextAttribs( const int *attribList, OSMesaContext sharelist );
-
-
-
 /*
  * Destroy an Off-Screen Mesa rendering context.
  *

include/GL/wmesa.h

@@ -0,0 +1,140 @@
+/*
+ * Mesa 3-D graphics library
+ * Copyright (C) 1995-1998  Brian Paul
+ *
+ * This library is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2 of the License, or (at your option) any later version.
+ *
+ * This library is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
+ * Library General Public License for more details.
+ *
+ * You should have received a copy of the GNU Library General Public
+ * License along with this library; if not, write to the Free
+ * Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
+ *
+ */
+
+
+/*
+ * Windows driver by: Mark E. Peterson (markp@ic.mankato.mn.us)
+ * Updated by Li Wei (liwei@aiar.xjtu.edu.cn)
+ *
+ *
+ ***************************************************************
+ *                     WMesa                                   *
+ *                     version 2.3                             *	
+ *                                                             *
+ *                        By                                   *
+ *                      Li Wei                                 *
+ *       Institute of Artificial Intelligence & Robotics       *
+ *       Xi'an Jiaotong University                             *
+ *       Email: liwei@aiar.xjtu.edu.cn                         * 
+ *       Web page: http://sun.aiar.xjtu.edu.cn                 *
+ *                                                             *
+ *	       July 7th, 1997				       *
+ ***************************************************************
+ */
+
+
+#ifndef WMESA_H
+#define WMESA_H
+
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+
+#include "GL/gl.h"
+
+#if defined(_MSV_VER) && !defined(__GNUC__)
+#  pragma warning (disable:4273)
+#  pragma warning( disable : 4244 ) /* '=' : conversion from 'const double ' to 'float ', possible loss of data */
+#  pragma warning( disable : 4018 ) /* '<' : signed/unsigned mismatch */
+#  pragma warning( disable : 4305 ) /* '=' : truncation from 'const double ' to 'float ' */
+#  pragma warning( disable : 4013 ) /* 'function' undefined; assuming extern returning int */
+#  pragma warning( disable : 4761 ) /* integral size mismatch in argument; conversion supplied */
+#  pragma warning( disable : 4273 ) /* 'identifier' : inconsistent DLL linkage. dllexport assumed */
+#  if (MESA_WARNQUIET>1)
+#    pragma warning( disable : 4146 ) /* unary minus operator applied to unsigned type, result still unsigned */
+#  endif
+#endif
+
+/*
+ * This is the WMesa context 'handle':
+ */
+typedef struct wmesa_context *WMesaContext;
+
+
+
+/*
+ * Create a new WMesaContext for rendering into a window.  You must
+ * have already created the window of correct visual type and with an
+ * appropriate colormap.
+ *
+ * Input:
+ *         hDC - Windows device or memory context
+ *         Pal  - Palette to use
+ *         rgb_flag - GL_TRUE = RGB mode,
+ *                    GL_FALSE = color index mode
+ *         db_flag - GL_TRUE = double-buffered,
+ *                   GL_FALSE = single buffered
+ *         alpha_flag - GL_TRUE = create software alpha buffer,
+ *                      GL_FALSE = no software alpha buffer
+ *
+ * Note: Indexed mode requires double buffering under Windows.
+ *
+ * Return:  a WMesa_context or NULL if error.
+ */
+extern WMesaContext WMesaCreateContext(HDC hDC,HPALETTE* pPal,
+                                       GLboolean rgb_flag,
+                                       GLboolean db_flag,
+                                       GLboolean alpha_flag);
+
+
+/*
+ * Destroy a rendering context as returned by WMesaCreateContext()
+ */
+extern void WMesaDestroyContext( WMesaContext ctx );
+
+
+
+/*
+ * Make the specified context the current one.
+ */
+extern void WMesaMakeCurrent( WMesaContext ctx, HDC hdc );
+
+
+/*
+ * Return a handle to the current context.
+ */
+extern WMesaContext WMesaGetCurrentContext( void );
+
+
+/*
+ * Swap the front and back buffers for the current context.  No action
+ * taken if the context is not double buffered.
+ */
+extern void WMesaSwapBuffers(HDC hdc);
+
+
+/*
+ * In indexed color mode we need to know when the palette changes.
+ */
+extern void WMesaPaletteChange(HPALETTE Pal);
+
+extern void WMesaMove(void);
+
+void WMesaShareLists(WMesaContext ctx_to_share, WMesaContext ctx);
+
+#ifdef __cplusplus
+}
+#endif
+
+
+#endif
+

include/KHR/khrplatform.h

@@ -26,7 +26,7 @@
 
 /* Khronos platform-specific types and definitions.
  *
- * $Revision: 23298 $ on $Date: 2013-09-30 17:07:13 -0700 (Mon, 30 Sep 2013) $
+ * $Revision: 9356 $ on $Date: 2009-10-21 02:52:25 -0700 (Wed, 21 Oct 2009) $
  *
  * Adopters may modify this file to suit their platform. Adopters are
  * encouraged to submit platform specific modifications to the Khronos
@@ -106,9 +106,9 @@
 #elif defined (__SYMBIAN32__)
 #   define KHRONOS_APICALL IMPORT_C
 #elif (defined(__GNUC__) && (__GNUC__ * 100 + __GNUC_MINOR__) >= 303) \
-       || (defined(__SUNPRO_C) && (__SUNPRO_C >= 0x590))
+	|| (defined(__SUNPRO_C) && (__SUNPRO_C >= 0x590))
 /* KHRONOS_APIATTRIBUTES is not used by the client API headers yet */
-#   define KHRONOS_APICALL __attribute__((visibility("default")))
+#  define KHRONOS_APICALL __attribute__((visibility("default")))
 #else
 #   define KHRONOS_APICALL
 #endif
@@ -229,23 +229,10 @@ typedef signed   char          khronos_int8_t;
 typedef unsigned char          khronos_uint8_t;
 typedef signed   short int     khronos_int16_t;
 typedef unsigned short int     khronos_uint16_t;
-
-/*
- * Types that differ between LLP64 and LP64 architectures - in LLP64, 
- * pointers are 64 bits, but 'long' is still 32 bits. Win64 appears
- * to be the only LLP64 architecture in current use.
- */
-#ifdef _WIN64
-typedef signed   long long int khronos_intptr_t;
-typedef unsigned long long int khronos_uintptr_t;
-typedef signed   long long int khronos_ssize_t;
-typedef unsigned long long int khronos_usize_t;
-#else
 typedef signed   long  int     khronos_intptr_t;
 typedef unsigned long  int     khronos_uintptr_t;
 typedef signed   long  int     khronos_ssize_t;
 typedef unsigned long  int     khronos_usize_t;
-#endif
 
 #if KHRONOS_SUPPORT_FLOAT
 /*

include/VG/openvg.h

@@ -0,0 +1,746 @@
+/* $Revision: 9203 $ on $Date:: 2009-10-07 02:21:52 -0700 #$ */
+
+/*------------------------------------------------------------------------
+ *
+ * OpenVG 1.1 Reference Implementation
+ * -------------------------------------
+ *
+ * Copyright (c) 2008 The Khronos Group Inc.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and /or associated documentation files
+ * (the "Materials "), to deal in the Materials without restriction,
+ * including without limitation the rights to use, copy, modify, merge,
+ * publish, distribute, sublicense, and/or sell copies of the Materials,
+ * and to permit persons to whom the Materials are furnished to do so,
+ * subject to the following conditions: 
+ *
+ * The above copyright notice and this permission notice shall be included 
+ * in all copies or substantial portions of the Materials. 
+ *
+ * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+ * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+ * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
+ * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
+ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
+ * THE USE OR OTHER DEALINGS IN THE MATERIALS.
+ *
+ *//**
+ * \file
+ * \brief	OpenVG 1.1 API.
+ *//*-------------------------------------------------------------------*/
+
+#ifndef _OPENVG_H
+#define _OPENVG_H
+
+#include <VG/vgplatform.h>
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+#define OPENVG_VERSION_1_0		1
+#define OPENVG_VERSION_1_0_1	1
+#define OPENVG_VERSION_1_1		2
+
+#ifndef VG_MAXSHORT
+#define VG_MAXSHORT 0x7FFF
+#endif
+
+#ifndef VG_MAXINT
+#define VG_MAXINT 0x7FFFFFFF
+#endif
+
+#ifndef VG_MAX_ENUM
+#define VG_MAX_ENUM 0x7FFFFFFF
+#endif
+
+typedef VGuint VGHandle;
+
+typedef VGHandle VGPath;
+typedef VGHandle VGImage;
+typedef VGHandle VGMaskLayer;
+typedef VGHandle VGFont;
+typedef VGHandle VGPaint;
+
+#define VG_INVALID_HANDLE ((VGHandle)0)
+
+typedef enum {
+  VG_FALSE               = 0,
+  VG_TRUE                = 1,
+
+  VG_BOOLEAN_FORCE_SIZE  = VG_MAX_ENUM
+} VGboolean;
+
+typedef enum {
+  VG_NO_ERROR                                 = 0,
+  VG_BAD_HANDLE_ERROR                         = 0x1000,
+  VG_ILLEGAL_ARGUMENT_ERROR                   = 0x1001,
+  VG_OUT_OF_MEMORY_ERROR                      = 0x1002,
+  VG_PATH_CAPABILITY_ERROR                    = 0x1003,
+  VG_UNSUPPORTED_IMAGE_FORMAT_ERROR           = 0x1004,
+  VG_UNSUPPORTED_PATH_FORMAT_ERROR            = 0x1005,
+  VG_IMAGE_IN_USE_ERROR                       = 0x1006,
+  VG_NO_CONTEXT_ERROR                         = 0x1007,
+
+  VG_ERROR_CODE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGErrorCode;
+
+typedef enum {
+  /* Mode settings */
+  VG_MATRIX_MODE                              = 0x1100,
+  VG_FILL_RULE                                = 0x1101,
+  VG_IMAGE_QUALITY                            = 0x1102,
+  VG_RENDERING_QUALITY                        = 0x1103,
+  VG_BLEND_MODE                               = 0x1104,
+  VG_IMAGE_MODE                               = 0x1105,
+
+  /* Scissoring rectangles */
+  VG_SCISSOR_RECTS                            = 0x1106,
+
+  /* Color Transformation */
+  VG_COLOR_TRANSFORM                          = 0x1170,
+  VG_COLOR_TRANSFORM_VALUES                   = 0x1171,
+
+  /* Stroke parameters */
+  VG_STROKE_LINE_WIDTH                        = 0x1110,
+  VG_STROKE_CAP_STYLE                         = 0x1111,
+  VG_STROKE_JOIN_STYLE                        = 0x1112,
+  VG_STROKE_MITER_LIMIT                       = 0x1113,
+  VG_STROKE_DASH_PATTERN                      = 0x1114,
+  VG_STROKE_DASH_PHASE                        = 0x1115,
+  VG_STROKE_DASH_PHASE_RESET                  = 0x1116,
+
+  /* Edge fill color for VG_TILE_FILL tiling mode */
+  VG_TILE_FILL_COLOR                          = 0x1120,
+
+  /* Color for vgClear */
+  VG_CLEAR_COLOR                              = 0x1121,
+
+  /* Glyph origin */
+  VG_GLYPH_ORIGIN                             = 0x1122,
+
+  /* Enable/disable alpha masking and scissoring */
+  VG_MASKING                                  = 0x1130,
+  VG_SCISSORING                               = 0x1131,
+
+  /* Pixel layout information */
+  VG_PIXEL_LAYOUT                             = 0x1140,
+  VG_SCREEN_LAYOUT                            = 0x1141,
+
+  /* Source format selection for image filters */
+  VG_FILTER_FORMAT_LINEAR                     = 0x1150,
+  VG_FILTER_FORMAT_PREMULTIPLIED              = 0x1151,
+
+  /* Destination write enable mask for image filters */
+  VG_FILTER_CHANNEL_MASK                      = 0x1152,
+
+  /* Implementation limits (read-only) */
+  VG_MAX_SCISSOR_RECTS                        = 0x1160,
+  VG_MAX_DASH_COUNT                           = 0x1161,
+  VG_MAX_KERNEL_SIZE                          = 0x1162,
+  VG_MAX_SEPARABLE_KERNEL_SIZE                = 0x1163,
+  VG_MAX_COLOR_RAMP_STOPS                     = 0x1164,
+  VG_MAX_IMAGE_WIDTH                          = 0x1165,
+  VG_MAX_IMAGE_HEIGHT                         = 0x1166,
+  VG_MAX_IMAGE_PIXELS                         = 0x1167,
+  VG_MAX_IMAGE_BYTES                          = 0x1168,
+  VG_MAX_FLOAT                                = 0x1169,
+  VG_MAX_GAUSSIAN_STD_DEVIATION               = 0x116A,
+
+  VG_PARAM_TYPE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGParamType;
+
+typedef enum {
+  VG_RENDERING_QUALITY_NONANTIALIASED         = 0x1200,
+  VG_RENDERING_QUALITY_FASTER                 = 0x1201,
+  VG_RENDERING_QUALITY_BETTER                 = 0x1202, /* Default */
+
+  VG_RENDERING_QUALITY_FORCE_SIZE             = VG_MAX_ENUM
+} VGRenderingQuality;
+
+typedef enum {
+  VG_PIXEL_LAYOUT_UNKNOWN                     = 0x1300,
+  VG_PIXEL_LAYOUT_RGB_VERTICAL                = 0x1301,
+  VG_PIXEL_LAYOUT_BGR_VERTICAL                = 0x1302,
+  VG_PIXEL_LAYOUT_RGB_HORIZONTAL              = 0x1303,
+  VG_PIXEL_LAYOUT_BGR_HORIZONTAL              = 0x1304,
+
+  VG_PIXEL_LAYOUT_FORCE_SIZE                  = VG_MAX_ENUM
+} VGPixelLayout;
+
+typedef enum {
+  VG_MATRIX_PATH_USER_TO_SURFACE              = 0x1400,
+  VG_MATRIX_IMAGE_USER_TO_SURFACE             = 0x1401,
+  VG_MATRIX_FILL_PAINT_TO_USER                = 0x1402,
+  VG_MATRIX_STROKE_PAINT_TO_USER              = 0x1403,
+  VG_MATRIX_GLYPH_USER_TO_SURFACE             = 0x1404,
+
+  VG_MATRIX_MODE_FORCE_SIZE                   = VG_MAX_ENUM
+} VGMatrixMode;
+
+typedef enum {
+  VG_CLEAR_MASK                               = 0x1500,
+  VG_FILL_MASK                                = 0x1501,
+  VG_SET_MASK                                 = 0x1502,
+  VG_UNION_MASK                               = 0x1503,
+  VG_INTERSECT_MASK                           = 0x1504,
+  VG_SUBTRACT_MASK                            = 0x1505,
+
+  VG_MASK_OPERATION_FORCE_SIZE                = VG_MAX_ENUM
+} VGMaskOperation;
+
+#define VG_PATH_FORMAT_STANDARD 0
+
+typedef enum {
+  VG_PATH_DATATYPE_S_8                        =  0,
+  VG_PATH_DATATYPE_S_16                       =  1,
+  VG_PATH_DATATYPE_S_32                       =  2,
+  VG_PATH_DATATYPE_F                          =  3,
+
+  VG_PATH_DATATYPE_FORCE_SIZE                 = VG_MAX_ENUM
+} VGPathDatatype;
+
+typedef enum {
+  VG_ABSOLUTE                                 = 0,
+  VG_RELATIVE                                 = 1,
+
+  VG_PATH_ABS_REL_FORCE_SIZE                  = VG_MAX_ENUM
+} VGPathAbsRel;
+
+typedef enum {
+  VG_CLOSE_PATH                               = ( 0 << 1),
+  VG_MOVE_TO                                  = ( 1 << 1),
+  VG_LINE_TO                                  = ( 2 << 1),
+  VG_HLINE_TO                                 = ( 3 << 1),
+  VG_VLINE_TO                                 = ( 4 << 1),
+  VG_QUAD_TO                                  = ( 5 << 1),
+  VG_CUBIC_TO                                 = ( 6 << 1),
+  VG_SQUAD_TO                                 = ( 7 << 1),
+  VG_SCUBIC_TO                                = ( 8 << 1),
+  VG_SCCWARC_TO                               = ( 9 << 1),
+  VG_SCWARC_TO                                = (10 << 1),
+  VG_LCCWARC_TO                               = (11 << 1),
+  VG_LCWARC_TO                                = (12 << 1),
+
+  VG_PATH_SEGMENT_FORCE_SIZE                  = VG_MAX_ENUM
+} VGPathSegment;
+
+typedef enum {
+  VG_MOVE_TO_ABS                              = VG_MOVE_TO    | VG_ABSOLUTE,
+  VG_MOVE_TO_REL                              = VG_MOVE_TO    | VG_RELATIVE,
+  VG_LINE_TO_ABS                              = VG_LINE_TO    | VG_ABSOLUTE,
+  VG_LINE_TO_REL                              = VG_LINE_TO    | VG_RELATIVE,
+  VG_HLINE_TO_ABS                             = VG_HLINE_TO   | VG_ABSOLUTE,
+  VG_HLINE_TO_REL                             = VG_HLINE_TO   | VG_RELATIVE,
+  VG_VLINE_TO_ABS                             = VG_VLINE_TO   | VG_ABSOLUTE,
+  VG_VLINE_TO_REL                             = VG_VLINE_TO   | VG_RELATIVE,
+  VG_QUAD_TO_ABS                              = VG_QUAD_TO    | VG_ABSOLUTE,
+  VG_QUAD_TO_REL                              = VG_QUAD_TO    | VG_RELATIVE,
+  VG_CUBIC_TO_ABS                             = VG_CUBIC_TO   | VG_ABSOLUTE,
+  VG_CUBIC_TO_REL                             = VG_CUBIC_TO   | VG_RELATIVE,
+  VG_SQUAD_TO_ABS                             = VG_SQUAD_TO   | VG_ABSOLUTE,
+  VG_SQUAD_TO_REL                             = VG_SQUAD_TO   | VG_RELATIVE,
+  VG_SCUBIC_TO_ABS                            = VG_SCUBIC_TO  | VG_ABSOLUTE,
+  VG_SCUBIC_TO_REL                            = VG_SCUBIC_TO  | VG_RELATIVE,
+  VG_SCCWARC_TO_ABS                           = VG_SCCWARC_TO | VG_ABSOLUTE,
+  VG_SCCWARC_TO_REL                           = VG_SCCWARC_TO | VG_RELATIVE,
+  VG_SCWARC_TO_ABS                            = VG_SCWARC_TO  | VG_ABSOLUTE,
+  VG_SCWARC_TO_REL                            = VG_SCWARC_TO  | VG_RELATIVE,
+  VG_LCCWARC_TO_ABS                           = VG_LCCWARC_TO | VG_ABSOLUTE,
+  VG_LCCWARC_TO_REL                           = VG_LCCWARC_TO | VG_RELATIVE,
+  VG_LCWARC_TO_ABS                            = VG_LCWARC_TO  | VG_ABSOLUTE,
+  VG_LCWARC_TO_REL                            = VG_LCWARC_TO  | VG_RELATIVE,
+
+  VG_PATH_COMMAND_FORCE_SIZE                  = VG_MAX_ENUM
+} VGPathCommand;
+
+typedef enum {
+  VG_PATH_CAPABILITY_APPEND_FROM              = (1 <<  0),
+  VG_PATH_CAPABILITY_APPEND_TO                = (1 <<  1),
+  VG_PATH_CAPABILITY_MODIFY                   = (1 <<  2),
+  VG_PATH_CAPABILITY_TRANSFORM_FROM           = (1 <<  3),
+  VG_PATH_CAPABILITY_TRANSFORM_TO             = (1 <<  4),
+  VG_PATH_CAPABILITY_INTERPOLATE_FROM         = (1 <<  5),
+  VG_PATH_CAPABILITY_INTERPOLATE_TO           = (1 <<  6),
+  VG_PATH_CAPABILITY_PATH_LENGTH              = (1 <<  7),
+  VG_PATH_CAPABILITY_POINT_ALONG_PATH         = (1 <<  8),
+  VG_PATH_CAPABILITY_TANGENT_ALONG_PATH       = (1 <<  9),
+  VG_PATH_CAPABILITY_PATH_BOUNDS              = (1 << 10),
+  VG_PATH_CAPABILITY_PATH_TRANSFORMED_BOUNDS  = (1 << 11),
+  VG_PATH_CAPABILITY_ALL                      = (1 << 12) - 1,
+
+  VG_PATH_CAPABILITIES_FORCE_SIZE             = VG_MAX_ENUM
+} VGPathCapabilities;
+
+typedef enum {
+  VG_PATH_FORMAT                              = 0x1600,
+  VG_PATH_DATATYPE                            = 0x1601,
+  VG_PATH_SCALE                               = 0x1602,
+  VG_PATH_BIAS                                = 0x1603,
+  VG_PATH_NUM_SEGMENTS                        = 0x1604,
+  VG_PATH_NUM_COORDS                          = 0x1605,
+
+  VG_PATH_PARAM_TYPE_FORCE_SIZE               = VG_MAX_ENUM
+} VGPathParamType;
+
+typedef enum {
+  VG_CAP_BUTT                                 = 0x1700,
+  VG_CAP_ROUND                                = 0x1701,
+  VG_CAP_SQUARE                               = 0x1702,
+
+  VG_CAP_STYLE_FORCE_SIZE                     = VG_MAX_ENUM
+} VGCapStyle;
+
+typedef enum {
+  VG_JOIN_MITER                               = 0x1800,
+  VG_JOIN_ROUND                               = 0x1801,
+  VG_JOIN_BEVEL                               = 0x1802,
+
+  VG_JOIN_STYLE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGJoinStyle;
+
+typedef enum {
+  VG_EVEN_ODD                                 = 0x1900,
+  VG_NON_ZERO                                 = 0x1901,
+
+  VG_FILL_RULE_FORCE_SIZE                     = VG_MAX_ENUM
+} VGFillRule;
+
+typedef enum {
+  VG_STROKE_PATH                              = (1 << 0),
+  VG_FILL_PATH                                = (1 << 1),
+
+  VG_PAINT_MODE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGPaintMode;
+
+typedef enum {
+  /* Color paint parameters */
+  VG_PAINT_TYPE                               = 0x1A00,
+  VG_PAINT_COLOR                              = 0x1A01,
+  VG_PAINT_COLOR_RAMP_SPREAD_MODE             = 0x1A02,
+  VG_PAINT_COLOR_RAMP_PREMULTIPLIED           = 0x1A07,
+  VG_PAINT_COLOR_RAMP_STOPS                   = 0x1A03,
+
+  /* Linear gradient paint parameters */
+  VG_PAINT_LINEAR_GRADIENT                    = 0x1A04,
+
+  /* Radial gradient paint parameters */
+  VG_PAINT_RADIAL_GRADIENT                    = 0x1A05,
+
+  /* Pattern paint parameters */
+  VG_PAINT_PATTERN_TILING_MODE                = 0x1A06,
+
+  VG_PAINT_PARAM_TYPE_FORCE_SIZE              = VG_MAX_ENUM
+} VGPaintParamType;
+
+typedef enum {
+  VG_PAINT_TYPE_COLOR                         = 0x1B00,
+  VG_PAINT_TYPE_LINEAR_GRADIENT               = 0x1B01,
+  VG_PAINT_TYPE_RADIAL_GRADIENT               = 0x1B02,
+  VG_PAINT_TYPE_PATTERN                       = 0x1B03,
+
+  VG_PAINT_TYPE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGPaintType;
+
+typedef enum {
+  VG_COLOR_RAMP_SPREAD_PAD                    = 0x1C00,
+  VG_COLOR_RAMP_SPREAD_REPEAT                 = 0x1C01,
+  VG_COLOR_RAMP_SPREAD_REFLECT                = 0x1C02,
+
+  VG_COLOR_RAMP_SPREAD_MODE_FORCE_SIZE        = VG_MAX_ENUM
+} VGColorRampSpreadMode;
+
+typedef enum {
+  VG_TILE_FILL                                = 0x1D00,
+  VG_TILE_PAD                                 = 0x1D01,
+  VG_TILE_REPEAT                              = 0x1D02,
+  VG_TILE_REFLECT                             = 0x1D03,
+
+  VG_TILING_MODE_FORCE_SIZE                   = VG_MAX_ENUM
+} VGTilingMode;
+
+typedef enum {
+  /* RGB{A,X} channel ordering */
+  VG_sRGBX_8888                               =  0,
+  VG_sRGBA_8888                               =  1,
+  VG_sRGBA_8888_PRE                           =  2,
+  VG_sRGB_565                                 =  3,
+  VG_sRGBA_5551                               =  4,
+  VG_sRGBA_4444                               =  5,
+  VG_sL_8                                     =  6,
+  VG_lRGBX_8888                               =  7,
+  VG_lRGBA_8888                               =  8,
+  VG_lRGBA_8888_PRE                           =  9,
+  VG_lL_8                                     = 10,
+  VG_A_8                                      = 11,
+  VG_BW_1                                     = 12,
+  VG_A_1                                      = 13,
+  VG_A_4                                      = 14,
+
+  /* {A,X}RGB channel ordering */
+  VG_sXRGB_8888                               =  0 | (1 << 6),
+  VG_sARGB_8888                               =  1 | (1 << 6),
+  VG_sARGB_8888_PRE                           =  2 | (1 << 6),
+  VG_sARGB_1555                               =  4 | (1 << 6),
+  VG_sARGB_4444                               =  5 | (1 << 6),
+  VG_lXRGB_8888                               =  7 | (1 << 6),
+  VG_lARGB_8888                               =  8 | (1 << 6),
+  VG_lARGB_8888_PRE                           =  9 | (1 << 6),
+
+  /* BGR{A,X} channel ordering */
+  VG_sBGRX_8888                               =  0 | (1 << 7),
+  VG_sBGRA_8888                               =  1 | (1 << 7),
+  VG_sBGRA_8888_PRE                           =  2 | (1 << 7),
+  VG_sBGR_565                                 =  3 | (1 << 7),
+  VG_sBGRA_5551                               =  4 | (1 << 7),
+  VG_sBGRA_4444                               =  5 | (1 << 7),
+  VG_lBGRX_8888                               =  7 | (1 << 7),
+  VG_lBGRA_8888                               =  8 | (1 << 7),
+  VG_lBGRA_8888_PRE                           =  9 | (1 << 7),
+
+  /* {A,X}BGR channel ordering */
+  VG_sXBGR_8888                               =  0 | (1 << 6) | (1 << 7),
+  VG_sABGR_8888                               =  1 | (1 << 6) | (1 << 7),
+  VG_sABGR_8888_PRE                           =  2 | (1 << 6) | (1 << 7),
+  VG_sABGR_1555                               =  4 | (1 << 6) | (1 << 7),
+  VG_sABGR_4444                               =  5 | (1 << 6) | (1 << 7),
+  VG_lXBGR_8888                               =  7 | (1 << 6) | (1 << 7),
+  VG_lABGR_8888                               =  8 | (1 << 6) | (1 << 7),
+  VG_lABGR_8888_PRE                           =  9 | (1 << 6) | (1 << 7),
+
+  VG_IMAGE_FORMAT_FORCE_SIZE                  = VG_MAX_ENUM
+} VGImageFormat;
+
+typedef enum {
+  VG_IMAGE_QUALITY_NONANTIALIASED             = (1 << 0),
+  VG_IMAGE_QUALITY_FASTER                     = (1 << 1),
+  VG_IMAGE_QUALITY_BETTER                     = (1 << 2),
+
+  VG_IMAGE_QUALITY_FORCE_SIZE                 = VG_MAX_ENUM
+} VGImageQuality;
+
+typedef enum {
+  VG_IMAGE_FORMAT                             = 0x1E00,
+  VG_IMAGE_WIDTH                              = 0x1E01,
+  VG_IMAGE_HEIGHT                             = 0x1E02,
+
+  VG_IMAGE_PARAM_TYPE_FORCE_SIZE              = VG_MAX_ENUM
+} VGImageParamType;
+
+typedef enum {
+  VG_DRAW_IMAGE_NORMAL                        = 0x1F00,
+  VG_DRAW_IMAGE_MULTIPLY                      = 0x1F01,
+  VG_DRAW_IMAGE_STENCIL                       = 0x1F02,
+
+  VG_IMAGE_MODE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGImageMode;
+
+typedef enum {
+  VG_RED                                      = (1 << 3),
+  VG_GREEN                                    = (1 << 2),
+  VG_BLUE                                     = (1 << 1),
+  VG_ALPHA                                    = (1 << 0),
+
+  VG_IMAGE_CHANNEL_FORCE_SIZE                 = VG_MAX_ENUM
+} VGImageChannel;
+
+typedef enum {
+  VG_BLEND_SRC                                = 0x2000,
+  VG_BLEND_SRC_OVER                           = 0x2001,
+  VG_BLEND_DST_OVER                           = 0x2002,
+  VG_BLEND_SRC_IN                             = 0x2003,
+  VG_BLEND_DST_IN                             = 0x2004,
+  VG_BLEND_MULTIPLY                           = 0x2005,
+  VG_BLEND_SCREEN                             = 0x2006,
+  VG_BLEND_DARKEN                             = 0x2007,
+  VG_BLEND_LIGHTEN                            = 0x2008,
+  VG_BLEND_ADDITIVE                           = 0x2009,
+
+  VG_BLEND_MODE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGBlendMode;
+
+typedef enum {
+  VG_FONT_NUM_GLYPHS                          = 0x2F00,
+
+  VG_FONT_PARAM_TYPE_FORCE_SIZE               = VG_MAX_ENUM
+} VGFontParamType;
+
+typedef enum {
+  VG_IMAGE_FORMAT_QUERY                       = 0x2100,
+  VG_PATH_DATATYPE_QUERY                      = 0x2101,
+
+  VG_HARDWARE_QUERY_TYPE_FORCE_SIZE           = VG_MAX_ENUM
+} VGHardwareQueryType;
+
+typedef enum {
+  VG_HARDWARE_ACCELERATED                     = 0x2200,
+  VG_HARDWARE_UNACCELERATED                   = 0x2201,
+
+  VG_HARDWARE_QUERY_RESULT_FORCE_SIZE         = VG_MAX_ENUM
+} VGHardwareQueryResult;
+
+typedef enum {
+  VG_VENDOR                                   = 0x2300,
+  VG_RENDERER                                 = 0x2301,
+  VG_VERSION                                  = 0x2302,
+  VG_EXTENSIONS                               = 0x2303,
+
+  VG_STRING_ID_FORCE_SIZE                     = VG_MAX_ENUM
+} VGStringID;
+
+/* Function Prototypes */
+
+#ifndef VG_API_CALL
+#	error VG_API_CALL must be defined
+#endif
+
+#ifndef VG_API_ENTRY
+#   error VG_API_ENTRY must be defined 
+#endif
+
+#ifndef VG_API_EXIT
+#   error VG_API_EXIT must be defined 
+#endif
+
+VG_API_CALL VGErrorCode VG_API_ENTRY vgGetError(void) VG_API_EXIT;
+
+VG_API_CALL void VG_API_ENTRY vgFlush(void) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgFinish(void) VG_API_EXIT;
+
+/* Getters and Setters */
+VG_API_CALL void VG_API_ENTRY vgSetf (VGParamType type, VGfloat value) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSeti (VGParamType type, VGint value) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetfv(VGParamType type, VGint count,
+                         const VGfloat * values) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetiv(VGParamType type, VGint count,
+                         const VGint * values) VG_API_EXIT;
+
+VG_API_CALL VGfloat VG_API_ENTRY vgGetf(VGParamType type) VG_API_EXIT;
+VG_API_CALL VGint VG_API_ENTRY vgGeti(VGParamType type) VG_API_EXIT;
+VG_API_CALL VGint VG_API_ENTRY vgGetVectorSize(VGParamType type) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetfv(VGParamType type, VGint count, VGfloat * values) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetiv(VGParamType type, VGint count, VGint * values) VG_API_EXIT;
+
+VG_API_CALL void VG_API_ENTRY vgSetParameterf(VGHandle object,
+                                 VGint paramType,
+                                 VGfloat value) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetParameteri(VGHandle object,
+                                 VGint paramType,
+                                 VGint value) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetParameterfv(VGHandle object,
+                                  VGint paramType,
+                                  VGint count, const VGfloat * values) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetParameteriv(VGHandle object,
+                                  VGint paramType,
+                                  VGint count, const VGint * values) VG_API_EXIT;
+
+VG_API_CALL VGfloat VG_API_ENTRY vgGetParameterf(VGHandle object,
+                                    VGint paramType) VG_API_EXIT;
+VG_API_CALL VGint VG_API_ENTRY vgGetParameteri(VGHandle object,
+                                  VGint paramType);
+VG_API_CALL VGint VG_API_ENTRY vgGetParameterVectorSize(VGHandle object,
+                                           VGint paramType) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetParameterfv(VGHandle object,
+                                  VGint paramType,
+                                  VGint count, VGfloat * values) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetParameteriv(VGHandle object,
+                                  VGint paramType,
+                                  VGint count, VGint * values) VG_API_EXIT;
+
+/* Matrix Manipulation */
+VG_API_CALL void VG_API_ENTRY vgLoadIdentity(void) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgLoadMatrix(const VGfloat * m) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetMatrix(VGfloat * m) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgMultMatrix(const VGfloat * m) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgTranslate(VGfloat tx, VGfloat ty) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgScale(VGfloat sx, VGfloat sy) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgShear(VGfloat shx, VGfloat shy) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgRotate(VGfloat angle) VG_API_EXIT;
+
+/* Masking and Clearing */
+VG_API_CALL void VG_API_ENTRY vgMask(VGHandle mask, VGMaskOperation operation,
+                                     VGint x, VGint y,
+                                     VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgRenderToMask(VGPath path,
+                                            VGbitfield paintModes,
+                                            VGMaskOperation operation) VG_API_EXIT;
+VG_API_CALL VGMaskLayer VG_API_ENTRY vgCreateMaskLayer(VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDestroyMaskLayer(VGMaskLayer maskLayer) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgFillMaskLayer(VGMaskLayer maskLayer,
+                                             VGint x, VGint y,
+                                             VGint width, VGint height,
+                                             VGfloat value) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgCopyMask(VGMaskLayer maskLayer,
+                                        VGint dx, VGint dy,
+                                        VGint sx, VGint sy,
+                                        VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgClear(VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
+
+/* Paths */
+VG_API_CALL VGPath VG_API_ENTRY vgCreatePath(VGint pathFormat,
+                                VGPathDatatype datatype,
+                                VGfloat scale, VGfloat bias,
+                                VGint segmentCapacityHint,
+                                VGint coordCapacityHint,
+                                VGbitfield capabilities) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgClearPath(VGPath path, VGbitfield capabilities) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDestroyPath(VGPath path) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgRemovePathCapabilities(VGPath path,
+                                          VGbitfield capabilities) VG_API_EXIT;
+VG_API_CALL VGbitfield VG_API_ENTRY vgGetPathCapabilities(VGPath path) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgAppendPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgAppendPathData(VGPath dstPath,
+                                  VGint numSegments,
+                                  const VGubyte * pathSegments,
+                                  const void * pathData) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgModifyPathCoords(VGPath dstPath, VGint startIndex,
+                                    VGint numSegments,
+                                    const void * pathData) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgTransformPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT;
+VG_API_CALL VGboolean VG_API_ENTRY vgInterpolatePath(VGPath dstPath,
+                                        VGPath startPath,
+                                        VGPath endPath,
+                                        VGfloat amount) VG_API_EXIT;
+VG_API_CALL VGfloat VG_API_ENTRY vgPathLength(VGPath path,
+                                 VGint startSegment, VGint numSegments) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgPointAlongPath(VGPath path,
+                                  VGint startSegment, VGint numSegments,
+                                  VGfloat distance,
+                                  VGfloat * x, VGfloat * y,
+                                  VGfloat * tangentX, VGfloat * tangentY) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgPathBounds(VGPath path,
+                              VGfloat * minX, VGfloat * minY,
+                              VGfloat * width, VGfloat * height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgPathTransformedBounds(VGPath path,
+                                         VGfloat * minX, VGfloat * minY,
+                                         VGfloat * width, VGfloat * height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDrawPath(VGPath path, VGbitfield paintModes) VG_API_EXIT;
+
+/* Paint */
+VG_API_CALL VGPaint VG_API_ENTRY vgCreatePaint(void) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDestroyPaint(VGPaint paint) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetPaint(VGPaint paint, VGbitfield paintModes) VG_API_EXIT;
+VG_API_CALL VGPaint VG_API_ENTRY vgGetPaint(VGPaintMode paintMode) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetColor(VGPaint paint, VGuint rgba) VG_API_EXIT;
+VG_API_CALL VGuint VG_API_ENTRY vgGetColor(VGPaint paint) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgPaintPattern(VGPaint paint, VGImage pattern) VG_API_EXIT;
+
+/* Images */
+VG_API_CALL VGImage VG_API_ENTRY vgCreateImage(VGImageFormat format,
+                                  VGint width, VGint height,
+                                  VGbitfield allowedQuality) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDestroyImage(VGImage image) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgClearImage(VGImage image,
+                              VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgImageSubData(VGImage image,
+                                const void * data, VGint dataStride,
+                                VGImageFormat dataFormat,
+                                VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetImageSubData(VGImage image,
+                                   void * data, VGint dataStride,
+                                   VGImageFormat dataFormat,
+                                   VGint x, VGint y,
+                                   VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL VGImage VG_API_ENTRY vgChildImage(VGImage parent,
+                                 VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL VGImage VG_API_ENTRY vgGetParent(VGImage image) VG_API_EXIT; 
+VG_API_CALL void VG_API_ENTRY vgCopyImage(VGImage dst, VGint dx, VGint dy,
+                             VGImage src, VGint sx, VGint sy,
+                             VGint width, VGint height,
+                             VGboolean dither) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDrawImage(VGImage image) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetPixels(VGint dx, VGint dy,
+                             VGImage src, VGint sx, VGint sy,
+                             VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgWritePixels(const void * data, VGint dataStride,
+                               VGImageFormat dataFormat,
+                               VGint dx, VGint dy,
+                               VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetPixels(VGImage dst, VGint dx, VGint dy,
+                             VGint sx, VGint sy,
+                             VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgReadPixels(void * data, VGint dataStride,
+                              VGImageFormat dataFormat,
+                              VGint sx, VGint sy,
+                              VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgCopyPixels(VGint dx, VGint dy,
+                              VGint sx, VGint sy,
+                              VGint width, VGint height) VG_API_EXIT;
+
+/* Text */
+VG_API_CALL VGFont VG_API_ENTRY vgCreateFont(VGint glyphCapacityHint) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDestroyFont(VGFont font) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetGlyphToPath(VGFont font,
+                                              VGuint glyphIndex,
+                                              VGPath path,
+                                              VGboolean isHinted,
+                                              const VGfloat glyphOrigin [2],
+                                              const VGfloat escapement[2]) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetGlyphToImage(VGFont font,
+                                               VGuint glyphIndex,
+                                               VGImage image,
+                                               const VGfloat glyphOrigin [2],
+                                               const VGfloat escapement[2]) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgClearGlyph(VGFont font,VGuint glyphIndex) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDrawGlyph(VGFont font, 
+                                         VGuint glyphIndex,
+                                         VGbitfield paintModes,
+                                         VGboolean allowAutoHinting) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDrawGlyphs(VGFont font,
+                                          VGint glyphCount,
+                                          const VGuint *glyphIndices,
+                                          const VGfloat *adjustments_x,
+                                          const VGfloat *adjustments_y,
+                                          VGbitfield paintModes,
+                                          VGboolean allowAutoHinting) VG_API_EXIT;
+
+/* Image Filters */
+VG_API_CALL void VG_API_ENTRY vgColorMatrix(VGImage dst, VGImage src,
+                               const VGfloat * matrix) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgConvolve(VGImage dst, VGImage src,
+                            VGint kernelWidth, VGint kernelHeight,
+                            VGint shiftX, VGint shiftY,
+                            const VGshort * kernel,
+                            VGfloat scale,
+                            VGfloat bias,
+                            VGTilingMode tilingMode) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSeparableConvolve(VGImage dst, VGImage src,
+                                     VGint kernelWidth,
+                                     VGint kernelHeight,
+                                     VGint shiftX, VGint shiftY,
+                                     const VGshort * kernelX,
+                                     const VGshort * kernelY,
+                                     VGfloat scale,
+                                     VGfloat bias,
+                                     VGTilingMode tilingMode) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGaussianBlur(VGImage dst, VGImage src,
+                                VGfloat stdDeviationX,
+                                VGfloat stdDeviationY,
+                                VGTilingMode tilingMode) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgLookup(VGImage dst, VGImage src,
+                          const VGubyte * redLUT,
+                          const VGubyte * greenLUT,
+                          const VGubyte * blueLUT,
+                          const VGubyte * alphaLUT,
+                          VGboolean outputLinear,
+                          VGboolean outputPremultiplied) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgLookupSingle(VGImage dst, VGImage src,
+                                const VGuint * lookupTable,
+                                VGImageChannel sourceChannel,
+                                VGboolean outputLinear,
+                                VGboolean outputPremultiplied) VG_API_EXIT;
+
+/* Hardware Queries */
+VG_API_CALL VGHardwareQueryResult VG_API_ENTRY vgHardwareQuery(VGHardwareQueryType key,
+                                                  VGint setting) VG_API_EXIT;
+
+/* Renderer and Extension Information */
+VG_API_CALL const VGubyte * VG_API_ENTRY vgGetString(VGStringID name) VG_API_EXIT;
+
+#ifdef __cplusplus 
+} /* extern "C" */
+#endif
+
+#endif /* _OPENVG_H */

include/VG/vgext.h

@@ -0,0 +1,233 @@
+/* $Revision: 6810 $ on $Date:: 2008-10-29 07:31:37 -0700 #$ */
+
+/*------------------------------------------------------------------------
+ * 
+ * VG extensions Reference Implementation
+ * -------------------------------------
+ *
+ * Copyright (c) 2008 The Khronos Group Inc.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and /or associated documentation files
+ * (the "Materials "), to deal in the Materials without restriction,
+ * including without limitation the rights to use, copy, modify, merge,
+ * publish, distribute, sublicense, and/or sell copies of the Materials,
+ * and to permit persons to whom the Materials are furnished to do so,
+ * subject to the following conditions: 
+ *
+ * The above copyright notice and this permission notice shall be included 
+ * in all copies or substantial portions of the Materials. 
+ *
+ * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+ * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+ * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
+ * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
+ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
+ * THE USE OR OTHER DEALINGS IN THE MATERIALS.
+ *
+ *//**
+ * \file
+ * \brief	VG extensions
+ *//*-------------------------------------------------------------------*/
+
+
+
+#ifndef _VGEXT_H
+#define _VGEXT_H
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+#include <VG/openvg.h>
+#include <VG/vgu.h>
+
+#ifndef VG_API_ENTRYP
+#   define VG_API_ENTRYP VG_API_ENTRY*
+#endif
+
+#ifndef VGU_API_ENTRYP
+#   define VGU_API_ENTRYP VGU_API_ENTRY*
+#endif
+
+/*-------------------------------------------------------------------------------
+ * KHR extensions
+ *------------------------------------------------------------------------------*/
+
+typedef enum  {
+
+#ifndef VG_KHR_iterative_average_blur
+  VG_MAX_AVERAGE_BLUR_DIMENSION_KHR        = 0x116B,
+  VG_AVERAGE_BLUR_DIMENSION_RESOLUTION_KHR = 0x116C,
+  VG_MAX_AVERAGE_BLUR_ITERATIONS_KHR       = 0x116D,
+#endif
+
+  VG_PARAM_TYPE_KHR_FORCE_SIZE             = VG_MAX_ENUM
+} VGParamTypeKHR;
+
+#ifndef VG_KHR_EGL_image
+#define VG_KHR_EGL_image 1
+/* VGEGLImageKHR is an opaque handle to an EGLImage */
+typedef void* VGeglImageKHR; 
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL VGImage VG_API_ENTRY vgCreateEGLImageTargetKHR(VGeglImageKHR image);
+#endif
+typedef VGImage (VG_API_ENTRYP PFNVGCREATEEGLIMAGETARGETKHRPROC) (VGeglImageKHR image);
+
+#endif
+
+
+#ifndef VG_KHR_iterative_average_blur
+#define VG_KHR_iterative_average_blur 1
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL void vgIterativeAverageBlurKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
+#endif 
+typedef void (VG_API_ENTRYP PFNVGITERATIVEAVERAGEBLURKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
+
+#endif
+
+
+#ifndef VG_KHR_advanced_blending
+#define VG_KHR_advanced_blending 1
+
+typedef enum {
+  VG_BLEND_OVERLAY_KHR        = 0x2010,
+  VG_BLEND_HARDLIGHT_KHR      = 0x2011,
+  VG_BLEND_SOFTLIGHT_SVG_KHR  = 0x2012,
+  VG_BLEND_SOFTLIGHT_KHR      = 0x2013,
+  VG_BLEND_COLORDODGE_KHR     = 0x2014,
+  VG_BLEND_COLORBURN_KHR      = 0x2015,
+  VG_BLEND_DIFFERENCE_KHR     = 0x2016,
+  VG_BLEND_SUBTRACT_KHR       = 0x2017,
+  VG_BLEND_INVERT_KHR         = 0x2018,
+  VG_BLEND_EXCLUSION_KHR      = 0x2019,
+  VG_BLEND_LINEARDODGE_KHR    = 0x201a,
+  VG_BLEND_LINEARBURN_KHR     = 0x201b,
+  VG_BLEND_VIVIDLIGHT_KHR     = 0x201c,
+  VG_BLEND_LINEARLIGHT_KHR    = 0x201d,
+  VG_BLEND_PINLIGHT_KHR       = 0x201e,
+  VG_BLEND_HARDMIX_KHR        = 0x201f,
+  VG_BLEND_CLEAR_KHR          = 0x2020,
+  VG_BLEND_DST_KHR            = 0x2021,
+  VG_BLEND_SRC_OUT_KHR        = 0x2022,
+  VG_BLEND_DST_OUT_KHR        = 0x2023,
+  VG_BLEND_SRC_ATOP_KHR       = 0x2024,
+  VG_BLEND_DST_ATOP_KHR       = 0x2025,
+  VG_BLEND_XOR_KHR            = 0x2026,
+
+  VG_BLEND_MODE_KHR_FORCE_SIZE= VG_MAX_ENUM
+} VGBlendModeKHR;
+#endif
+
+#ifndef VG_KHR_parametric_filter
+#define VG_KHR_parametric_filter 1 
+
+typedef enum {
+  VG_PF_OBJECT_VISIBLE_FLAG_KHR = (1 << 0),
+  VG_PF_KNOCKOUT_FLAG_KHR       = (1 << 1),
+  VG_PF_OUTER_FLAG_KHR          = (1 << 2),
+  VG_PF_INNER_FLAG_KHR          = (1 << 3),
+
+  VG_PF_TYPE_KHR_FORCE_SIZE     = VG_MAX_ENUM
+} VGPfTypeKHR;
+
+typedef enum {
+  VGU_IMAGE_IN_USE_ERROR           = 0xF010,
+
+  VGU_ERROR_CODE_KHR_FORCE_SIZE    = VG_MAX_ENUM
+} VGUErrorCodeKHR;
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL void VG_API_ENTRY vgParametricFilterKHR(VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguDropShadowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA) ;
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
+#endif
+typedef void (VG_API_ENTRYP PFNVGPARAMETRICFILTERKHRPROC) (VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUDROPSHADOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
+
+#endif
+
+
+/*-------------------------------------------------------------------------------
+ * NDS extensions
+ *------------------------------------------------------------------------------*/
+
+#ifndef VG_NDS_paint_generation
+#define VG_NDS_paint_generation 1
+
+typedef enum { 
+  VG_PAINT_COLOR_RAMP_LINEAR_NDS            = 0x1A10,
+  VG_COLOR_MATRIX_NDS                       = 0x1A11,
+  VG_PAINT_COLOR_TRANSFORM_LINEAR_NDS       = 0x1A12,
+
+  VG_PAINT_PARAM_TYPE_NDS_FORCE_SIZE        = VG_MAX_ENUM
+} VGPaintParamTypeNds;
+
+typedef enum {
+  VG_DRAW_IMAGE_COLOR_MATRIX_NDS            = 0x1F10,
+
+  VG_IMAGE_MODE_NDS_FORCE_SIZE              = VG_MAX_ENUM
+} VGImageModeNds;
+#endif 
+
+
+#ifndef VG_NDS_projective_geometry
+#define VG_NDS_projective_geometry 1
+
+typedef enum {
+  VG_CLIP_MODE_NDS                          = 0x1180,
+  VG_CLIP_LINES_NDS                         = 0x1181,
+  VG_MAX_CLIP_LINES_NDS                     = 0x1182,
+
+  VG_PARAM_TYPE_NDS_FORCE_SIZE        = VG_MAX_ENUM
+} VGParamTypeNds;
+
+typedef enum {
+  VG_CLIPMODE_NONE_NDS                      = 0x3000,
+  VG_CLIPMODE_CLIP_CLOSED_NDS               = 0x3001,
+  VG_CLIPMODE_CLIP_OPEN_NDS                 = 0x3002,
+  VG_CLIPMODE_CULL_NDS                      = 0x3003,
+
+  VG_CLIPMODE_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGClipModeNds;
+
+typedef enum {
+  VG_RQUAD_TO_NDS              = ( 13 << 1 ),
+  VG_RCUBIC_TO_NDS             = ( 14 << 1 ),
+  
+  VG_PATH_SEGMENT_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGPathSegmentNds;
+
+typedef enum {
+  VG_RQUAD_TO_ABS_NDS            = (VG_RQUAD_TO_NDS  | VG_ABSOLUTE),
+  VG_RQUAD_TO_REL_NDS            = (VG_RQUAD_TO_NDS  | VG_RELATIVE),
+  VG_RCUBIC_TO_ABS_NDS           = (VG_RCUBIC_TO_NDS | VG_ABSOLUTE),
+  VG_RCUBIC_TO_REL_NDS           = (VG_RCUBIC_TO_NDS | VG_RELATIVE),
+
+  VG_PATH_COMMAND_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGPathCommandNds;
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL void VG_API_ENTRY vgProjectiveMatrixNDS(VGboolean enable) ;
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguTransformClipLineNDS(const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
+#endif 
+typedef void (VG_API_ENTRYP PFNVGPROJECTIVEMATRIXNDSPROC) (VGboolean enable) ;
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUTRANSFORMCLIPLINENDSPROC) (const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
+
+#endif
+
+#ifdef __cplusplus 
+} /* extern "C" */
+#endif
+
+#endif /* _VGEXT_H */

include/VG/vgplatform.h

@@ -0,0 +1,92 @@
+/* $Revision: 6810 $ on $Date:: 2008-10-29 07:31:37 -0700 #$ */
+
+/*------------------------------------------------------------------------
+ *
+ * VG platform specific header Reference Implementation
+ * ----------------------------------------------------
+ *
+ * Copyright (c) 2008 The Khronos Group Inc.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and /or associated documentation files
+ * (the "Materials "), to deal in the Materials without restriction,
+ * including without limitation the rights to use, copy, modify, merge,
+ * publish, distribute, sublicense, and/or sell copies of the Materials,
+ * and to permit persons to whom the Materials are furnished to do so,
+ * subject to the following conditions: 
+ *
+ * The above copyright notice and this permission notice shall be included 
+ * in all copies or substantial portions of the Materials. 
+ *
+ * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+ * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+ * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
+ * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
+ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
+ * THE USE OR OTHER DEALINGS IN THE MATERIALS.
+ *
+ *//**
+ * \file
+ * \brief VG platform specific header
+ *//*-------------------------------------------------------------------*/
+
+#ifndef _VGPLATFORM_H
+#define _VGPLATFORM_H
+
+#include <KHR/khrplatform.h>
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+#ifndef VG_API_CALL 
+#if defined(OPENVG_STATIC_LIBRARY)
+#	define VG_API_CALL
+#else
+#	define VG_API_CALL KHRONOS_APICALL
+#endif /* defined OPENVG_STATIC_LIBRARY */
+#endif /* ifndef VG_API_CALL */
+
+#ifndef VGU_API_CALL 
+#if defined(OPENVG_STATIC_LIBRARY)
+#	define VGU_API_CALL
+#else
+#	define VGU_API_CALL KHRONOS_APICALL
+#endif /* defined OPENVG_STATIC_LIBRARY */
+#endif /* ifndef VGU_API_CALL */
+
+
+#ifndef VG_API_ENTRY
+#define VG_API_ENTRY
+#endif
+
+#ifndef VG_API_EXIT
+#define VG_API_EXIT
+#endif
+
+#ifndef VGU_API_ENTRY
+#define VGU_API_ENTRY
+#endif
+
+#ifndef VGU_API_EXIT
+#define VGU_API_EXIT
+#endif
+
+typedef float          VGfloat;
+typedef signed char    VGbyte;
+typedef unsigned char  VGubyte;
+typedef signed short   VGshort;
+typedef signed int     VGint;
+typedef unsigned int   VGuint;
+typedef unsigned int   VGbitfield;
+
+#ifndef VG_VGEXT_PROTOTYPES
+#define VG_VGEXT_PROTOTYPES
+#endif 
+
+#ifdef __cplusplus 
+} /* extern "C" */
+#endif
+
+#endif /* _VGPLATFORM_H */

include/VG/vgu.h

@@ -0,0 +1,131 @@
+/* $Revision: 6810 $ on $Date:: 2008-10-29 07:31:37 -0700 #$ */
+
+/*------------------------------------------------------------------------
+ * 
+ * VGU 1.1 Reference Implementation
+ * -------------------------------------
+ *
+ * Copyright (c) 2008 The Khronos Group Inc.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and /or associated documentation files
+ * (the "Materials "), to deal in the Materials without restriction,
+ * including without limitation the rights to use, copy, modify, merge,
+ * publish, distribute, sublicense, and/or sell copies of the Materials,
+ * and to permit persons to whom the Materials are furnished to do so,
+ * subject to the following conditions: 
+ *
+ * The above copyright notice and this permission notice shall be included 
+ * in all copies or substantial portions of the Materials. 
+ *
+ * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+ * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+ * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
+ * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
+ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
+ * THE USE OR OTHER DEALINGS IN THE MATERIALS.
+ *
+ *//**
+ * \file
+ * \brief	VGU 1.1 API.
+ *//*-------------------------------------------------------------------*/
+
+#ifndef _VGU_H
+#define _VGU_H
+
+#ifdef __cplusplus 
+extern "C" { 
+#endif
+
+#include <VG/openvg.h>
+
+#define VGU_VERSION_1_0 1
+#define VGU_VERSION_1_1 2
+
+#ifndef VGU_API_CALL
+#	error VGU_API_CALL must be defined
+#endif
+
+#ifndef VGU_API_ENTRY
+#   error VGU_API_ENTRY must be defined 
+#endif
+
+#ifndef VGU_API_EXIT
+#   error VGU_API_EXIT must be defined 
+#endif
+
+
+typedef enum {
+  VGU_NO_ERROR                                 = 0,
+  VGU_BAD_HANDLE_ERROR                         = 0xF000,
+  VGU_ILLEGAL_ARGUMENT_ERROR                   = 0xF001,
+  VGU_OUT_OF_MEMORY_ERROR                      = 0xF002,
+  VGU_PATH_CAPABILITY_ERROR                    = 0xF003,
+  VGU_BAD_WARP_ERROR                           = 0xF004,
+
+  VGU_ERROR_CODE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGUErrorCode;
+
+typedef enum {
+  VGU_ARC_OPEN                                 = 0xF100,
+  VGU_ARC_CHORD                                = 0xF101,
+  VGU_ARC_PIE                                  = 0xF102,
+
+  VGU_ARC_TYPE_FORCE_SIZE                      = VG_MAX_ENUM
+} VGUArcType;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguLine(VGPath path,
+                                  VGfloat x0, VGfloat y0,
+                                  VGfloat x1, VGfloat y1) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguPolygon(VGPath path,
+                                     const VGfloat * points, VGint count,
+                                     VGboolean closed) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguRect(VGPath path,
+                                  VGfloat x, VGfloat y,
+                                  VGfloat width, VGfloat height) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguRoundRect(VGPath path,
+                                       VGfloat x, VGfloat y,
+                                       VGfloat width, VGfloat height,
+                                       VGfloat arcWidth, VGfloat arcHeight) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguEllipse(VGPath path,
+                                     VGfloat cx, VGfloat cy,
+                                     VGfloat width, VGfloat height) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguArc(VGPath path,
+                                 VGfloat x, VGfloat y,
+                                 VGfloat width, VGfloat height,
+                                 VGfloat startAngle, VGfloat angleExtent,
+                                 VGUArcType arcType) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpQuadToSquare(VGfloat sx0, VGfloat sy0,
+                                                     VGfloat sx1, VGfloat sy1,
+                                                     VGfloat sx2, VGfloat sy2,
+                                                     VGfloat sx3, VGfloat sy3,
+                                                     VGfloat * matrix) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpSquareToQuad(VGfloat dx0, VGfloat dy0,
+                                                     VGfloat dx1, VGfloat dy1,
+                                                     VGfloat dx2, VGfloat dy2,
+                                                     VGfloat dx3, VGfloat dy3,
+                                                     VGfloat * matrix) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpQuadToQuad(VGfloat dx0, VGfloat dy0,
+                                                   VGfloat dx1, VGfloat dy1,
+                                                   VGfloat dx2, VGfloat dy2,
+                                                   VGfloat dx3, VGfloat dy3,
+                                                   VGfloat sx0, VGfloat sy0,
+                                                   VGfloat sx1, VGfloat sy1,
+                                                   VGfloat sx2, VGfloat sy2,
+                                                   VGfloat sx3, VGfloat sy3,
+                                                   VGfloat * matrix) VGU_API_EXIT;
+
+#ifdef __cplusplus 
+} /* extern "C" */
+#endif
+
+#endif /* #ifndef _VGU_H */

include/c11/threads_posix.h

@@ -102,8 +102,9 @@ call_once(once_flag *flag, void (*func)(void))
 static inline int
 cnd_broadcast(cnd_t *cond)
 {
-    assert(cond != NULL);
-    return (pthread_cond_broadcast(cond) == 0) ? thrd_success : thrd_error;
+    if (!cond) return thrd_error;
+    pthread_cond_broadcast(cond);
+    return thrd_success;
 }
 
 // 7.25.3.2
@@ -118,16 +119,18 @@ cnd_destroy(cnd_t *cond)
 static inline int
 cnd_init(cnd_t *cond)
 {
-    assert(cond != NULL);
-    return (pthread_cond_init(cond, NULL) == 0) ? thrd_success : thrd_error;
+    if (!cond) return thrd_error;
+    pthread_cond_init(cond, NULL);
+    return thrd_success;
 }
 
 // 7.25.3.4
 static inline int
 cnd_signal(cnd_t *cond)
 {
-    assert(cond != NULL);
-    return (pthread_cond_signal(cond) == 0) ? thrd_success : thrd_error;
+    if (!cond) return thrd_error;
+    pthread_cond_signal(cond);
+    return thrd_success;
 }
 
 // 7.25.3.5
@@ -136,14 +139,7 @@ cnd_timedwait(cnd_t *cond, mtx_t *mtx, const xtime *xt)
 {
     struct timespec abs_time;
     int rt;
-
-    assert(mtx != NULL);
-    assert(cond != NULL);
-    assert(xt != NULL);
-
-    abs_time.tv_sec = xt->sec;
-    abs_time.tv_nsec = xt->nsec;
-
+    if (!cond || !mtx || !xt) return thrd_error;
     rt = pthread_cond_timedwait(cond, mtx, &abs_time);
     if (rt == ETIMEDOUT)
         return thrd_busy;
@@ -154,9 +150,9 @@ cnd_timedwait(cnd_t *cond, mtx_t *mtx, const xtime *xt)
 static inline int
 cnd_wait(cnd_t *cond, mtx_t *mtx)
 {
-    assert(mtx != NULL);
-    assert(cond != NULL);
-    return (pthread_cond_wait(cond, mtx) == 0) ? thrd_success : thrd_error;
+    if (!cond || !mtx) return thrd_error;
+    pthread_cond_wait(cond, mtx);
+    return thrd_success;
 }
 
 
@@ -165,7 +161,7 @@ cnd_wait(cnd_t *cond, mtx_t *mtx)
 static inline void
 mtx_destroy(mtx_t *mtx)
 {
-    assert(mtx != NULL);
+    assert(mtx);
     pthread_mutex_destroy(mtx);
 }
 
@@ -174,7 +170,7 @@ static inline int
 mtx_init(mtx_t *mtx, int type)
 {
     pthread_mutexattr_t attr;
-    assert(mtx != NULL);
+    if (!mtx) return thrd_error;
     if (type != mtx_plain && type != mtx_timed && type != mtx_try
       && type != (mtx_plain|mtx_recursive)
       && type != (mtx_timed|mtx_recursive)
@@ -192,8 +188,9 @@ mtx_init(mtx_t *mtx, int type)
 static inline int
 mtx_lock(mtx_t *mtx)
 {
-    assert(mtx != NULL);
-    return (pthread_mutex_lock(mtx) == 0) ? thrd_success : thrd_error;
+    if (!mtx) return thrd_error;
+    pthread_mutex_lock(mtx);
+    return thrd_success;
 }
 
 static inline int
@@ -206,9 +203,7 @@ thrd_yield(void);
 static inline int
 mtx_timedlock(mtx_t *mtx, const xtime *xt)
 {
-    assert(mtx != NULL);
-    assert(xt != NULL);
-
+    if (!mtx || !xt) return thrd_error;
     {
 #ifdef EMULATED_THREADS_USE_NATIVE_TIMEDLOCK
     struct timespec ts;
@@ -238,7 +233,7 @@ mtx_timedlock(mtx_t *mtx, const xtime *xt)
 static inline int
 mtx_trylock(mtx_t *mtx)
 {
-    assert(mtx != NULL);
+    if (!mtx) return thrd_error;
     return (pthread_mutex_trylock(mtx) == 0) ? thrd_success : thrd_busy;
 }
 
@@ -246,8 +241,9 @@ mtx_trylock(mtx_t *mtx)
 static inline int
 mtx_unlock(mtx_t *mtx)
 {
-    assert(mtx != NULL);
-    return (pthread_mutex_unlock(mtx) == 0) ? thrd_success : thrd_error;
+    if (!mtx) return thrd_error;
+    pthread_mutex_unlock(mtx);
+    return thrd_success;
 }
 
 
@@ -257,7 +253,7 @@ static inline int
 thrd_create(thrd_t *thr, thrd_start_t func, void *arg)
 {
     struct impl_thrd_param *pack;
-    assert(thr != NULL);
+    if (!thr) return thrd_error;
     pack = (struct impl_thrd_param *)malloc(sizeof(struct impl_thrd_param));
     if (!pack) return thrd_nomem;
     pack->func = func;
@@ -333,7 +329,7 @@ thrd_yield(void)
 static inline int
 tss_create(tss_t *key, tss_dtor_t dtor)
 {
-    assert(key != NULL);
+    if (!key) return thrd_error;
     return (pthread_key_create(key, dtor) == 0) ? thrd_success : thrd_error;
 }
 

include/c99/inttypes.h

@@ -0,0 +1,305 @@
+// ISO C9x  compliant inttypes.h for Microsoft Visual Studio
+// Based on ISO/IEC 9899:TC2 Committee draft (May 6, 2005) WG14/N1124 
+// 
+//  Copyright (c) 2006 Alexander Chemeris
+// 
+// Redistribution and use in source and binary forms, with or without
+// modification, are permitted provided that the following conditions are met:
+// 
+//   1. Redistributions of source code must retain the above copyright notice,
+//      this list of conditions and the following disclaimer.
+// 
+//   2. Redistributions in binary form must reproduce the above copyright
+//      notice, this list of conditions and the following disclaimer in the
+//      documentation and/or other materials provided with the distribution.
+// 
+//   3. The name of the author may be used to endorse or promote products
+//      derived from this software without specific prior written permission.
+// 
+// THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR IMPLIED
+// WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF
+// MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO
+// EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
+// SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO,
+// PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS;
+// OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, 
+// WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR
+// OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF
+// ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
+// 
+///////////////////////////////////////////////////////////////////////////////
+
+#ifndef _MSC_VER // [
+#error "Use this header only with Microsoft Visual C++ compilers!"
+#endif // _MSC_VER ]
+
+#ifndef _MSC_INTTYPES_H_ // [
+#define _MSC_INTTYPES_H_
+
+#if _MSC_VER > 1000
+#pragma once
+#endif
+
+#include "stdint.h"
+
+// 7.8 Format conversion of integer types
+
+typedef struct {
+   intmax_t quot;
+   intmax_t rem;
+} imaxdiv_t;
+
+// 7.8.1 Macros for format specifiers
+
+#if !defined(__cplusplus) || defined(__STDC_FORMAT_MACROS) // [   See footnote 185 at page 198
+
+// The fprintf macros for signed integers are:
+#define PRId8       "d"
+#define PRIi8       "i"
+#define PRIdLEAST8  "d"
+#define PRIiLEAST8  "i"
+#define PRIdFAST8   "d"
+#define PRIiFAST8   "i"
+
+#define PRId16       "hd"
+#define PRIi16       "hi"
+#define PRIdLEAST16  "hd"
+#define PRIiLEAST16  "hi"
+#define PRIdFAST16   "hd"
+#define PRIiFAST16   "hi"
+
+#define PRId32       "I32d"
+#define PRIi32       "I32i"
+#define PRIdLEAST32  "I32d"
+#define PRIiLEAST32  "I32i"
+#define PRIdFAST32   "I32d"
+#define PRIiFAST32   "I32i"
+
+#define PRId64       "I64d"
+#define PRIi64       "I64i"
+#define PRIdLEAST64  "I64d"
+#define PRIiLEAST64  "I64i"
+#define PRIdFAST64   "I64d"
+#define PRIiFAST64   "I64i"
+
+#define PRIdMAX     "I64d"
+#define PRIiMAX     "I64i"
+
+#define PRIdPTR     "Id"
+#define PRIiPTR     "Ii"
+
+// The fprintf macros for unsigned integers are:
+#define PRIo8       "o"
+#define PRIu8       "u"
+#define PRIx8       "x"
+#define PRIX8       "X"
+#define PRIoLEAST8  "o"
+#define PRIuLEAST8  "u"
+#define PRIxLEAST8  "x"
+#define PRIXLEAST8  "X"
+#define PRIoFAST8   "o"
+#define PRIuFAST8   "u"
+#define PRIxFAST8   "x"
+#define PRIXFAST8   "X"
+
+#define PRIo16       "ho"
+#define PRIu16       "hu"
+#define PRIx16       "hx"
+#define PRIX16       "hX"
+#define PRIoLEAST16  "ho"
+#define PRIuLEAST16  "hu"
+#define PRIxLEAST16  "hx"
+#define PRIXLEAST16  "hX"
+#define PRIoFAST16   "ho"
+#define PRIuFAST16   "hu"
+#define PRIxFAST16   "hx"
+#define PRIXFAST16   "hX"
+
+#define PRIo32       "I32o"
+#define PRIu32       "I32u"
+#define PRIx32       "I32x"
+#define PRIX32       "I32X"
+#define PRIoLEAST32  "I32o"
+#define PRIuLEAST32  "I32u"
+#define PRIxLEAST32  "I32x"
+#define PRIXLEAST32  "I32X"
+#define PRIoFAST32   "I32o"
+#define PRIuFAST32   "I32u"
+#define PRIxFAST32   "I32x"
+#define PRIXFAST32   "I32X"
+
+#define PRIo64       "I64o"
+#define PRIu64       "I64u"
+#define PRIx64       "I64x"
+#define PRIX64       "I64X"
+#define PRIoLEAST64  "I64o"
+#define PRIuLEAST64  "I64u"
+#define PRIxLEAST64  "I64x"
+#define PRIXLEAST64  "I64X"
+#define PRIoFAST64   "I64o"
+#define PRIuFAST64   "I64u"
+#define PRIxFAST64   "I64x"
+#define PRIXFAST64   "I64X"
+
+#define PRIoMAX     "I64o"
+#define PRIuMAX     "I64u"
+#define PRIxMAX     "I64x"
+#define PRIXMAX     "I64X"
+
+#define PRIoPTR     "Io"
+#define PRIuPTR     "Iu"
+#define PRIxPTR     "Ix"
+#define PRIXPTR     "IX"
+
+// The fscanf macros for signed integers are:
+#define SCNd8       "d"
+#define SCNi8       "i"
+#define SCNdLEAST8  "d"
+#define SCNiLEAST8  "i"
+#define SCNdFAST8   "d"
+#define SCNiFAST8   "i"
+
+#define SCNd16       "hd"
+#define SCNi16       "hi"
+#define SCNdLEAST16  "hd"
+#define SCNiLEAST16  "hi"
+#define SCNdFAST16   "hd"
+#define SCNiFAST16   "hi"
+
+#define SCNd32       "ld"
+#define SCNi32       "li"
+#define SCNdLEAST32  "ld"
+#define SCNiLEAST32  "li"
+#define SCNdFAST32   "ld"
+#define SCNiFAST32   "li"
+
+#define SCNd64       "I64d"
+#define SCNi64       "I64i"
+#define SCNdLEAST64  "I64d"
+#define SCNiLEAST64  "I64i"
+#define SCNdFAST64   "I64d"
+#define SCNiFAST64   "I64i"
+
+#define SCNdMAX     "I64d"
+#define SCNiMAX     "I64i"
+
+#ifdef _WIN64 // [
+#  define SCNdPTR     "I64d"
+#  define SCNiPTR     "I64i"
+#else  // _WIN64 ][
+#  define SCNdPTR     "ld"
+#  define SCNiPTR     "li"
+#endif  // _WIN64 ]
+
+// The fscanf macros for unsigned integers are:
+#define SCNo8       "o"
+#define SCNu8       "u"
+#define SCNx8       "x"
+#define SCNX8       "X"
+#define SCNoLEAST8  "o"
+#define SCNuLEAST8  "u"
+#define SCNxLEAST8  "x"
+#define SCNXLEAST8  "X"
+#define SCNoFAST8   "o"
+#define SCNuFAST8   "u"
+#define SCNxFAST8   "x"
+#define SCNXFAST8   "X"
+
+#define SCNo16       "ho"
+#define SCNu16       "hu"
+#define SCNx16       "hx"
+#define SCNX16       "hX"
+#define SCNoLEAST16  "ho"
+#define SCNuLEAST16  "hu"
+#define SCNxLEAST16  "hx"
+#define SCNXLEAST16  "hX"
+#define SCNoFAST16   "ho"
+#define SCNuFAST16   "hu"
+#define SCNxFAST16   "hx"
+#define SCNXFAST16   "hX"
+
+#define SCNo32       "lo"
+#define SCNu32       "lu"
+#define SCNx32       "lx"
+#define SCNX32       "lX"
+#define SCNoLEAST32  "lo"
+#define SCNuLEAST32  "lu"
+#define SCNxLEAST32  "lx"
+#define SCNXLEAST32  "lX"
+#define SCNoFAST32   "lo"
+#define SCNuFAST32   "lu"
+#define SCNxFAST32   "lx"
+#define SCNXFAST32   "lX"
+
+#define SCNo64       "I64o"
+#define SCNu64       "I64u"
+#define SCNx64       "I64x"
+#define SCNX64       "I64X"
+#define SCNoLEAST64  "I64o"
+#define SCNuLEAST64  "I64u"
+#define SCNxLEAST64  "I64x"
+#define SCNXLEAST64  "I64X"
+#define SCNoFAST64   "I64o"
+#define SCNuFAST64   "I64u"
+#define SCNxFAST64   "I64x"
+#define SCNXFAST64   "I64X"
+
+#define SCNoMAX     "I64o"
+#define SCNuMAX     "I64u"
+#define SCNxMAX     "I64x"
+#define SCNXMAX     "I64X"
+
+#ifdef _WIN64 // [
+#  define SCNoPTR     "I64o"
+#  define SCNuPTR     "I64u"
+#  define SCNxPTR     "I64x"
+#  define SCNXPTR     "I64X"
+#else  // _WIN64 ][
+#  define SCNoPTR     "lo"
+#  define SCNuPTR     "lu"
+#  define SCNxPTR     "lx"
+#  define SCNXPTR     "lX"
+#endif  // _WIN64 ]
+
+#endif // __STDC_FORMAT_MACROS ]
+
+// 7.8.2 Functions for greatest-width integer types
+
+// 7.8.2.1 The imaxabs function
+#define imaxabs _abs64
+
+// 7.8.2.2 The imaxdiv function
+
+// This is modified version of div() function from Microsoft's div.c found
+// in %MSVC.NET%\crt\src\div.c
+#ifdef STATIC_IMAXDIV // [
+static
+#else // STATIC_IMAXDIV ][
+_inline
+#endif // STATIC_IMAXDIV ]
+imaxdiv_t __cdecl imaxdiv(intmax_t numer, intmax_t denom)
+{
+   imaxdiv_t result;
+
+   result.quot = numer / denom;
+   result.rem = numer % denom;
+
+   if (numer < 0 && result.rem > 0) {
+      // did division wrong; must fix up
+      ++result.quot;
+      result.rem -= denom;
+   }
+
+   return result;
+}
+
+// 7.8.2.3 The strtoimax and strtoumax functions
+#define strtoimax _strtoi64
+#define strtoumax _strtoui64
+
+// 7.8.2.4 The wcstoimax and wcstoumax functions
+#define wcstoimax _wcstoi64
+#define wcstoumax _wcstoui64
+
+
+#endif // _MSC_INTTYPES_H_ ]

include/c99/stdbool.h

@@ -1,6 +1,6 @@
 /**************************************************************************
  *
- * Copyright 2010 VMware, Inc.
+ * Copyright 2007-2010 VMware, Inc.
  * All Rights Reserved.
  *
  * Permission is hereby granted, free of charge, to any person obtaining a
@@ -25,32 +25,22 @@
  *
  **************************************************************************/
 
+#ifndef _STDBOOL_H_
+#define _STDBOOL_H_
 
-#include "lp_bld_format.h"
+#ifndef __cplusplus
 
+#define false   0
+#define true    1
+#define bool    _Bool
 
-
-LLVMTypeRef
-lp_build_format_cache_type(struct gallivm_state *gallivm)
-{
-   LLVMTypeRef elem_types[LP_BUILD_FORMAT_CACHE_MEMBER_COUNT];
-   LLVMTypeRef s;
-
-   elem_types[LP_BUILD_FORMAT_CACHE_MEMBER_DATA] =
-         LLVMArrayType(LLVMInt32TypeInContext(gallivm->context),
-                       LP_BUILD_FORMAT_CACHE_SIZE * 16);
-   elem_types[LP_BUILD_FORMAT_CACHE_MEMBER_TAGS] =
-         LLVMArrayType(LLVMInt64TypeInContext(gallivm->context),
-                       LP_BUILD_FORMAT_CACHE_SIZE);
-#if LP_BUILD_FORMAT_CACHE_DEBUG
-   elem_types[LP_BUILD_FORMAT_CACHE_MEMBER_ACCESS_TOTAL] =
-         LLVMInt64TypeInContext(gallivm->context);
-   elem_types[LP_BUILD_FORMAT_CACHE_MEMBER_ACCESS_MISS] =
-         LLVMInt64TypeInContext(gallivm->context);
+/* For compilers that don't have the builtin _Bool type. */
+#if (defined(_MSC_VER) && _MSC_VER < 1800)
+typedef unsigned char _Bool;
 #endif
 
-   s = LLVMStructTypeInContext(gallivm->context, elem_types,
-                               LP_BUILD_FORMAT_CACHE_MEMBER_COUNT, 0);
+#endif /* !__cplusplus */
 
-   return s;
-}
+#define __bool_true_false_are_defined   1
+
+#endif /* !_STDBOOL_H_ */

include/c99/stdint.h

@@ -0,0 +1,247 @@
+// ISO C9x  compliant stdint.h for Microsoft Visual Studio
+// Based on ISO/IEC 9899:TC2 Committee draft (May 6, 2005) WG14/N1124 
+// 
+//  Copyright (c) 2006-2008 Alexander Chemeris
+// 
+// Redistribution and use in source and binary forms, with or without
+// modification, are permitted provided that the following conditions are met:
+// 
+//   1. Redistributions of source code must retain the above copyright notice,
+//      this list of conditions and the following disclaimer.
+// 
+//   2. Redistributions in binary form must reproduce the above copyright
+//      notice, this list of conditions and the following disclaimer in the
+//      documentation and/or other materials provided with the distribution.
+// 
+//   3. The name of the author may be used to endorse or promote products
+//      derived from this software without specific prior written permission.
+// 
+// THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR IMPLIED
+// WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF
+// MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO
+// EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
+// SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO,
+// PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS;
+// OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, 
+// WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR
+// OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF
+// ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
+// 
+///////////////////////////////////////////////////////////////////////////////
+
+#ifndef _MSC_VER // [
+#error "Use this header only with Microsoft Visual C++ compilers!"
+#endif // _MSC_VER ]
+
+#ifndef _MSC_STDINT_H_ // [
+#define _MSC_STDINT_H_
+
+#if _MSC_VER > 1000
+#pragma once
+#endif
+
+#include <limits.h>
+
+// For Visual Studio 6 in C++ mode and for many Visual Studio versions when
+// compiling for ARM we should wrap <wchar.h> include with 'extern "C++" {}'
+// or compiler give many errors like this:
+//   error C2733: second C linkage of overloaded function 'wmemchr' not allowed
+#ifdef __cplusplus
+extern "C" {
+#endif
+#  include <wchar.h>
+#ifdef __cplusplus
+}
+#endif
+
+// Define _W64 macros to mark types changing their size, like intptr_t.
+#ifndef _W64
+#  if !defined(__midl) && (defined(_X86_) || defined(_M_IX86)) && _MSC_VER >= 1300
+#     define _W64 __w64
+#  else
+#     define _W64
+#  endif
+#endif
+
+
+// 7.18.1 Integer types
+
+// 7.18.1.1 Exact-width integer types
+
+// Visual Studio 6 and Embedded Visual C++ 4 doesn't
+// realize that, e.g. char has the same size as __int8
+// so we give up on __intX for them.
+#if (_MSC_VER < 1300)
+   typedef signed char       int8_t;
+   typedef signed short      int16_t;
+   typedef signed int        int32_t;
+   typedef unsigned char     uint8_t;
+   typedef unsigned short    uint16_t;
+   typedef unsigned int      uint32_t;
+#else
+   typedef signed __int8     int8_t;
+   typedef signed __int16    int16_t;
+   typedef signed __int32    int32_t;
+   typedef unsigned __int8   uint8_t;
+   typedef unsigned __int16  uint16_t;
+   typedef unsigned __int32  uint32_t;
+#endif
+typedef signed __int64       int64_t;
+typedef unsigned __int64     uint64_t;
+
+
+// 7.18.1.2 Minimum-width integer types
+typedef int8_t    int_least8_t;
+typedef int16_t   int_least16_t;
+typedef int32_t   int_least32_t;
+typedef int64_t   int_least64_t;
+typedef uint8_t   uint_least8_t;
+typedef uint16_t  uint_least16_t;
+typedef uint32_t  uint_least32_t;
+typedef uint64_t  uint_least64_t;
+
+// 7.18.1.3 Fastest minimum-width integer types
+typedef int8_t    int_fast8_t;
+typedef int16_t   int_fast16_t;
+typedef int32_t   int_fast32_t;
+typedef int64_t   int_fast64_t;
+typedef uint8_t   uint_fast8_t;
+typedef uint16_t  uint_fast16_t;
+typedef uint32_t  uint_fast32_t;
+typedef uint64_t  uint_fast64_t;
+
+// 7.18.1.4 Integer types capable of holding object pointers
+#ifdef _WIN64 // [
+   typedef signed __int64    intptr_t;
+   typedef unsigned __int64  uintptr_t;
+#else // _WIN64 ][
+   typedef _W64 signed int   intptr_t;
+   typedef _W64 unsigned int uintptr_t;
+#endif // _WIN64 ]
+
+// 7.18.1.5 Greatest-width integer types
+typedef int64_t   intmax_t;
+typedef uint64_t  uintmax_t;
+
+
+// 7.18.2 Limits of specified-width integer types
+
+#if !defined(__cplusplus) || defined(__STDC_LIMIT_MACROS) // [   See footnote 220 at page 257 and footnote 221 at page 259
+
+// 7.18.2.1 Limits of exact-width integer types
+#define INT8_MIN     ((int8_t)_I8_MIN)
+#define INT8_MAX     _I8_MAX
+#define INT16_MIN    ((int16_t)_I16_MIN)
+#define INT16_MAX    _I16_MAX
+#define INT32_MIN    ((int32_t)_I32_MIN)
+#define INT32_MAX    _I32_MAX
+#define INT64_MIN    ((int64_t)_I64_MIN)
+#define INT64_MAX    _I64_MAX
+#define UINT8_MAX    _UI8_MAX
+#define UINT16_MAX   _UI16_MAX
+#define UINT32_MAX   _UI32_MAX
+#define UINT64_MAX   _UI64_MAX
+
+// 7.18.2.2 Limits of minimum-width integer types
+#define INT_LEAST8_MIN    INT8_MIN
+#define INT_LEAST8_MAX    INT8_MAX
+#define INT_LEAST16_MIN   INT16_MIN
+#define INT_LEAST16_MAX   INT16_MAX
+#define INT_LEAST32_MIN   INT32_MIN
+#define INT_LEAST32_MAX   INT32_MAX
+#define INT_LEAST64_MIN   INT64_MIN
+#define INT_LEAST64_MAX   INT64_MAX
+#define UINT_LEAST8_MAX   UINT8_MAX
+#define UINT_LEAST16_MAX  UINT16_MAX
+#define UINT_LEAST32_MAX  UINT32_MAX
+#define UINT_LEAST64_MAX  UINT64_MAX
+
+// 7.18.2.3 Limits of fastest minimum-width integer types
+#define INT_FAST8_MIN    INT8_MIN
+#define INT_FAST8_MAX    INT8_MAX
+#define INT_FAST16_MIN   INT16_MIN
+#define INT_FAST16_MAX   INT16_MAX
+#define INT_FAST32_MIN   INT32_MIN
+#define INT_FAST32_MAX   INT32_MAX
+#define INT_FAST64_MIN   INT64_MIN
+#define INT_FAST64_MAX   INT64_MAX
+#define UINT_FAST8_MAX   UINT8_MAX
+#define UINT_FAST16_MAX  UINT16_MAX
+#define UINT_FAST32_MAX  UINT32_MAX
+#define UINT_FAST64_MAX  UINT64_MAX
+
+// 7.18.2.4 Limits of integer types capable of holding object pointers
+#ifdef _WIN64 // [
+#  define INTPTR_MIN   INT64_MIN
+#  define INTPTR_MAX   INT64_MAX
+#  define UINTPTR_MAX  UINT64_MAX
+#else // _WIN64 ][
+#  define INTPTR_MIN   INT32_MIN
+#  define INTPTR_MAX   INT32_MAX
+#  define UINTPTR_MAX  UINT32_MAX
+#endif // _WIN64 ]
+
+// 7.18.2.5 Limits of greatest-width integer types
+#define INTMAX_MIN   INT64_MIN
+#define INTMAX_MAX   INT64_MAX
+#define UINTMAX_MAX  UINT64_MAX
+
+// 7.18.3 Limits of other integer types
+
+#ifdef _WIN64 // [
+#  define PTRDIFF_MIN  _I64_MIN
+#  define PTRDIFF_MAX  _I64_MAX
+#else  // _WIN64 ][
+#  define PTRDIFF_MIN  _I32_MIN
+#  define PTRDIFF_MAX  _I32_MAX
+#endif  // _WIN64 ]
+
+#define SIG_ATOMIC_MIN  INT_MIN
+#define SIG_ATOMIC_MAX  INT_MAX
+
+#ifndef SIZE_MAX // [
+#  ifdef _WIN64 // [
+#     define SIZE_MAX  _UI64_MAX
+#  else // _WIN64 ][
+#     define SIZE_MAX  _UI32_MAX
+#  endif // _WIN64 ]
+#endif // SIZE_MAX ]
+
+// WCHAR_MIN and WCHAR_MAX are also defined in <wchar.h>
+#ifndef WCHAR_MIN // [
+#  define WCHAR_MIN  0
+#endif  // WCHAR_MIN ]
+#ifndef WCHAR_MAX // [
+#  define WCHAR_MAX  _UI16_MAX
+#endif  // WCHAR_MAX ]
+
+#define WINT_MIN  0
+#define WINT_MAX  _UI16_MAX
+
+#endif // __STDC_LIMIT_MACROS ]
+
+
+// 7.18.4 Limits of other integer types
+
+#if !defined(__cplusplus) || defined(__STDC_CONSTANT_MACROS) // [   See footnote 224 at page 260
+
+// 7.18.4.1 Macros for minimum-width integer constants
+
+#define INT8_C(val)  val##i8
+#define INT16_C(val) val##i16
+#define INT32_C(val) val##i32
+#define INT64_C(val) val##i64
+
+#define UINT8_C(val)  val##ui8
+#define UINT16_C(val) val##ui16
+#define UINT32_C(val) val##ui32
+#define UINT64_C(val) val##ui64
+
+// 7.18.4.2 Macros for greatest-width integer constants
+#define INTMAX_C   INT64_C
+#define UINTMAX_C  UINT64_C
+
+#endif // __STDC_CONSTANT_MACROS ]
+
+
+#endif // _MSC_STDINT_H_ ]

include/c99_compat.h

@@ -25,8 +25,6 @@
  *
  **************************************************************************/
 
-#include "no_extern_c.h"
-
 #ifndef _C99_COMPAT_H_
 #define _C99_COMPAT_H_
 
@@ -35,18 +33,13 @@
  * MSVC hacks.
  */
 #if defined(_MSC_VER)
-
-#  if _MSC_VER < 1800
-#    error "Microsoft Visual Studio 2013 or higher required"
-#  endif
-
    /*
-    * Visual Studio will complain if we define the `inline` keyword, but
+    * Visual Studio 2012 will complain if we define the `inline` keyword, but
     * actually it only supports the keyword on C++.
     *
     * To avoid this the _ALLOW_KEYWORD_MACROS must be set.
     */
-#  if !defined(_ALLOW_KEYWORD_MACROS)
+#  if (_MSC_VER >= 1700) && !defined(_ALLOW_KEYWORD_MACROS)
 #    define _ALLOW_KEYWORD_MACROS
 #  endif
 
@@ -81,6 +74,8 @@
      /* Intel compiler supports inline keyword */
 #  elif defined(__WATCOMC__) && (__WATCOMC__ >= 1100)
 #    define inline __inline
+#  elif defined(__SUNPRO_C) && defined(__C99FEATURES__)
+     /* C99 supports inline keyword */
 #  elif (__STDC_VERSION__ >= 199901L)
      /* C99 supports inline keyword */
 #  else
@@ -98,6 +93,8 @@
 #ifndef restrict
 #  if (__STDC_VERSION__ >= 199901L)
      /* C99 */
+#  elif defined(__SUNPRO_C) && defined(__C99FEATURES__)
+     /* C99 */
 #  elif defined(__GNUC__)
 #    define restrict __restrict__
 #  elif defined(_MSC_VER)
@@ -114,10 +111,16 @@
 #ifndef __func__
 #  if (__STDC_VERSION__ >= 199901L)
      /* C99 */
+#  elif defined(__SUNPRO_C) && defined(__C99FEATURES__)
+     /* C99 */
 #  elif defined(__GNUC__)
 #    define __func__ __FUNCTION__
 #  elif defined(_MSC_VER)
-#    define __func__ __FUNCTION__
+#    if _MSC_VER >= 1300
+#      define __func__ __FUNCTION__
+#    else
+#      define __func__ "<unknown>"
+#    endif
 #  else
 #    define __func__ "<unknown>"
 #  endif