Compare commits

..

4274 Commits

Author SHA1 Message Date
Chih-Wei Huang
559a79ff87 Merge remote-tracking branch 'x86/froyo-x86' into froyo-next 2011-04-07 16:50:48 +08:00
Chia-I Wu
e87d4d2e31 egl_android: assorted fixes 2011-03-29 06:31:15 +08:00
Chia-I Wu
0c1c261c2d gralloc: glFlush() should suffice for page flipping 2011-03-28 22:33:38 +08:00
Chia-I Wu
f27a8a3321 gralloc: improve page flip blocking
Use DRM_MODE_PAGE_FLIP_EVENT.
2011-03-28 22:20:29 +08:00
Chia-I Wu
98e1078d71 gralloc: boost radeon performance
Allocate buffer from GTT for 2D apps.
2011-03-26 15:59:05 +08:00
Chia-I Wu
1e21885cde gralloc: improve radeon sync issue 2011-03-26 15:46:32 +08:00
Chia-I Wu
7492794ef5 glsl: add missing generated files 2011-03-26 15:20:15 +08:00
Chia-I Wu
16ca82773e gralloc: kernel module name is i915 2011-03-25 16:50:37 +08:00
Chia-I Wu
f84d946322 android: fix building 2011-03-25 03:30:43 +08:00
Chia-I Wu
66c6b2520d st/egl: add support for loading radeon 2011-03-25 03:30:43 +08:00
Chia-I Wu
f3837c7094 egl_android: add support for loading radeon
For completeness.  Not used.
2011-03-25 03:30:43 +08:00
Chia-I Wu
d8ebb254c2 android: use __mmap2 for winsys/r600 2011-03-25 03:30:43 +08:00
Chia-I Wu
dd4929b30b gralloc: add radeon support 2011-03-25 03:30:43 +08:00
Chia-I Wu
0b9a9c408f gralloc: rename i915 to intel 2011-03-25 03:30:43 +08:00
Chia-I Wu
5dddfa8591 gralloc: add multiple driver support 2011-03-25 03:30:43 +08:00
Chia-I Wu
7baac8d734 mesa: fix glDrawTex*
As the case with _mesa_DrawPixels, the driver may install its vertex
shader and the vp override flag should be set.
2011-03-25 03:29:54 +08:00
Chia-I Wu
887b78bb5b auxiliary: disable SSE translate
It does not support FIXED.
2011-03-25 03:29:04 +08:00
Chia-I Wu
d175f38bc3 mesa: one more missing pre-generated file 2011-03-17 15:59:23 +08:00
Chia-I Wu
eeb3391bd5 mesa: add more pre-generated files 2011-03-17 14:46:57 +08:00
Chia-I Wu
06608674d0 egl_android: update surface geometry 2011-03-16 20:18:40 +08:00
Chia-I Wu
9f119b3c51 intel: advertise GL_OES_point_sprite 2011-03-16 20:18:40 +08:00
Chia-I Wu
c4d9c4f7f1 i965c: add MESA_FORMAT_RGBA8888_REV to brw_format_for_mesa_format
The framebuffer uses

  PIXEL_FORMAT_BGRA_8888 -> MESA_FORMAT_ARGB8888

while applications use

  PIXEL_FORMAT_RGBA_8888 -> MESA_FORMAT_RGBA8888_REV
  PIXEL_FORMAT_RGB_565   -> MESA_FORMAT_RGB565
2011-03-16 20:18:40 +08:00
Chia-I Wu
e4706d5cc8 mesa: advertise GL_ARB_texture_non_power_of_two
It maps to DisplayHardware::NPOT_EXTENSION in SurfaceFlinger.
2011-03-16 20:18:40 +08:00
Chia-I Wu
9a3759c3dd android: Add Android.mk's. 2011-03-16 20:18:40 +08:00
Chia-I Wu
f547fef2d0 android: Add pre-generated files.
make -C src/glsl builtin_function.cpp
  make -C src/es1api
  make -C src/es2api
  make -C src/shared-glapi
  make -C src/mesa/mai/api_exec_es{12}.c
2011-03-16 20:18:39 +08:00
Chia-I Wu
73d3113849 android: Add __DRI_IMAGE_FORMAT_RGBA8888_REV. 2011-03-16 20:18:39 +08:00
Chia-I Wu
2b1f1af17f android: Add DRM-based gralloc. 2011-03-16 20:18:39 +08:00
Chia-I Wu
8e698931d7 android: Make egl_android load DRI drivers. 2011-03-16 20:18:39 +08:00
Chia-I Wu
f60af24be7 android: Add new classic EGL driver for Android. 2011-03-16 20:18:39 +08:00
Chia-I Wu
17cd318e41 android: Add android backend for st/egl. 2011-03-16 20:18:39 +08:00
Chia-I Wu
f2d8241f01 android: Add Android EGL extensions. 2011-03-16 20:18:39 +08:00
Chia-I Wu
f9172081ca android: Add _EGL_PLATFORM_ANDROID. 2011-03-16 20:18:39 +08:00
Chia-I Wu
cb4afed922 android: Enable extensions required by ES1 for i915c. 2011-03-16 20:18:39 +08:00
Chia-I Wu
5d1e2165f7 android: Fix depth/stencil with i915c/i965c. 2011-03-16 20:18:39 +08:00
Chia-I Wu
39d1094301 android: Fix GL_OES_EGL_image with SurfaceFlinger. 2011-03-16 20:18:39 +08:00
Chia-I Wu
fb3c3f3079 android: Use __mmap2 in winsys/svga. 2011-03-16 20:18:39 +08:00
Chia-I Wu
c60978b2e0 android: Fix build with bionic. 2011-03-16 20:18:39 +08:00
Chia-I Wu
80a8e7d3d1 i965c: Fix a declaration in for loop. 2011-03-16 20:18:39 +08:00
Chia-I Wu
a0f0662e0c i965c: Add support for GL_FIXED.
Quick and dirty..
2011-03-16 20:18:29 +08:00
Chia-I Wu
d5d833a353 i915c: Add GL_OES_draw_texture support. 2011-03-16 14:17:52 +08:00
Chia-I Wu
32197c0094 i915: Free with FREE. 2011-03-16 14:17:43 +08:00
Brian Paul
11150e4667 mesa: use BITFIELD64_BIT() macro 2011-03-15 18:21:36 -06:00
Brian Paul
aa878f94ab st/mesa: use BITFIELD64_BIT() macro in a few more places 2011-03-15 18:21:35 -06:00
Brian Paul
d350ef1682 glsl: add cast to silence signed/unsigned comparison warning 2011-03-15 18:21:35 -06:00
Brian Paul
d029ba9ec0 mesa: use 1UL for 64-bit unsigned constant for C++
This fixes C++ warnings where BITFIELD64_BIT() is used.
2011-03-15 18:21:35 -06:00
Ian Romanick
85caea29c1 glsl: Only allow unsized array assignment in an initializer
It should have been a tip when the spec says "However, implicitly
sized arrays cannot be assigned to. Note, this is a rare case that
*initializers and assignments appear to have different semantics*."
(empahsis mine)

Fixes bugzilla #34367.

NOTE: This is a candidate for stable release branches.
2011-03-15 16:41:23 -07:00
Daniel Vetter
d04348aaf6 i915g: fix braino in the static state rework
For mip-map level rendering, both draw offset and size tend to change ...

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-15 21:49:25 +01:00
Daniel Vetter
11ee41fe7f i915g: implement early z
v2: Make it actually work.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-15 18:36:25 +01:00
Daniel Vetter
288504fac7 i915g: split up static state
Early Z support is set in the DST_VARS command. Hence split up static
state emission to avoid reissuing to much on fragment shader changes,
especially the costly dst buffer relocations.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-15 18:36:00 +01:00
Eric Anholt
a99447314c i965: Fix alpha testing when there is no color buffer in the FBO.
We were alpha testing against an unwritten value, resulting in garbage.
(part of) Bug #35073.
2011-03-15 10:14:52 -07:00
Eric Anholt
b60651a17b i965: Do our lowering passes before the loop of optimization.
The optimization loop won't reinsert noise instructions or quadop
vectors, so we were traversing the tree for nothing.  Lowering vector
indexing was in the loop after do_common_optimization() to avoid the
work if it ended up that the index was actually constant, but that has
been called already in the core.
2011-03-15 10:14:52 -07:00
Eric Anholt
c75427f4c8 glsl: Skip processing the first function's body in do_dead_functions().
It can't call anything, so there's no point.
2011-03-15 10:14:51 -07:00
Eric Anholt
11af045ea8 glsl: Whitespace fixup in opt_dead_functions.cpp. 2011-03-15 10:14:51 -07:00
Eric Anholt
2b13e13594 glsl: Skip processing of expression trees in discard simplification.
It only cares about "if", "loop", and "discard".
2011-03-15 09:49:01 -07:00
Eric Anholt
05cf1ad82e glsl: Reduce processing of expression trees in do_structure_splitting.
Most of the time we don't have a non-uniform struct variable in the
shader, so this cuts the time spent in do_structure_splitting during
glean texCombine by about 2/3.
2011-03-15 09:49:01 -07:00
Eric Anholt
991fa4d3d0 glsl: Skip processing expression trees in do_if_simplification().
Reduces time spent in this during glean texCombine by about 2/3.
2011-03-15 09:49:00 -07:00
Eric Anholt
d3a444af2d glsl: Skip processing expression trees in optimize_redundant_jumps()
Cuts the time spent in this function during glean texCombine by 2/3.
2011-03-15 09:49:00 -07:00
José Fonseca
b0fff8d17e svga: Tell the host to discard when doing writes without FLUSH_EXPLICIT. 2011-03-15 15:44:03 +00:00
José Fonseca
147ca90bd3 svga: Update svga_winsys_screen::buffer_map comments. 2011-03-15 15:43:33 +00:00
José Fonseca
ef33c82bfd svga: Ensure DMA commands are serialized with unsynchronized flag is unset. 2011-03-15 15:38:18 +00:00
Jose Fonseca
a946e84071 scons: copy hash_table.c, symbol_table.c to glsl directory
This fixes an issue where the .obj files wound up in the src/
directory rather than the build/ directory.  That prevented
combined 32-bit and 64-bit builds from working.

Signed-off-by: Brian Paul <brianp@vmware.com>
2011-03-15 15:32:00 +00:00
Marek Olšák
d0e805ebd8 mesa: fix scons build 2011-03-15 16:25:16 +01:00
Marek Olšák
79ddcb93fb r300g: implement the texture barrier 2011-03-15 15:58:12 +01:00
Marek Olšák
aea4ed41ed gallium: add texture barrier support to the interface and st/mesa (v2)
v2: change the gallium entry point to texture_barrier.
2011-03-15 15:58:12 +01:00
Marek Olšák
9a9c1e1ae1 mesa: add display list support for NV_texture_barrier 2011-03-15 15:58:12 +01:00
Marek Olšák
7fa53f37e6 mesa: regenerate glapi files
Be sure to type "make clean" after this commit, otherwise your binaries
will segfault.
2011-03-15 15:58:00 +01:00
Marek Olšák
867f9b07d4 mesa: add NV_texture_barrier 2011-03-15 15:47:27 +01:00
Mathias Fröhlich
65942e141f gallium/util: Use PIPE_TRANSFER_DISCARD_RANGE in pipe_buffer_write.
Additionally, to discarding the whole buffer, use
PIPE_TRANSFER_DISCARD_RANGE in pipe_buffer_write when the
write covers only part of the buffer.

Signed-off-by: Mathias Fröhlich <Mathias.Froehlich@web.de>
2011-03-15 15:39:38 +01:00
Mathias Fröhlich
baab835a1f st/mesa: Make use of the new PIPE_TRANSFER_DISCARD_* for buffer object.
In memory mapping buffer objects make use of
PIPE_TRANSFER_DISCARD_WHOLE_RESOURCE and PIPE_TRANSFER_DISCARD_RANGE
when appropriate.

Signed-off-by: Mathias Fröhlich <Mathias.Froehlich@web.de>
2011-03-15 15:39:31 +01:00
Dave Airlie
fedc5b03db glx: add ARB_create_context functions/ops to glx xml 2011-03-15 14:27:27 +10:00
Henri Verbeet
df3d11f6ca r600g: FLT_TO_INT_FLOOR and FLT_TO_INT_RPI are vector-only instructions on Evergreen.
Signed-off-by: Henri Verbeet <hverbeet@gmail.com>
2011-03-15 01:15:50 +01:00
Alex Deucher
39d60610e8 r600g: fix logic error in 028987c803
Spotted by Henri on IRC.

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2011-03-14 18:07:15 -04:00
Alex Deucher
3e30148900 r600g: don't set per-MRT blend bits on R600
It doesn't support them.  Also, we shouldn't be
emitting CB_BLENDx_CONTROL on R600 as the regs don't
exist there, but I'm not sure of the best way to deal
with this in the current r600 winsys.

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2011-03-14 17:53:00 -04:00
Alex Deucher
d6fea4a985 r600g: Original R600 does not support per-MRT blends
Only rv6xx+ support them.

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2011-03-14 17:47:21 -04:00
Alex Deucher
028987c803 r600g: emit SURFACE_BASE_UPDATE packet on rv6xx
This packet is required when updating the DB, CB,
or STRMOUT base addresses on rv6xx for the surface
sync logic to work correctly.

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2011-03-14 17:42:19 -04:00
Henri Verbeet
1a8dc1539b r600g: Properly update MULTIWRITE_ENABLE in r600_pipe_shader_ps().
This sort of worked because blend state setup cleared MULTIWRITE_ENABLE again,
but that's not something we want to depend on.

Signed-off-by: Henri Verbeet <hverbeet@gmail.com>
2011-03-14 22:15:56 +01:00
Henri Verbeet
ab1a2e454e r600g: Fix the DB_SHADER_CONTROL mask in create_ds_state().
Signed-off-by: Henri Verbeet <hverbeet@gmail.com>
2011-03-14 22:15:56 +01:00
Henri Verbeet
2342e89979 r600g: Properly update DB_SHADER_CONTROL in evergreen_pipe_shader_ps().
Disable Z_EXPORT / STENCIL_EXPORT / KILL_ENABLE again if a shader doesn't
use those. This is similar to 0a6f09a76a.

Signed-off-by: Henri Verbeet <hverbeet@gmail.com>
2011-03-14 22:15:56 +01:00
Henri Verbeet
a2ef38368b r600g: Move fetch shader register setup to r600_state.c / evergreen_state.c.
Signed-off-by: Henri Verbeet <hverbeet@gmail.com>
2011-03-14 22:15:56 +01:00
Henri Verbeet
f262ba26f0 r600g: Move r600_pipe_shader_ps() to r600_state.c.
Signed-off-by: Henri Verbeet <hverbeet@gmail.com>
2011-03-14 22:15:56 +01:00
Henri Verbeet
c0ca43e507 r600g: Move r600_pipe_shader_vs() to r600_state.c.
The idea behind this is that anything touching registers should be in
r600_state.c or evergreen_state.c. This is also consistent with
evergreen_pipe_shader_vs().

Signed-off-by: Henri Verbeet <hverbeet@gmail.com>
2011-03-14 22:15:56 +01:00
Rafael Monica
112ffdfd07 r600g: Evergreen add support for log opcode.
Signed-off-by: Henri Verbeet <hverbeet@gmail.com>
2011-03-14 22:15:56 +01:00
José Fonseca
202c345c7c autoconf/make: Don't specify individual llvm libraries.
We need more and more of these, and it is difficult and prone to version
incompatability issues trying to single out every one of them.

This mimicks what was done in SCons.
2011-03-14 20:05:56 +00:00
Kenneth Graunke
25e3114095 i965: Enable texture lookups whose return type is 'float'
This enables the new shadow texture functions in GLSL 1.30.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Chad Versace <chad.versace@intel.com>
2011-03-14 13:03:50 -07:00
Chad Versace
1842b89f77 i965: Fix tex_swizzle when depth mode is GL_RED
Change swizzle from (x000) to (x001).

Signed-off-by: Chad Versace <chad.versace@intel.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
2011-03-14 13:03:50 -07:00
Chad Versace
e0cbb154f2 i965: Remove dead assignment
The assignment on line 368, `tex_swizzles[i] = SWIZZLE_NOOP`, is rendered
dead by the reassignment on line 392.

Signed-off-by: Chad Versace <chad.versace@intel.com>
Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
2011-03-14 13:03:50 -07:00
Kenneth Graunke
233b88eab9 glsl: Explicitly specify a type when reading/printing ir_texture.
This is necessary for GLSL 1.30+ shadow sampling functions, which return
a single float rather than splatting the value to a vec4 based on
GL_DEPTH_TEXTURE_MODE.
2011-03-14 13:03:50 -07:00
Kenneth Graunke
cb3317b85a texture_builtins.py: Add support for 130-style Shadow sampler variants. 2011-03-14 13:03:50 -07:00
Marek Olšák
bb0910bfa6 mesa: rename _mesa_texstore_a8 -> _mesa_texstore_unorm8
It's a generic function capable of storing A8, L8, I8, R8.
2011-03-14 18:51:29 +01:00
Marek Olšák
c0110d5450 mesa: fix up assertion in _mesa_source_buffer_exists
This was probably missed when implementing luminance and luminance alpha
render targets.

_mesa_get_format_bits checks for both GL_*_BITS and GL_TEXTURE_*_SIZE.

This fixes:
main/framebuffer.c:892: _mesa_source_buffer_exists: Assertion `....' failed.
2011-03-14 10:24:24 +01:00
Marek Olšák
23ccab39cd r300g: clamp after blending for fixed-point formats only 2011-03-14 10:09:34 +01:00
Dave Airlie
340e15c79b glx: the server still needs __GLXcontext.
This file generates code for the X server and it still uses
the __GLXcontext structure name.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-03-14 15:03:53 +10:00
Marek Olšák
0f84ddad29 ir_to_mesa: do not check the number of uniforms against hw limits
The r300 compiler can eliminate unused uniforms and remap uniform locations
if their number surpasses hardware limits, so the limit is actually
NumParameters + NumUnusedParameters. This is important for some apps
under Wine to run.

Wine sometimes declares a uniform array of 256 vec4's and some Wine-specific
constants on top of that, so in total there is more uniforms than r300 can
handle. This was the main motivation for implementing the elimination
of unused constants.

We should allow drivers to implement fail & recovery paths where it makes
sense, so giving up too early especially when comes to uniforms is not
so good idea, though I agree there should be some hard limit for all drivers.

This patch fixes:
- glsl-fs-uniform-array-5
- glsl-vs-large-uniform-array
on drivers which can eliminate unused uniforms.
2011-03-14 03:12:34 +01:00
Dave Airlie
110f5e2056 autoconf/llvm: fix build for disassembler
tested by okias on irc
2011-03-14 09:37:08 +10:00
José Fonseca
c27e58c109 gallivm: Fix build with llvm 2.6 on 32bit platforms 2011-03-13 19:49:21 +00:00
José Fonseca
e6314db0ac gallivm: Use LLVM MC disassembler, instead of udis86.
Included in LLVM 2.7+. Unlink udis86, should support all instructions that
LLVM can emit.
2011-03-13 19:24:26 +00:00
José Fonseca
d2332569d2 util: Silence gcc unitialized member warning 2011-03-13 18:56:19 +00:00
José Fonseca
b79b05e17e draw: Fix draw_variant_output::format's type. 2011-03-13 18:56:07 +00:00
Christoph Bumiller
c448a556e9 nv50,nvc0: don't assert on cso with 0 vertex elements 2011-03-13 18:19:22 +01:00
Jakob Bornecrantz
07838ff990 rbug: Use the call mutex
Fixes crashes in [soft|llvm]pipe when replacing shaders
2011-03-13 18:13:55 +01:00
Mathias Fröhlich
0a6f09a76a r600g: Only update DB_SHADER_CONTROL once in r600_pipe_shader_ps().
Avoid setting the same gpu register several times in a r600_pipe_state.
Compute the final value of the register and set that one time. This avoids
some overhead in r600_context_pipe_state_set().

Signed-off-by: Mathias Fröhlich <Mathias.Froehlich@web.de>
Signed-off-by: Henri Verbeet <hverbeet@gmail.com>
2011-03-13 17:25:16 +01:00
Jakob Bornecrantz
629bc76b75 tgsi: Fix parsing of properties with digits in the name 2011-03-13 15:35:35 +01:00
Jakob Bornecrantz
f4e6061d88 rbug: Skip drawing on disabled shaders 2011-03-13 13:36:21 +01:00
Jakob Bornecrantz
dfac72208d rbug: Remove flags from flush 2011-03-13 13:36:21 +01:00
Jakob Bornecrantz
c7894dfad9 i915g: Lie more so we get GLSL
Lots of piglit tests are lazy and wants GLSL
2011-03-13 13:36:21 +01:00
Jakob Bornecrantz
c03be14d42 i915g: Point sprite cap could be supported 2011-03-13 13:36:21 +01:00
Jakob Bornecrantz
6d86429bd9 i915g: Sort cap list 2011-03-13 13:36:21 +01:00
Christoph Bumiller
07f73577af nvc0: support edge flags 2011-03-13 13:23:55 +01:00
Christoph Bumiller
c0f53fe8aa nvc0: fix POLYGON_MODE_BACK macro copy/paste error 2011-03-13 13:23:55 +01:00
Christoph Bumiller
e864ccb3f2 nv50,nvc0: fix pipe context switch 2011-03-13 13:23:55 +01:00
Christoph Bumiller
4388817a67 nv50,nvc0: clean up flushes 2011-03-13 13:23:55 +01:00
Christoph Bumiller
26a199efac nv50,nvc0: add some missing resource referencing 2011-03-13 13:23:55 +01:00
Christoph Bumiller
259efc90e7 nvc0: mask out centroid bit for writing FP header
It's only 2 bit per input, centroid is set in the instruction.
2011-03-13 13:23:55 +01:00
Christoph Bumiller
0abaaac872 nvc0: identify VERTEX_QUARANTINE
Well, not sure what exactly it is, but it certainly doesn't contain
the control flow stack, but vertex data.

Not sure about size, I've only seen the first few KiB written, but
the binary driver seems to allocate more.
2011-03-13 13:23:55 +01:00
Christoph Bumiller
f0ee7d8bb4 nvc0: don't enable early-z if alpha test is enabled
Depth values are also written before the shader is executed, so if
early tests are enabled, fragments that failed the alpha test were
modifying the depth buffer, but they shouldn't.
2011-03-13 13:23:54 +01:00
Christoph Bumiller
d9f1310e51 nvc0: move sprite coord replace state into cso
It's not dependent on any other state anymore now.
2011-03-13 13:23:54 +01:00
Christoph Bumiller
11f07a35f4 nvc0: s/nblocksx/nblocksy for height in resource_copy_region 2011-03-13 13:23:54 +01:00
Christoph Bumiller
d7a23cfb88 nvc0: fix unitialized variable in TGSI sysval decl processing 2011-03-13 13:23:54 +01:00
Christoph Bumiller
f10b2021c1 nvc0: update/fix supported instruction src modifiers 2011-03-13 13:23:54 +01:00
Chad Versace
dedc81e1dc glsl: Document glsl_type::sampler_dimensionality 2011-03-12 17:39:48 -08:00
Eric Anholt
098f9c5325 Revert "mesa: Convert fixed function fragment program generator to GLSL IR."
This reverts commit 7cb87dffce.
There were regressions (Bug #35244) and more review has been requested.
2011-03-12 15:11:01 -08:00
Eric Anholt
07c420a3c6 Revert "mesa: Track a computed _CurrentFragmentProgram for current gl_shader_program"
This reverts commit b4452c3baa.
2011-03-12 15:11:00 -08:00
Eric Anholt
403be11111 Revert "i965: Use the fixed function GLSL program instead of the ARB program."
This reverts commit 81b34a4e3a.  There
were regressions in the core change that this depends on.
2011-03-12 15:11:00 -08:00
Daniel Vetter
7735f8c6e5 i915g: fix transfer coherency
The kernel drm takes care of all coherency as long as we don't forget
to submit all outstanding commands in the batchbuffer ...

Also move batchbuffer initialization up because otherwise transfers
for some helper textures fail with a segmentation fault.

And kill the dead code, flushes should now be correct everywhere.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-12 22:58:19 +01:00
Daniel Vetter
f608795588 i915g: don't recalculate fb dimension
The statetracker should do this for us correctly.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-12 20:32:30 +01:00
Daniel Vetter
d46c6084ce i915g: use y-tiling when the blitter is not used
The blitter is broken. Who'd have guessed?

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-12 20:32:29 +01:00
Daniel Vetter
f0c56e2a23 i915g: implement copy_region using u_blitter
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>works
2011-03-12 20:32:29 +01:00
Daniel Vetter
06713a4079 i915g: fix use after free
Pipe templates should be copied if still needed after the create
call completes.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-12 20:31:30 +01:00
Jakob Bornecrantz
1a79064da1 gallium: Delay the creation of simple helper shaders 2011-03-12 19:39:45 +01:00
Carl-Philip Hänsch
7339915a4b r600g: Fix VS sampler view offsets for r600/r700.
077c448d18 missed this.

Signed-off-by: Henri Verbeet <hverbeet@gmail.com>
2011-03-12 19:33:16 +01:00
Henri Verbeet
656c314573 r600g: Fix an unused variable warning. 2011-03-12 16:43:58 +01:00
Henri Verbeet
ab21147c89 u_blitter: Do blits in linear color space.
Blits between sRGB and linear formats should happen in linear color space.
This fixes piglit fbo/fbo-srgb-blit.
2011-03-12 16:43:58 +01:00
Marek Olšák
6da4866ffd r300/compiler: do not set TEX_IGNORE_UNCOVERED on r500
The docs say it can be set for direct texture lookups, but even that
causes problems.

This fixes the wireframe bug:
https://bugs.freedesktop.org/show_bug.cgi?id=32688

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-03-12 11:54:23 +01:00
Marek Olšák
1e97b4dd10 r300/compiler: TEX instructions don't support negation on source arguments
This fixes piglit:
- glsl-fs-texture2d-dependent-4

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-03-12 10:22:18 +01:00
Marek Olšák
589d835dfd r300/compiler: Abs doesn't cancel Negate (in the conversion to native swizzles)
NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-03-12 10:18:45 +01:00
Marek Olšák
d96305e4fc r300/compiler: fix translating the src negate bits in pair_translate
(1, -_, ...) was converted to (-1, ...) because of the negation
in the second component.
Masking out the unused bits fixes this.

Piglit:
- glsl-fs-texture2d-branching

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-03-12 09:39:46 +01:00
Marek Olšák
1868d21c8e st/dri: fix warning: ‘bind’ may be used uninitialized in this function 2011-03-12 08:49:54 +01:00
Marek Olšák
f1e160f89b llvmpipe: fix warning: ‘t0’ may be used uninitialized in this function 2011-03-12 08:48:43 +01:00
Marek Olšák
4b92c688a4 r300g: implement fragment color clamping in the shader
This finishes the implementation of the fragment color clamp control
for ARB_color_buffer_float. I don't wanna keep this stuff in a branch...
2011-03-12 07:56:33 +01:00
Marek Olšák
e4707604ab r300/compiler: fix the saturate modifier when applied to TEX instructions
This bug can only be triggered if the source texture is either signed or float.
2011-03-12 07:54:23 +01:00
Adam Jackson
cbcb84fccf r600g: revert unintentional commit 2011-03-11 17:46:03 -05:00
Adam Jackson
02725bc8b0 nouveau: Build fix
nouveau_vieux_dri.so.tmp: undefined reference to `_mesa_need_secondary_color'
2011-03-11 17:37:21 -05:00
Adam Jackson
b5872cdda0 r600: Build fix
r600_dri.so.tmp: undefined reference to `_mesa_rgba_logicop_enabled'
2011-03-11 17:24:47 -05:00
Vinson Lee
4faa95e74d st/python: Remove flags from flush function. 2011-03-11 14:00:32 -08:00
Vinson Lee
9c366ceedb st/python: Remove the geom_flags param from is_format_supported. 2011-03-11 13:37:30 -08:00
Vinson Lee
d17ef8636d st/python: Clean up fence_finish. 2011-03-11 13:35:06 -08:00
Vinson Lee
dee6eafbd2 scons: Move texenvprogram.c to ff_fragment_shader.cpp. 2011-03-11 13:32:41 -08:00
Eric Anholt
81b34a4e3a i965: Use the fixed function GLSL program instead of the ARB program.
This gets one more piece of the pipeline onto the new codegen backend.
Once ARB_fragment_program can generate GLSL programs, we can nuke the
old backend.
2011-03-11 12:55:14 -08:00
Eric Anholt
b4452c3baa mesa: Track a computed _CurrentFragmentProgram for current gl_shader_program
This is like how we track FragmentProgram._Current for the computed
ARB fragment program for fixed function texenv, but this gives direct
access to the gl_shader_program for drivers to codegen from, skipping
ARB_fp.
2011-03-11 12:55:14 -08:00
Eric Anholt
7cb87dffce mesa: Convert fixed function fragment program generator to GLSL IR.
This is a step towards providing a direct route for drivers accepting
GLSL IR for codegen.  Perhaps more importantly, it runs the fixed
function fragment program through the GLSL IR optimization.  Having
seen how easy it is to make ugly fixed function texenv code that can
do unnecessary work, this may improve real applicatinos.
2011-03-11 12:55:14 -08:00
Eric Anholt
29e013e58b mesa: Add gl_MESAFogParamsOptimized for our special pre-computed fog params.
It would be nice if we handled optimized uniform math like this in
some generic way, since people often end up doing uniform expressions
in shaders, but for now keep this hard-coded like it was in the
texenvprogram code.
2011-03-11 12:55:14 -08:00
Eric Anholt
20f7a6f11a mesa: Add a builtin uniform for the ATI_envmap_bumpmap rotation matrix.
For fixed function fragment processing in GLSL IR, we want to be able
to reference this state value.  gl_* not explicitly permitted is
reserved, so using this variable name internally shouldn't be any
issue.
2011-03-11 12:55:14 -08:00
Eric Anholt
cdacca4868 mesa: Move texenvprogram.c to ff_fragment_shader.cpp.
This file is about to change to generating a shader program instead of
a fragment program.
2011-03-11 12:55:13 -08:00
Eric Anholt
e1cb12bfff prog_cache: Add some support for shader_programs in prog_cache.
This is used in the upcoming fixed function shader_program generation,
and shader_program and ARB programs are together in this code until
both fragment and vertex ff get converted.
2011-03-11 12:55:13 -08:00
Eric Anholt
9c7231c1d9 mesa: Don't try to remove an internal shader_program from the hash.
It fails on assertions if the key isn't actually present.
2011-03-11 12:55:13 -08:00
Eric Anholt
5ae1d19506 i965: Use ffs() on a 32-bit int value instad of ffsll(). 2011-03-11 12:55:13 -08:00
Marek Olšák
7e02303497 gallium: remove flags from the flush function
The drivers have been changed so that they behave as if all of the flags
were set. This is already implicit in most hardware drivers and required
for multiple contexts.

Some state trackers were also abusing the PIPE_FLUSH_RENDER_CACHE flag
to decide whether flush_frontbuffer should be called.
New flag ST_FLUSH_FRONT has been added to st_api.h as a replacement.
2011-03-11 21:39:31 +01:00
Marek Olšák
e968975cb5 gallium: remove the geom_flags param from is_format_supported 2011-03-11 21:39:30 +01:00
Marek Olšák
bfe88e6998 gallium: cleanup fence_signalled and fence_finish
So that they don't have the driver-specific param and return type.
2011-03-11 21:39:30 +01:00
Marek Olšák
25485f4b69 gallium: kill is_resource_referenced
Only st/xorg used it and even incorrectly with regards to pipelined transfers.
2011-03-11 21:39:30 +01:00
Adam Jackson
2b64886c81 swrastg: Add __DRI_TEX_BUFFER support
Without this, EXT_texture_from_pixmap is trivially broken.  With it,
it's merely subtly broken.

Signed-off-by: Adam Jackson <ajax@redhat.com>
2011-03-11 14:49:28 -05:00
Brian Paul
d7db14ab7d mesa: test against MaxUniformComponents in check_resources()
Since we're compiling/linking GLSL shaders we should check against
the shader uniform limits, not the legacy vertex/fragment program
parameter limits which are usually lower.
2011-03-11 10:04:17 -07:00
Brian Paul
e0e94026a0 mesa: move location of some geometry program limits
The gl_program_constants struct is for limits that are applicable to
any/all shader stages.  Move the geometry shader-only fields into the
gl_constants struct.
Remove redundant MaxGeometryUniformComponents field too.
2011-03-11 09:25:22 -07:00
Brian Paul
8cc84b3e45 mesa: use check_resources() to check program against limits
Without these checks we could create shaders with more samplers,
constants than the driver could handle.  Fail linking rather than
dying later.
2011-03-11 09:25:22 -07:00
Brian Paul
decc6e2a32 mesa: replace NEED_SECONDARY_COLOR(), RGBA_LOGICOP_ENABLED() with inlines
and rename them.
2011-03-11 09:25:21 -07:00
Brian Paul
4293a12c7f mesa: call FLUSH_VERTICES() before deleting shaders, buffers, query objects
Need to flush rendering (or at least indicate that the rug might be getting
pulled out from underneath us) when a shader, buffer object or query object
is about to be deleted.

Also, this helps to tell the VBO module to unmap its current vertex buffer.
2011-03-11 09:25:21 -07:00
Brian Paul
a4a5d7e0dd vega: remove unused pipe var 2011-03-11 09:25:21 -07:00
José Fonseca
530ad1ff6f svga: Propagate discard/unsynchronized flags to the host when doing texture DMAs. 2011-03-11 15:03:21 +00:00
José Fonseca
f0ea6395b6 util: Fix typo in u_upload_flush().
upload->offset is how much we used. upload->size is the whole buffer size.
2011-03-11 11:54:26 +00:00
Nicolas Peninguy
b6c9c78bff r300g: fix alignement for NPOT values in hyperz setup
With 3 pipes cards we need to align with NPOT values. This fixes:
https://bugs.freedesktop.org/show_bug.cgi?id=32945

Signed-off-by: Nicolas Peninguy <nico@lostgeeks.org>
2011-03-11 04:36:37 +01:00
Marek Olšák
8a01cb8793 draw: remove unnecessary flush 2011-03-11 02:02:16 +01:00
Marek Olšák
cb06f180e3 st/vega: remove unnecessary flushes
I don't see a reason we need them.
2011-03-11 02:02:16 +01:00
Marek Olšák
bdf1038940 st/mesa: remove unnecessary flushes
The framebuffer cache flush should be implicit when calling
set_framebuffer_state.

There is no need to flush the command stream either.
2011-03-11 02:02:16 +01:00
Thomas Hellstrom
ded1e315a4 Revert "gallium/svga: Only upload parts of vertexarrays that are actually used"
This reverts commit 6d4e337f38.

The commit is incorrect. I'll rework it. Revert for now.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2011-03-10 23:31:42 +01:00
Daniel Vetter
fb3b712b84 i915g: implement surface clear functions using hw-clear
Tested by temporarily using util_clear even when not using the blitter.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-10 23:04:20 +01:00
Daniel Vetter
6ad4a11b3e i915g: make set_framebuffer_state more robust
u_blitter is lazy and doesn't fully clear it's stack-allocated fb.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-10 23:04:19 +01:00
Daniel Vetter
6358e6371b i915g: implement hw clear
Benefits:
- spares us a relocation.
- needed for zone rendering (if that ever happens).
- just awesome.

v2: Rename the debug option. Completely disabling the blitter is
required for Y tiling to work, so this option will cover other
code paths in the future.

v3: Implement suggestions by Jakob Bornecrantz.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-10 23:04:10 +01:00
Daniel Vetter
8c420db1c4 i915g: blitter handles overlapping blits
No need to assert.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-10 22:47:50 +01:00
Daniel Vetter
55d2d7fb3a i915g: enable separate depth/stencil clears
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-10 22:47:49 +01:00
Daniel Vetter
9070879a79 i915g: streamline derived state updates of the driver pipeline
Flushing the batch/hw backend doesn't invalidate the derived state.
So kill the unnecessary function calls and add an assert in
emit_hardware_state for paranoia.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-10 22:47:48 +01:00
Daniel Vetter
b0dd74aaf7 i915g: don't validate a NULL vbo
With the new clear code this is possible (if the app call glClear
before drawing the first primitive).

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-10 22:47:47 +01:00
Brian Paul
7dcf019af2 gallium/util: new polygon stipple utility helper
The polygon stipple fallback does not have to be implemented in the
draw module (it doesn't need window coords, etc).  Drivers can use
this utility and avoid sw vertex fallbacks if pstipple is enabled.
Note: this is WIP and not used by any driver yet.
2011-03-10 09:44:32 -07:00
Brian Paul
0eab3a8a97 glsl: silence warning in printf() with a cast 2011-03-10 09:29:00 -07:00
Brian Paul
76a43c5fba glx: fix null pointer deref in __glXGenerateError()
The gc var would be NULL if called from line 238.  Instead, get
the opcode from __glXSetupForCommand(dpy) as done in other places.
And remove the unused gc parameter.

Fixes a bug reported by "John Doe" on 3/9/2011.

NOTE: This is a candidate for the 7.10 branch.
2011-03-10 08:50:52 -07:00
Thomas Hellstrom
6d4e337f38 gallium/svga: Only upload parts of vertexarrays that are actually used
Make sure we only upload parts of vertex arrays that are actually used
by a draw command.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2011-03-10 14:30:50 +01:00
Dave Airlie
9b7f377635 r600: don't close fd on failed load
This fd gets passed in from outside, closing it causes the X.org server
to crap out when the driver doesn't identify the chipset.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-03-10 12:01:43 +10:00
Eric Anholt
f6ca4a304b intel: Don't complain when getparam fails due to a missing param.
This is an expected behavior when we're testing for the presence of
new kernel features.
2011-03-09 12:54:47 -08:00
Chris Wilson
ea004a3aed i965: Pack the tracked state atoms into separate arrays for prepare/emit.
Improves performance of a hacked-up scissor-many (to reuse a small set
of scissors instead of blowing out the cache, and then to run 100x
more iterations so it actually took some time) by 3.6% +/- 1.2% (n=10)
2011-03-09 10:18:29 -08:00
Christoph Bumiller
caaa7fdd6f nv50: add back initialization of redefine_user_buffer
Got lost in f80c03e187.
2011-03-09 17:26:33 +01:00
Christian König
bb4f2a0f35 r600g: remove some now unneeded code from r600_bc_vtx_build 2011-03-09 14:49:03 +01:00
Christian König
2ed56d3170 r600g: R700+ can do more than 8 tex and vtx clause in one CF inst
Reviewed-by: Henri Verbeet <hverbeet@gmail.com>
2011-03-09 14:49:03 +01:00
Christian König
8dc1dfc9f0 r600g: split R600 and R700 CF generation for VTX and TEX
Reviewed-by: Henri Verbeet <hverbeet@gmail.com>
2011-03-09 14:49:03 +01:00
José Fonseca
8308272291 svga: Add a new winsys entry point to query the hw version. 2011-03-09 13:34:21 +00:00
José Fonseca
d5249b7d89 util: Use PIPE_TRANSFER_DISCARD_WHOLE_RESOURCE in pipe_buffer_write. 2011-03-09 11:17:45 +00:00
Keith Whitwell
05efcee46e util: add ensure_sanity checks, fix a bug
Add ensure_sanity checks.
Fix a bug which caused us to misplace entries adding to a full cache.
2011-03-09 11:17:14 +00:00
Keith Whitwell
20962bf547 util: improve cache collision behaviour
Add linear probing on collisions.

Expand entry array by a fixed scale (currently 2) to help avoid
collisions.

Use a LRU approach to ensure that the number of entries stored in the
cache doesn't exceed the requested size.
2011-03-09 11:16:53 +00:00
Alex Corscadden
d00cbf46cd util: Add remove to util_cache
I need to be able to remove entries from util_cache caches.  This change
enables that functionality.
2011-03-09 11:16:49 +00:00
Alex Corscadden
eb2e8167fa util: Allow util_draw_texquad to draw quads with non-integer coordinates. 2011-03-09 11:16:49 +00:00
José Fonseca
0ffd603e17 wgl: Force framebuffer validation on glViewport. 2011-03-09 09:58:35 +00:00
Thomas Hellstrom
52e598d200 gallium/svga: Don't replace user vertex buffer with uploaded copy
Do that later on when we set up the hwtnl state instead.
This addresses a problem when we drop the uploaded copy due to a vb
size change, it will remain referenced in svga->curr.vb[], and the
new contents of the vb will never be uploaded.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2011-03-09 08:49:33 +01:00
Vinson Lee
c0d3fb4b6c scons: Fix immediate Python exceptions with SCons on SunOS.
The build still fails.
2011-03-08 17:59:57 -08:00
Vinson Lee
67f61199c2 st/python: Add timeout parameter to fence_finish.
This is a follow-up to commit b39bccbd4e.

Fixes Linux SCons build.
2011-03-08 16:18:16 -08:00
Marek Olšák
ac8821ffe2 r300g: handle timeout parameter in fence_finish 2011-03-08 23:52:37 +01:00
Marek Olšák
b39bccbd4e gallium: add timeout parameter to fence_finish
This is a follow-up to the ARB_sync patch for st/mesa and completes
the ARB_sync implementation.
2011-03-08 23:52:37 +01:00
Marek Olšák
5257a6dbc6 st/mesa: implement ARB_sync
The ServerWaitSync implementation matches Intel's driver.

The extension is advertised when pipe_screen::fence_finish is set.
2011-03-08 23:52:37 +01:00
Marek Olšák
5ef807c036 r300g: add LATC support 2011-03-08 23:52:37 +01:00
Marek Olšák
b0ec461954 st/mesa: cleanup checking for signed compressed formats in generate_mipmaps 2011-03-08 23:52:37 +01:00
Marek Olšák
384845f335 st/mesa: add LATC and 3DC support
softpipe passes all tests.
2011-03-08 23:52:37 +01:00
Marek Olšák
23f92c20d7 gallium/util: add LATC support
Again, a lot of code is shared with RGTC.

The layout is UTIL_FORMAT_LAYOUT_RGTC, because LATC is just swizzled RGTC.
2011-03-08 23:52:37 +01:00
Marek Olšák
69f16accd0 mesa: add ATI_texture_compression_3dc
LUMINANCE_ALPHA_LATC2 = LUMINANCE_ALPHA_3DC, so this is easy.

Note that there is no specification for 3DC, just a few white papers
from ATI.
2011-03-08 23:52:37 +01:00
Marek Olšák
7d16e2c0cd mesa: add EXT_texture_compression_latc
The encoding/decoding algorithms are shared with RGTC.
Thanks to some magic with the base format, the RGTC texstore functions work
for LATC too.

swrast passes the related piglit tests besides two things:
- The alpha channel is wrong (it's always 1), however the incorrect alpha
  channel makes some other tests fail too, so I guess it's unrelated to LATC.
- Signed LATC fetches aren't correct yet (signed values are clamped to [0,1]),
  however RGTC has the same problem.

Further testing (with other of my patches) shows that hardware drivers
and softpipe work.

BTW, ETQW uses this extension.
2011-03-08 23:52:37 +01:00
Thomas Hellstrom
12fa91b675 st/mesa: Fix an incorrect user vertex buffer reference
st->user_vb[attr] was always pointing to the same user vb, regardless
of the value of attr. Together with reverting the temporary workaround
for bug 34378, and a fix in the svga driver, this fixes googleearth on svga.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2011-03-08 22:15:50 +01:00
Marek Olšák
ef58598c1c vbo: mark vertex arrays as dirty when re-binding
This fixes:
https://bugs.freedesktop.org/show_bug.cgi?id=34378
2011-03-08 22:14:47 +01:00
Marek Olšák
ff8baec5bc r300/compiler: remove unused variables 2011-03-08 22:13:29 +01:00
Ian Romanick
bdb6a6ef83 glsl: Use insert_before for lists instead of open coding it 2011-03-08 11:47:25 -08:00
Ian Romanick
60f898a90e linker: Add imported functions to the linked IR
Fixes piglit test glsl-function-chain16 and bugzilla #34203.

NOTE: This is a candidate for stable release branches.
2011-03-08 11:47:25 -08:00
Ian Romanick
8bbfbb14ee glsl: Add several function / call related validations
The signature list in a function must contain only ir_function_signature nodes.

The target of an ir_call must be an ir_function_signature.

These were added while trying to debug Mesa bugzilla #34203.
2011-03-08 11:47:25 -08:00
Ian Romanick
2df56b002d glsl: Function signatures cannot have NULL return type
The return type can be void, and this is the case where a `_ret_val'
variable should not be declared.
2011-03-08 11:47:25 -08:00
Christian König
719f07e45a r600g: set start instance correctly 2011-03-08 16:57:47 +01:00
Brian Paul
4a802738b0 swrast: flip the conditionals in shadow_compare4() for readability 2011-03-08 08:31:43 -07:00
Philip Taylor
d9f584e663 swrast: add coord clamping, fix comparisons for shadow testing
This fixes https://bugs.freedesktop.org/show_bug.cgi?id=31159 for swrast
and piglit depth-tex-compare.

NOTE: This is a candidate for the 7.10 branch.

Signed-off-by: Brian Paul <brianp@vmware.com>
2011-03-08 08:31:43 -07:00
Brian Paul
9181a75c4d docs: added Depth format cube textures to GL3.txt list 2011-03-08 08:31:42 -07:00
Marek Olšák
5650a719f0 r300g: decide whether a flush should be asynchronous when calling it
Thread offloading is not sometimes desirable, e.g. when mapping a buffer.
2011-03-08 08:23:29 +01:00
Marek Olšák
6051f26b78 r300g: use pipelined transfers for RGTC textures 2011-03-08 08:17:12 +01:00
Marek Olšák
4dfcf3c4fe r300/compiler: fix equal and notequal shadow compare functions 2011-03-08 07:36:40 +01:00
Marek Olšák
94818d4c6a r300/compiler: detect constants harder 2011-03-08 06:54:14 +01:00
Marek Olšák
4f38261179 r300/compiler: improve the detection of constants for constant folding
Now the expression V==0 generates one instruction instead of two.
2011-03-08 06:37:50 +01:00
Marek Olšák
eb1acd1613 r300/compiler: saturate Z before the shadow comparison
This fixes:
https://bugs.freedesktop.org/show_bug.cgi?id=31159

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-03-08 05:13:45 +01:00
Brian Paul
2c1ef65a04 llvmpipe: clamp texcoords in lp_build_sample_compare()
See previous commit for more info.

NOTE: This is a candidate for the 7.10 branch.
2011-03-07 18:59:42 -07:00
Philip Taylor
0eef561a5b softpipe: clamp texcoords in sample_compare()
This fixes http://bugs.freedesktop.org/show_bug.cgi?id=31159 for softpipe
and fixes the piglit depth-tex-compare test.

NOTE: This is a candidate for the 7.10 branch.

Signed-off-by: Brian Paul <brianp@vmware.com>
2011-03-07 18:56:54 -07:00
Marek Olšák
a674ef7814 mesa: return after invalidating renderbuffer 2011-03-07 23:33:36 +01:00
Marek Olšák
fb5d9e1199 st/mesa: fail to alloc a renderbuffer if st_choose_renderbuffer_format fails
This fixes:
  state_tracker/st_format.c:401:st_pipe_format_to_mesa_format:
  Assertion `0' failed.
2011-03-07 23:27:35 +01:00
Marek Olšák
df818d572e mesa: invalidate framebuffer if internal format of renderbuffer is changed
RenderTexture doesn't have to be called in invalidate_rb, I guess.
2011-03-07 23:27:35 +01:00
Brian Paul
f4ca12c4f1 mesa: initialize DummyBufferObject's mutex
The mutex's fields were all zeros.  That's OK on Linux, but not Windows.

NOTE: This is a candidate for the 7.10 branch.
2011-03-07 14:58:39 -07:00
Brian Paul
ce6f16d382 st/mesa: fix incorrect version checking code 2011-03-07 14:58:39 -07:00
Brian Paul
8329f4db61 st/glx: whitespace, 80-column fixes 2011-03-07 14:58:39 -07:00
Brian Paul
51db2045b4 mesa: remove stray _mesa_finish() call in _mesa_CopyPixels()
Leftover debug code from 6364d75008.
2011-03-07 14:01:09 -07:00
Henri Verbeet
0e4750a84d r600g: Simplify some swizzle lookups. 2011-03-07 21:48:21 +01:00
Henri Verbeet
eac50295fc r600g: Constant buffers can contain up to 4096 constants. 2011-03-07 21:48:21 +01:00
Henri Verbeet
a8bde5c47e i915: Only invert wpos when rendering to the system framebuffer. 2011-03-07 21:48:21 +01:00
Henri Verbeet
a99b23752b i915: Derive the gl_fragment_program from i915_fragment_program.
Instead of using the current gl_fragment_program. These aren't necessarily
the same, for example when translate_program() is called by
i915ValidateFragmentProgram().
2011-03-07 21:48:21 +01:00
Henri Verbeet
c3c91a0fe5 glx: Take GLPROTO_CFLAGS into account. 2011-03-07 21:48:20 +01:00
Chris Wilson
6547253bd1 intel: check for miptree allocation failure
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-03-07 10:53:09 +00:00
Chris Wilson
de7678ef52 intel: Add some defense against buffer allocation failure for subimage blits
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-03-07 10:53:05 +00:00
Chris Wilson
f627d429bd intel: Add some defense against bo allocation failure
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-03-07 10:53:00 +00:00
Benjamin Franzke
4f6fbfa0ed egl_dri2: Add attribute map for __DRI_ATTRIB_FRAMEBUFFER_SRGB_CAPABLE
Broken since 6538b5824e.
Thanks to iskren on #wayland for helping on finding this.
2011-03-07 00:32:05 +01:00
Christian König
e0cf8471a1 r600g: use long long integers for instance addr calculation
Using a long for instance addr calculation isn't
big enough on 32bit systems, use a long long int instead.

Thanks to Rafael Monica for fixing this.
2011-03-06 23:37:47 +01:00
Dave Airlie
6538b5824e glx/dri: add initial dri interface for GLX_EXT_framebuffer_sRGB.
This realigns the name of the glx bit to align with the core mesa names.
2011-03-06 20:06:42 +10:00
Dave Airlie
b09b3e5c8f glx: add initial GLX_EXT_framebuffer_sRGB support.
this doesn't bind to drivers yet, just enough to in theory make indirect
work against other servers.

I'm really not sure what the rules for adding extensions to the known_gl_extensions list as it looks to be missing a few. are these GL extensions that have GLX
protocol??

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-03-06 19:56:22 +10:00
José Fonseca
7cb17862c6 pb: Add is_buffer_busy for malloc buffers. 2011-03-06 09:12:58 +00:00
José Fonseca
e1510d4816 st/wgl: No need to initialize OneTimeLock anymore. 2011-03-06 09:12:30 +00:00
José Fonseca
b531b01b70 mapi: _glthread_DECLARE_STATIC_MUTEX is not broken on Windows. 2011-03-06 09:11:59 +00:00
José Fonseca
e640eec9ba trace: Use pipe_static_mutex. 2011-03-06 09:11:13 +00:00
José Fonseca
db6d0d9ebf os: Fix pipe_static_mutex on Windows. 2011-03-06 09:10:38 +00:00
José Fonseca
5e1b31066b graw-gdi: Silence gcc missing initialization warning. 2011-03-06 09:10:03 +00:00
Daniel Vetter
f95892b46a i915g: update TODO
Comments about the deleted stuff:
- openaren hang: likely caused by the vertex corruptions, fixed by Jakob.
- tiling: Y-tiling works with my hw-clear branch. X-tiling works as
  merged to master a while ago (execbuf2 version).

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-06 00:39:18 +01:00
Marek Olšák
b6a9675b2f r300g/swtcl: advertise draw_instanced and primitive_restart 2011-03-05 17:41:12 +01:00
Marek Olšák
65482f2c2b r300g: implement instanced arrays 2011-03-05 17:41:11 +01:00
Marek Olšák
95c7881ac8 gallium: split CAP_INSTANCE_DRAWING into INSTANCEID and INSTANCE_DIVISOR
ARB_instanced_arrays is a subset of D3D9.
ARB_draw_instanced is a subset of D3D10.

The point of this change is to allow D3D9-level drivers to enable
ARB_instanced_arrays without ARB_draw_instanced.
2011-03-05 17:40:19 +01:00
Marek Olšák
307408a4f8 r300g: cleanup parameters of draw functions 2011-03-05 16:13:43 +01:00
Christoph Bumiller
533bf171d4 nv50: support the InstanceID system value 2011-03-05 14:53:23 +01:00
Christian König
17b9b757b7 r600g: simplify instance addr calculation
Use MULHI_UINT instead of the more complex
INT_TO_FLT->MUL->TRUNC->FLT_TO_INT
2011-03-05 13:42:51 +01:00
Vinson Lee
19355a461a nvc0: Update SConscript. 2011-03-04 17:15:21 -08:00
Vinson Lee
dbf4970b69 nv50: Update SConscript. 2011-03-04 17:11:35 -08:00
Christian König
fd2409ca27 r600g: fix fragment shader size calculation
bc.ndw is altered in r600_bc_build, respect that
in fragment shader size calculation.
2011-03-05 01:52:44 +01:00
Ian Romanick
09a4ba0fc3 glsl: Process redeclarations before initializers
If an array redeclaration includes an initializer, the initializer
would previously be dropped on the floor.  Instead, directly apply the
initializer to the correct ir_variable instance and append the
generated instructions.

Fixes bugzilla #34374 and piglit tests glsl-{vs,fs}-array-redeclaration.

NOTE: This is a candidate for stable release branches.  0292ffb8 and
8e6cb9fe are also necessary.
2011-03-04 16:33:31 -08:00
Ian Romanick
0292ffb85c glsl: Refactor AST-to-HIR code handling variable initializers 2011-03-04 16:32:37 -08:00
Ian Romanick
8e6cb9fe51 glsl: Refactor AST-to-HIR code handling variable redeclarations 2011-03-04 16:32:37 -08:00
Christoph Bumiller
b0698396dc nv50,nvc0: get format desc for TIC entry from sampler view format
Fixes piglit/tex-srgb.
2011-03-05 00:51:07 +01:00
Christoph Bumiller
1f5d6fc59b nv50,nvc0: share sampler state creation 2011-03-05 00:51:07 +01:00
Christoph Bumiller
e4c968cdbb nv50,nvc0: update the format tables
Removed sampler view support for USCALED/SSCALED, the texture unit
refuses to convert to non-normalized float. The enums are treated
like UNORM.

Removed duplicate format related headers.
2011-03-05 00:51:07 +01:00
Christoph Bumiller
f556b897eb nvc0: use m2mf for resource_copy_region if formats are equal
Which is always the case, but we'll keep the 2D engine blitter
nonetheless.
2011-03-05 00:51:07 +01:00
Christoph Bumiller
4fae7da9a3 nv50,nvc0: fix texture layer issues 2011-03-05 00:51:07 +01:00
Jakob Bornecrantz
9f0acfe138 i915g: Use tgsi_info from fragment shader instead 2011-03-05 00:23:27 +01:00
Daniel Vetter
98b418e56e i915g: use passthough shader for empty fragment programs
The hw doesn't like it - demos/shadowtex is broken. The emitted shader
isn't totally empty though, the depth write fixup gets emitted instead.
Maybe that one is somewhat fishy, too?

Idea for this patch from Jakob Bornecrantz.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-04 23:46:20 +01:00
Benjamin Franzke
22d9ae11bc egl_dri2: Fix incompatible vfunc-pointer warning 2011-03-04 16:36:37 -05:00
Benjamin Franzke
e71920929e egl/wayland: Move wayland-egl into a subdir
This hopefully fixes wayland-egl's dependency
resolution for autogenerated wayland-drm headers.
2011-03-04 16:36:37 -05:00
Eric Anholt
1a57717bbe i965: Apply a workaround for the Ironlake "vertex flashing".
This is an awful hack and will hurt performance on Ironlake, but we're
at a loss as to what's going wrong otherwise.  This is the only common
variable we've found that avoids the problem on 4 applications
(CelShading, gnome-shell, Pill Popper, and my GLSL demo), while other
variables we've tried appear to only be confounding.  Neither the
specifications nor the hardware team have been able to provide any
enlightenment, despite much searching.

https://bugs.freedesktop.org/show_bug.cgi?id=29172
Tested by:	Chris Lord <chris@linux.intel.com> (Pill Popper)
Tested by:	Ryan Lortie <desrt@desrt.ca> (gnome-shell)
2011-03-04 12:04:42 -08:00
Marek Olšák
bdb811772f r300g: preliminary implementation of clamping controls 2011-03-04 17:47:56 +01:00
Marek Olšák
10a893106b r300g: implement FP16 alpha test 2011-03-04 17:47:56 +01:00
Marek Olšák
910bac63df r300g: implement blending for some of non-RGBA8 formats
Blending is now fully supported with:
- R8_UNORM
- R8G8_UNORM
- B8G8R8A8_UNORM
- R16G16B16A16_FLOAT (r500-only)

Blending is partially supported (DST_ALPHA not working) with:
- L8A8_UNORM
- I8_UNORM
- B5G5R5A1_UNORM
- B10G10R10A2_UNORM

The other formats can't do blending.
2011-03-04 17:47:56 +01:00
José Fonseca
4a4f6a3901 draw: Silence tgsi_emit_sse2 failed messages. 2011-03-04 16:29:13 +00:00
José Fonseca
6838c9ce74 tgsi: Disable SSE2 code generation.
It's broken now that tgsi_exec_machine::Inputs/Ouputs are pointers.

Temporary if anybody still cares about tgsi_sse2.c. Permanent otherwise.
2011-03-04 14:54:24 +00:00
José Fonseca
c8e904e159 scons: Unbreak mingw cross compilation. 2011-03-04 14:44:39 +00:00
Marek Olšák
ba48811fa8 st/mesa: set PIPE_BIND_RENDER_TARGET for sRGB formats if UNORM is supported
Because the format can be changed to UNORM in a surface.

This fixes:
state_tracker/st_atom_framebuffer.c:163:update_framebuffer_state:
Assertion `framebuffer->cbufs[i]->texture->bind & (1 << 1)' failed.
2011-03-04 14:52:45 +01:00
José Fonseca
5378983417 scons: Get glsl2 and glcpp programs building correctly. 2011-03-04 13:11:49 +00:00
José Fonseca
12d17bcadf glsl/glcpp: Use stdio.h instead of unistd.h. 2011-03-04 12:53:14 +00:00
José Fonseca
f52660c3dc glsl: Define YY_NO_UNISTD_H on MSVC. 2011-03-04 12:49:55 +00:00
José Fonseca
d40b868db5 gallium: Define __func__ on MSVC. 2011-03-04 11:55:36 +00:00
Christoph Bumiller
cf143c1f4d Merge remote branch 'origin/nvc0' 2011-03-04 11:02:10 +01:00
Chris Wilson
9d31138f53 i965: Fix extending VB packets
Computation of the delta of this array from the last had a silly little
bug and ignored any initial delta==0 causing grief in Nexuiz and
friends.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-03-04 09:58:31 +00:00
Chris Wilson
18dd7932c7 i965: Handle URB_FENCE erratum for Broadwater
There is a silicon bug which causes unpredictable behaviour if the
URB_FENCE command should cross a cache-line boundary. Pad before the
command to avoid such occurrences. As this command only applies to
gen4/5, do the fixup unconditionally as the specs do not actually state
for which chip it was fixed (and the cost is negligible)...

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-03-04 09:58:31 +00:00
Chris Wilson
1546291e5b i965: Align index to type size and flush if the type changes
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-03-04 09:58:31 +00:00
Chris Wilson
1c0d09cd4e intel: Add couple of missing gen6 commands to decode
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-03-04 09:58:31 +00:00
Chris Wilson
b93684f5f3 i965: Prevent using a zero sized (or of unknown type) vertex array
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-03-04 09:58:30 +00:00
Dave Airlie
137d44e0f2 r600g: disable tiling by default again.
we still have a lot of corner cases that aren't working.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-03-04 08:47:10 +10:00
José Fonseca
9f3c59a350 tgsi: Update assert.
Elements(mach->Inputs) is wrong now that mach->Inputs is dynamically
allocated.
2011-03-03 19:23:04 +00:00
Kenneth Graunke
09e1bebc25 glcpp: Remove trailing contexts from #if rules.
These are now unnecessary.
2011-03-03 10:42:37 -08:00
Kenneth Graunke
f20656e944 glcpp: Rework lexer to use a SKIP state rather than REJECT.
Previously, the rule deleted by this commit was matched every single
time (being the longest match).  If not skipping, it used REJECT to
continue on to the actual correct rule.

The flex manual advises against using REJECT where possible, as it is
one of the most expensive lexer features.  So using it on every match
seems undesirable. Perhaps more importantly, it made it necessary for
the #if directive rules to contain a look-ahead pattern to make them
as long as the (now deleted) "skip the whole line" rule.

This patch introduces an exclusive start state, SKIP, to avoid REJECTs.
Each time the lexer is called, the code at the top of the rules section
will run, implicitly switching the state to the correct one.

Fixes piglit tests 16384-consecutive-chars.frag and
16385-consecutive-chars.frag.
2011-03-03 10:42:37 -08:00
Kenneth Graunke
b56f30c2b2 glcpp/tests: Update 063-comments.c.expected to match output.
The expected result has been out of sync with what glcpp produces for
some time; glcpp's actual result seems to be correct and is very close to
GCC's cpp.  Updating this will make it easier to catch regressions in
upcoming commits.
2011-03-03 10:42:37 -08:00
Jakob Bornecrantz
4bd27cfecc rbug: Fix depth stencil surface not being sent to the client 2011-03-03 18:29:17 +00:00
José Fonseca
5d0e8beaa2 scons: More tweaks to fix MinGW build. 2011-03-03 16:57:38 +00:00
José Fonseca
dbfbb8cf6d scons: Ensure generated headers are in the include path. 2011-03-03 15:43:18 +00:00
José Fonseca
54d8c5e3c2 scons: Add human friendlier build messages for lex/yacc. 2011-03-03 15:42:58 +00:00
José Fonseca
8987109c27 scons: Always load lex/yacc tool.
lex/yacc is not loaded by default when toolchain is not default either,
e.g., when toolchain=crossmingw.
2011-03-03 15:28:36 +00:00
Christoph Bumiller
3bf92a281b nv50: check grclass instead of chipset for 3D caps 2011-03-03 12:32:40 +01:00
Christoph Bumiller
7048ad62f8 nv50: increase size of shader code bo
512 KiB should be quite enough, but dynamic resize might be nicer.
2011-03-03 12:32:40 +01:00
Ben Skeggs
6b4e3e8941 nouveau: allow pipe driver to define which buffers should start in sysmem
PIPE_BIND_CONSTANT_BUFFER alone was OK for nv50/nvc0, but nv30 will need
to be able to set others on certain chipsets.

Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-03 15:56:20 +10:00
Zou Nan hai
118ecb1a22 i965: SNB GT1 has only 32k urb and max 128 urb entries.
Signed-off-by: Zou Nan hai <nanhai.zou@intel.com>
2011-03-03 10:30:06 +08:00
Kenneth Graunke
2e756f3d6f glsl: Remove unused glcpp/Makefile.am.
This is a remnant of when glsl2 lived in its own repository.
2011-03-02 15:25:49 -08:00
Kenneth Graunke
8be828c3b3 glsl: Remove 'tests' subfolder.
These have long since moved to piglit and aren't useful to have here.
2011-03-02 15:25:49 -08:00
Christian König
8d9ea4c4e7 r600g: correct mega_fetch_count in fetch shader 2011-03-03 00:23:15 +01:00
Zack Rusin
ff2a0faba0 tgsi: defer allocation of huge inputs/outputs until we have a gs 2011-03-02 17:45:22 -05:00
Ian Romanick
d569cc4d44 docs: added news item for 7.9.2 and 7.10.1 releases 2011-03-02 14:37:59 -08:00
Ian Romanick
910820daf4 docs: All links to 7.9.2 and 7.10.1 release notes 2011-03-02 14:37:59 -08:00
Ian Romanick
8010c35852 docs: Import 7.10.1 release notes from 7.10 branch 2011-03-02 14:37:59 -08:00
Ian Romanick
198e9bb5b0 docs: Import 7.9.2 release notes from 7.9 branch 2011-03-02 14:37:59 -08:00
Christoph Bumiller
0c0e996d59 nv50: fix IB index buffer path
Add missing VERTEX_END and treat unaligned offsets correctly.
2011-03-02 22:37:56 +01:00
Christoph Bumiller
fa94f8b209 nv50: fix POINT_COORD_REPLACE_MAP method size
Introduced in 223d98bb8d.
2011-03-02 21:07:33 +01:00
Christoph Bumiller
47a62b1ca1 nv50: primitive restart trick for vertex data through FIFO mode
Also, on nv50 the VERTEX_BEGIN method doesn't follow VERTEX_END,
which was erroneously taken over from nvc0 and is fixed now.
2011-03-02 20:59:54 +01:00
Christoph Bumiller
b8646bc2af nv50: fix depth clamp for disabled primitive clipping 2011-03-02 20:59:53 +01:00
Christoph Bumiller
ddcb90248f nv50: implement independent blend functions for nva3+ and fix cap 2011-03-02 20:59:53 +01:00
Christoph Bumiller
669de7016c nv50: fix tile size calculations 2011-03-02 20:59:53 +01:00
Christoph Bumiller
223d98bb8d nv50: fix point sprite state validation
Wasn't updated if the FP didn't change, and coordinate replacement
wasn't disabled anymore.
2011-03-02 20:59:53 +01:00
Christoph Bumiller
dbdbbce066 nv50: allow accidentally disabled IB index buffers again
Must have sneaked in from debugging.
2011-03-02 20:59:53 +01:00
Christoph Bumiller
908013b737 nv50: apply relocations to shader code
On nv50, branches are absolute, so we need to adjust them according
to the shader's position in the code buffer.
2011-03-02 20:59:53 +01:00
Christoph Bumiller
040ff18a21 nv50: fix wrong miptree tile flags taken over from nvc0 2011-03-02 20:59:53 +01:00
Benjamin Franzke
4ca075ac4f egl_dri2 x11: Workaround device_name xcb-dri2 bug
This commit is basically a copy-over of the fix
Chia-I Wu's commited to wayland:
   http://cgit.freedesktop.org/wayland/wayland-demos/commit/?id=1b6c0ed95
   "Workaround an xcb-dri2 bug.
    xcb_dri2_connect_device_name generated by xcb-proto 1.6 is broken.
    It only works when the length of the driver name is a multiple of 4."
2011-03-02 20:41:38 +01:00
Benjamin Franzke
648a16d079 egl/wayland: build subdirs (wayland-drm) before depend
Autogenerated files need to be generated first.
2011-03-02 20:17:26 +01:00
Marek Olšák
a6314eb47f r300g: require DRM 2.3.0 (kernel 2.6.34)
Running any older kernel is not recommended anyway.
2011-03-02 17:54:36 +01:00
Marek Olšák
f6dbcb92bf r300g: do not use ioctl thread offloading on single-core machines 2011-03-02 17:54:36 +01:00
Brian Paul
8ad821df0a mesa: added gl_program_constants::MaxAddressOffset
See https://bugs.freedesktop.org/show_bug.cgi?id=29418
2011-03-02 09:32:47 -07:00
Brian Paul
41208bf047 mesa: increase INST_INDEX_BITS to 12
For more info see fd.o bug 29418.
2011-03-02 09:20:59 -07:00
Brian Paul
5f4d0cc6bc Revert "mesa: reduce calls to _mesa_test_framebuffer_completeness()"
This reverts commit 1f9a0a4e6e.

This caused trouble with Lightsmark w/ i965 driver and fbo/fbo-blit-d24s8
(see bug 34894).  It's probably something simple but no time to debug now.
2011-03-02 09:11:43 -07:00
Brian Paul
69c6e21ceb vbo: fix error parameter
Spotted by Ian.
2011-03-02 09:10:49 -07:00
Vinson Lee
bbd9616838 r300g: Silence 'control reaches end of non-void function' warning.
Fixes this GCC warning.
r300_hyperz.c: In function 'r300_get_hiz_func':
r300_hyperz.c:65: warning: control reaches end of non-void function
2011-03-02 00:43:09 -08:00
Vinson Lee
0f29d394a4 gallium: Add u_format_rgtc.c to SConscript. 2011-03-01 23:02:50 -08:00
Zou Nan hai
f1824905fa i965: Maxinum the usage of urb space on SNB.
SNB has 64k urb space, we only use piece of them.
      The more urb space we alloc,
      the more concurrent vs threads we can run.
      push the urb space usage to the limit.

Signed-off-by: Zou Nan hai <nanhai.zou@intel.com>
2011-03-02 14:23:17 +08:00
Dave Airlie
e8d061fd74 mesa/st: fix softpipe npot compressed mipmaps.
this fixes fbo-generatemipmap-formats rgtc and s3tc in NPOT mode
with softpipe.

r600g fails to even get level 0 correct so have to look into that
a bit further.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-03-02 16:13:59 +10:00
Dave Airlie
e80bfc8515 softpipe: enable RGTC now that we have u_format support. 2011-03-02 15:30:17 +10:00
Dave Airlie
64f19b90d7 mesa/st: fix generate mipmap for signed compressed formats.
This was always converting to 8-bit per channel unsigned formats,
which isn't suitable for RGTC signed formats, this special cases
those two formats and converts to floats for those.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-03-02 15:30:17 +10:00
Dave Airlie
8d62b2aca9 gallium: add RGTC UNORM support to u_format.
SNORM needs a bit of work in the state tracker in order for mipmap
generation to work I believe.

I'm also not sure that having unorm fetches for an snorm format is
sane.
2011-03-02 15:30:16 +10:00
Dave Airlie
59cae3eee1 rgtc: remove GL types from this file.
I'd like to share this file with gallium u_format stuff.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-03-02 14:33:35 +10:00
Dave Airlie
531c336fa3 rgtc: move the texel fetch into common unsigned/signed code.
This function can be done in the include file also.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-03-02 14:16:39 +10:00
Dave Airlie
fb6ecca0a5 rgtc: fix issues with compressor and signed types.
With signed types we weren't hitting this test however the comment
stating this doesn't happen often doesn't apply when using signed
types since an all 0 block is quite common which isn't abs min or max.

this fixes the limits correctly again also.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-03-02 14:08:59 +10:00
Dave Airlie
521394a204 rgtc: don't try to access off the end of the block.
if the values are all in the last dword, the high bits can be 0,

This fixes a valgrind warning I saw when playing with mipmaps.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-03-02 13:14:34 +10:00
Dave Airlie
5f714c2aaf rgtc: move to using ubyte for fetch instead of chan + fix limit
My previous fix to the byte max was incorrect.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-03-02 13:02:20 +10:00
Marek Olšák
c37e283423 st/mesa: use RGTC for GL_COMPRESSED_RED/RG if possible
With proper fallback formats.
2011-03-02 03:46:27 +01:00
Brian Paul
e118fdc9e2 svga: reduce MAX_DMA_SIZE to 4MB 2011-03-01 17:40:27 -07:00
Brian Paul
8731f0363f vbo: add vbo_always_unmap_buffers()
Drivers can call this function as needed.  It tells the VBO module to
always unmap the current glBegin/glEnd VBO when we flush.  Otherwise
it's possible to be in a flushed state but still have the VBO mapped.
2011-03-01 17:16:53 -07:00
Brian Paul
a2924b488b vbo: generate GL_INVALID_VALUE for bad glVertexAttrib index 2011-03-01 17:16:02 -07:00
Brian Paul
1c9ca21adb i915g: remove extra semicolon 2011-03-01 17:09:15 -07:00
Ian Romanick
3ff4974f22 mesa: Revert most of 3158cc7d because it causes other breakage 2011-03-01 15:57:32 -08:00
Marek Olšák
30600e3dab r300g: accelerate resoure_copy_region for rgtc 2011-03-02 00:54:06 +01:00
Kenneth Graunke
8be58df67a scons: Use Flex and Bison to generate lexer/parser files.
This gets it building again here; I'll leave it up to the SCons
maintainers to make further improvements.
2011-03-01 15:49:29 -08:00
Kenneth Graunke
80ec97af79 glsl: Rename .lpp to .ll and .ypp to .yy.
SCons has built-in support for .ll and .yy, but not .lpp and .ypp. Since
there's no real benefit to using the old names, change them.
2011-03-01 15:49:29 -08:00
Dave Airlie
ff0f36f59d rgtc: fix fetch function limits for signed types 2011-03-02 09:52:53 +10:00
Dave Airlie
8eebd216dd rgtc: fixup mipmap generation
this allows swrast to pass mipmap generation for these formats.
2011-03-02 09:48:40 +10:00
Dave Airlie
01d5d1e80e swrast/rgtc: fix rendering issues introduced when fix constants
The max value was wrong and this showed up in the piglit tests.
2011-03-02 09:41:38 +10:00
Dave Airlie
c7d239c43b r600g: change the cross over point for 2d->1d
this fixes some rendering in the fbo-generatemipmap-formats test on
my rv610.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-03-02 09:30:24 +10:00
Ian Romanick
3158cc7df8 mesa: Fix build breakage caused by c73e6ce 2011-03-01 15:22:43 -08:00
Benjamin Franzke
6b369c4c7c egl: Add EGL_WL_bind_wayland_display 2011-03-01 17:23:50 -05:00
Ian Romanick
654adaabc9 Generate lexer and parser files for tarball creation process 2011-03-01 13:43:12 -08:00
Ian Romanick
6dd0a2ed40 Add generated parser / lexer files to gitignore lists 2011-03-01 13:43:12 -08:00
Ian Romanick
1034284596 mesa: Fix some quirkiness of make tarballs
Among other benefits, parallel makes now work.  Since many people have
parallel builds by default (via MAKEFLAGS environment variable), this
sames some irritation at release time...when there's usually not any
other irritation already.
2011-03-01 13:43:12 -08:00
Ian Romanick
8170684fbe mesa: Remove nonexistent files from distribution list 2011-03-01 13:43:12 -08:00
Ian Romanick
c73e6ce7e2 mesa: Remove files generated by flex and bison from GIT
These files were for the ARB_vertex_program / ARB_fragement_program assembler.
2011-03-01 13:43:12 -08:00
Ian Romanick
cb48207e4b glcpp: Remove files generated by flex and bison from GIT 2011-03-01 13:43:12 -08:00
Ian Romanick
8864b38783 glsl: Remove files generated by flex and bison from GIT 2011-03-01 13:43:12 -08:00
Daniel Vetter
8f9e546fde i915g: kill relocs accouting
No one ever cared. libdrm does dynamic resizing of its reloc-table,
anyway.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-01 22:18:11 +01:00
Daniel Vetter
ee7acf6493 i915g: switch to the exact batch space reservation code
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-01 22:18:10 +01:00
Daniel Vetter
179cb58795 i915g: split up hw state emission into small atoms
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-01 22:18:09 +01:00
Christian König
4c4ab5668c st/mesa: probably handle instanced drawing
Remove the previous workaround for instanced drawing and implement it correctly.
2011-03-01 21:42:16 +01:00
Daniel Vetter
583eb13948 i915g: fix i915_winsys_batchbuffer_write
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-03-01 20:57:57 +01:00
Kenneth Graunke
d1fc920f61 intel: Support glCopyTexImage() from ARGB8888 to XRGB8888.
Nexuiz was hitting a software fallback.
2011-03-01 11:21:48 -08:00
Chris Wilson
faf1ddacfb configure: Bump libdrm requirements
In my last commit I introduced a build dependency upon a new libdrm.
Add the associated autoconf checks. As the headers are part of the core
libdrm, we need to bump that version and so may as well bump the chipset
specific versions simultaneously.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-03-01 18:42:23 +00:00
Marek Olšák
952222e4bf r300g: initialize some r500 PS3 regs 2011-03-01 19:10:30 +01:00
Marek Olšák
a5ee80a264 r300g: document some more DRM 2.8.0 features 2011-03-01 19:10:30 +01:00
Chris Wilson
900a5c91ee i965: Use negative relocation deltas to minimse vertex uploads
With relaxed relocation checking in the kernel, we can specify a
negative delta (i.e. pointing outside of the target bo) in order to fake
a range in a large buffer. We only then need to upload the elements used
and adjust the buffer offset such that they correspond with the indices
used in the DrawArrays.

(Depends on libdrm 0209428b3918c4336018da9293cdcbf7f8fedfb6)

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-03-01 16:34:50 +00:00
Chris Wilson
9fa380ccdc i965: Undo 'continuation of vb packets'
This breaks nexuiz for unknown reason; disable until a true fix can be
found.
2011-03-01 16:33:49 +00:00
Chris Wilson
69b3f24658 i965: Fix uploading of shortened vertex packets
... handle all cases and not just the interleaved upload.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-03-01 16:33:40 +00:00
Chris Wilson
6ddfb322f5 i965: Upload all vertices used
... and take advantage of start_vertex_bias to trim to [min_index,
max_index] where possible (i.e. when we need to upload all arrays).

Fixes half_float_vertex(misc.fillmode.wireframe)

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=34595
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-03-01 09:42:52 +00:00
Thomas Hellstrom
8b145e2302 st/egl: Implement swapbuffer throttling
When doing copy swapbuffers using drm, throttle on outstanding copy operations.
Introduces a new environment variable, EGL_THROTTLE_FENCES that the
user can use to indicate the desired number of outstanding swapbuffers, or
disable throttling using EGL_THROTTLE_FENCES=0.

This can and perhaps should be extended to the pageflip case as well, since
with some hardware pageflips can be pipelined. In case the pageflip syncs, the
throttle operation will be a no-op anyway.

Update copyright notices.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2011-03-01 10:36:19 +01:00
Thomas Hellstrom
c9febff31f st/egl/drm: Rework swapbuffers
Use the pageflip ioctl when available.
Otherwise, or when the backbuffer contents need to be preserved,
fall back to a copy operation.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2011-03-01 10:36:19 +01:00
Thomas Hellstrom
2b079485f6 st/egl: Add a helper to perform a copy swap on a resource surface
The copy swap can be used when we need to preserve the contents of
the back buffer or when there is no way to do native page-flipping.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2011-03-01 10:36:19 +01:00
Thomas Hellstrom
d1e4117355 st/egl: Move the copy context to the native display structure
This makes it usable also for native helpers.
Also add inline functions to access the context and to
uninit the native display structure.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2011-03-01 10:36:18 +01:00
Kenneth Graunke
186d3bc7a3 Revert "i965/fs: Correctly set up gl_FragCoord.w on Sandybridge."
This reverts commit 4a3b28113c, as it
caused a regression on Ironlake (bug #34646).
2011-03-01 01:09:15 -08:00
Dave Airlie
b1ceda5cbd st/dri: one more missing array size
whats one more between friends.

again bnf on irc.
2011-03-01 18:32:33 +10:00
Dave Airlie
02448f2241 st/dri: fix missing array size init.
Init array size to 1,

reported by bnf on irc.
2011-03-01 18:29:24 +10:00
Dave Airlie
2d62e39c62 egl/st: add array size initialisor
reported by bnf on irc.
2011-03-01 18:24:15 +10:00
Ben Skeggs
450aa241bf nouveau: remove nouveau_stateobj.h
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 17:43:13 +10:00
Ben Skeggs
28eb7214db nvc0: fix a crash on context destruction
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 17:23:31 +10:00
Ben Skeggs
1ba8e95108 nouveau: ensure vbo_dirty is set when buffer write transfer complete
This introduces a shared nouveau_context struct to track such things.

Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 17:23:31 +10:00
Ben Skeggs
96d57722fd nouveau: fix leak of nouveau_mman structs
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 17:22:53 +10:00
Ben Skeggs
4826cd0f61 nvc0: port to common fence/mm/buffer code
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 17:22:49 +10:00
Dave Airlie
a44b65312e r600g: add NV_conditional_render support.
This is reliant on a drm patch that I posted on the list + a version bump.

These will appear in drm-next today.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-03-01 15:09:00 +10:00
Dave Airlie
929be6eb95 r600g: start using drm minor version to enable things.
If the drm minor version is > 9 (i.e. whats in drm-next),
we enable s3tc + texture tiling by default now.

this changes R600_FORCE_TILING to R600_TILING which can
be set to false to disable tiling on working drm.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-03-01 15:08:50 +10:00
Ben Skeggs
40d7a87a8e nv50: multiply polygon offset units by 2
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 14:44:43 +10:00
Ben Skeggs
be68782d9a nv50: sync textures with render targets ourselves
Port of the nvc0 commit doing the same.

Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 14:44:43 +10:00
Ben Skeggs
79079141fa nv50: move onto common linear buffer manager
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 14:44:43 +10:00
Ben Skeggs
5c1c4f8593 nouveau: common linear buffer manager, ported from nv50/nvc0 drivers
nv50_resource is being called nv04_resource now temporarily, to avoid
a naming conflict with nouveau_resource from libdrm.

Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 14:44:43 +10:00
Ben Skeggs
cd24fcedec nouveau: create linear gart/vram mman in common screen init
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 14:44:43 +10:00
Ben Skeggs
3a38a4b0a8 nouveau: fix fence_ref() where fence and *ref are the same fence
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 14:44:43 +10:00
Ben Skeggs
d6bdf1f6ae nouveau: fix compiler complaint
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 14:44:42 +10:00
Ben Skeggs
2f30a5bdaa nv50: make mm available as common code
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 14:44:42 +10:00
Ben Skeggs
7a8ee058a8 nv50: move onto shared fence code
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 14:44:42 +10:00
Ben Skeggs
5a0915870c nouveau: move nv50/nvc0 fencing to common location, and modify slightly
Modified from original to remove chipset-specific code, and to be decoupled
from the mm present in said drivers.

Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 14:44:42 +10:00
Ben Skeggs
48e191f90c nv50-nvc0: set cur_ctx during init if none currently bound
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-03-01 14:44:42 +10:00
Marek Olšák
ea4a19c392 r300g: fix RGTC2_SNORM
ATI engineers have probably chosen those sign bits by a dice roll.
2011-03-01 05:25:33 +01:00
Marek Olšák
66d5de74c4 r300g: reorder parts of translate_texformat 2011-03-01 05:25:33 +01:00
Alex Deucher
1dc204d145 r600g: truncate point sampled texture coordinates
By default the hardware rounds texcoords.  However,
for point sampled textures, the expected behavior is
to truncate.  When we have point sampled textures,
set the truncate bit in the sampler.

Should fix:
https://bugs.freedesktop.org/show_bug.cgi?id=25871

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2011-02-28 22:01:59 -05:00
Zou Nan hai
6c324777a6 i965: bump VS thread number to 60 on SNB
Signed-off-by: Zou Nan hai <nanhai.zou@intel.com>
2011-03-01 10:39:35 +08:00
Marek Olšák
7a61957424 r300g: fix RGTC1_UNORM and RGTC2_UNORM
Signs don't work the way I'd like...
2011-03-01 03:24:55 +01:00
Dave Airlie
9c16fcc617 rgtc: shared the compressor code between signed/unsigned
No idea why I didn't do it like this the first time, but share
the code like other portions of mesa do using _tmp.h suffix
and some #defines for the types.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-03-01 11:57:51 +10:00
Brian Paul
7b3bec87df vbo: silence unused var warning 2011-02-28 18:34:06 -07:00
Brian Paul
125b4ac7e6 softpipe: remove redundant draw_flush() call
We'll flush after the same-shader comparison.
2011-02-28 18:25:41 -07:00
Brian Paul
e6f3e24330 draw: setup pipe's draw pointer for the aapoint stage
The other draw stages like aaline and pstipple were already doing this.
If the driver used the aapoint stage but not the others it would crash
because of a null pipe->draw pointer.
2011-02-28 18:25:37 -07:00
Brian Paul
b70610b982 mesa: move PBO-related functions into a new file 2011-02-28 18:24:35 -07:00
Brian Paul
7d8db55148 mesa: always generate error in glColorTableParameter[fi]v()
These were only used by GL_SGI_texture_color_table, which is gone now.
2011-02-28 18:24:30 -07:00
Brian Paul
9d20849516 mesa: remove GL_SGI_texture_color_table support
It was only implemented in the swrast driver and probably not used by
any applications.  A modern app would use a dependent/chained texture
lookup in the fragment shader.
2011-02-28 18:24:30 -07:00
Brian Paul
7e161bcf11 svga: add assertions in svga_shader_type() 2011-02-28 18:24:30 -07:00
Brian Paul
c6991433ef mesa: consolidate framebuffer target lookup code 2011-02-28 18:24:25 -07:00
Brian Paul
fec26193fb mesa: remove some old do-nothing code 2011-02-28 18:24:25 -07:00
Brian Paul
1f9a0a4e6e mesa: reduce calls to _mesa_test_framebuffer_completeness()
when updating/validating framebuffer state.  The _Status field is set
to zero when we need to recompute _Status.  Otherwise, it's up to date.
2011-02-28 18:24:25 -07:00
Brian Paul
b0fceae22f mesa: reduce calls to _mesa_test_framebuffer_completeness()
when doing glCopyTex[Sub]Image() and checking the source buffer's
completeness.
We only need to determine FBO completeness when the status is indeterminate.
2011-02-28 18:24:20 -07:00
Brian Paul
ca1b551562 mesa: s/mesaFormat/attFormat/ 2011-02-28 18:23:23 -07:00
Marek Olšák
790c731409 r300g: set the correct HiZ clear value 2011-03-01 01:46:27 +01:00
Marek Olšák
4609be4410 r300g: update derived state before uploading vertex buffers
The function may invoke blitter, which invalidates vertex buffers.
2011-03-01 00:46:58 +01:00
Marek Olšák
fbedd9c73a u_vbuf_mgr: compute user buffer size for instance data from instance_count 2011-03-01 00:46:58 +01:00
Marek Olšák
2f665885cd r300g: fix printing whether Z compression is enabled 2011-03-01 00:46:58 +01:00
Marek Olšák
ebf69f2c50 r300g: disable HiZ permanently if the the depth function is inverted
Instead of temporarily.

The HiZ function (something like a depth function) is a property
of a HiZ buffer and can only be changed during HiZ clears.
2011-03-01 00:46:54 +01:00
Marek Olšák
d99ec708af r300g: fix HiZ memory size computation and deciding when to use HiZ
I removed the HiZ memory management, because the HiZ RAM is too small
and I also did it in hope that HiZ will be enabled more often.

This also sets aligned strides to HIZ_PITCH and ZMASK_PITCH.
2011-03-01 00:23:11 +01:00
Alex Deucher
5f44fab5a6 r600g: add missing evergreen INT_TO_FLT to r600_bc_get_num_operands
Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2011-02-28 17:21:26 -05:00
Dave Airlie
3f600047d9 rgtc: fix void pointer arith.
should fix scons build.
2011-03-01 06:47:00 +10:00
Kenneth Graunke
0a163cf56d glsl: Enable GL_OES_texture_3D extension for ES2. 2011-02-28 10:35:57 -08:00
Kenneth Graunke
eb639349e2 glsl: Use reralloc instead of plain realloc.
Plugs a memory leak when compiling shaders with user defined structures.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-28 10:35:40 -08:00
Jerome Glisse
c33e091d17 r600g: indentation fixes
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2011-02-28 13:33:13 -05:00
Marek Olšák
ab824a0722 r300g: initialize SC_SCREENDOOR 2011-02-28 12:43:26 +01:00
Christoph Bumiller
f80c03e187 nv50: replace most of it with nvc0 driver ported to nv50
We'll have to do some unification now to reduce code duplication.
2011-02-28 12:41:09 +01:00
Marek Olšák
d1dbbf7bf4 r300g: disable hyper-z on rs6xx+
It doesn't work.
2011-02-28 12:28:07 +01:00
Vinson Lee
93893139a4 mesa: Add texcompress_rgtc.c to SConscript. 2011-02-27 23:17:49 -08:00
Dave Airlie
e107a3aa08 rgtc: update docs 2011-02-28 13:43:32 +10:00
Dave Airlie
83ebc01c1d mesa/st: add RGTC format support.
this just adds a format check + format conversion.
2011-02-28 13:35:35 +10:00
Dave Airlie
903726d285 swrast: add RGTC support 2011-02-28 13:35:35 +10:00
Dave Airlie
8d47c91985 mesa: Add RGTC texture store/fetch support.
This adds support for the RGTC unsigned and signed
texture storage and fetch methods.

the code is a port of the DXT5 alpha compression code.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-28 13:35:34 +10:00
Dave Airlie
e792e79f5a mesa: make_float_temp_image non-static
We need this to do signed stuff for RGTC.
2011-02-28 13:34:25 +10:00
Dave Airlie
e3709c26a6 rgtc: llvmpipe/softpipe refuse RGTC until u_format has support.
So far I haven't implemented the u_format code for these.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-28 13:34:25 +10:00
Dave Airlie
0495425dc3 r300g: force swizzles for RGTC
still can't get signed to work
2011-02-28 13:21:44 +10:00
Christian König
96bbc627f3 r600g: implement instanced drawing support 2011-02-28 02:19:39 +01:00
Christian König
bce4f9ac39 st/mesa & v_bug_mgr: two small instanced drawing fixes 2011-02-28 02:19:39 +01:00
Dave Airlie
0a17444133 Revert "r600g: Don't negate result of ABS instruction"
This reverts commit b6d4021393.

This actually breaks gears here on my rv670.
2011-02-28 11:10:35 +10:00
Fabian Bieler
0ab7dcddb3 r600g: Process TRUNC with tgis_op2
TRUNC is neither a scalar instruction nor exclusive to the Trans unit.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-28 09:22:16 +10:00
Fabian Bieler
b6d4021393 r600g: Don't negate result of ABS instruction
Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-28 09:21:41 +10:00
Daniel Vetter
d42c9433b0 i915g: implement cache flushing
With an extremely dumb strategy. But it's the same i915c employs.

Also improve the hw_atom code slightly by statically specifying the
required batch space. For extremely variably stuff (shaders, constants)
it would probably be better to add a new parameter to the hw_atom->validate
function.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-02-27 22:10:46 +01:00
Daniel Vetter
f90fa55347 i915g: buffer validation for blitter
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-02-27 22:03:51 +01:00
Daniel Vetter
342016010a i915g: buffer validation for render state
Also contains the first few bits for hw state atoms.

v2: Implement suggestion by Jakob Bornecrantz.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-02-27 21:57:31 +01:00
Daniel Vetter
3c59b3eb4b i915g/winsys: buffer validation support
v2: Add the batch bo to the libdrm validation lost, for otherwise
libdrm won't take previously used buffers into account.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-02-27 18:49:56 +01:00
Daniel Vetter
e20c3255e2 i915g: add raw batchbuffer dumping in drm winsys
These files can be decoded with intel_dump_decode from the intel-gpu-tools
available at:

http://cgit.freedesktop.org/xorg/app/intel-gpu-tools/

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-02-27 16:32:38 +01:00
Daniel Vetter
f58c11af72 i915g: cleanup static state calculation, part 2
Now also for the DRAW_RECT command

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-02-27 15:58:13 +01:00
Daniel Vetter
beaf039f97 i915g: cleanup static state calculation, part 1
Move it to i915_state_static.c This way i915_emit_state.c only emits
state and doesn't (re)calculate it.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-02-27 15:58:03 +01:00
Kenneth Graunke
a385ac6207 glsl/builtins: Fix return type for textureSize sampler2DArray variants.
A copy and paste error.
2011-02-27 00:44:47 -08:00
Eric Anholt
5f889c5bf5 glx: Adjust the MESA_multithread_makecurrent spec to match implementation.
This came out of discussion at the office today, and we agreed that
solving this for indirect wasn't really interesting, though the
server-side change would be of a similar level of difficulty.
2011-02-26 12:43:15 -08:00
Eric Anholt
dea5e57861 intel: Use the current context rather than last bound context for a drawable.
If another thread bound a context to the drawable then unbound it, the
driContextPriv would end up NULL.

With the previous two fixes, this fixes glx-multithread-makecurrent-2,
despite the issue not being about the multithreaded makecurrent.
2011-02-26 12:43:15 -08:00
Eric Anholt
74cde6505c dri2: Don't call the dri2 flush hook for swapbuffers unless we have a context.
The driver only has one reasonable place to look for its context to
flush anything, which is the current context.  Don't bother it with
having to check.
2011-02-26 12:43:15 -08:00
Eric Anholt
4d01bea808 glx: Don't do the implicit glFlush in SwapBuffers if it's the wrong drawable.
The GLX Spec says you only implicitly glFlush if the drawable being
swapped is the current context's drawable.
2011-02-26 12:43:15 -08:00
Eric Anholt
49d7e48b33 mesa: Add new MESA_multithread_makecurrent extension.
This extension allows a client to bind one context in multiple threads
simultaneously.  It is then up to the client to manage synchronization of
access to the GL, just as normal multithreaded GL from multiple contexts
requires synchronization management to shared objects.
2011-02-26 12:43:15 -08:00
Daniel Vetter
132dc0b6d2 i915g: make dynamic state emission actually lazy
Premature semicolon.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-02-26 21:20:03 +01:00
Jakob Bornecrantz
11f9ec5422 gallivm: Initialize stack values
valgrind gives me a warning with llvmpipe with profile builds but
not debug builds, this seems to fix the issue at least.
2011-02-26 20:13:08 +01:00
Arkadiusz Miskiewicz
99b9019716 glsl/Makefile: Remove builtin_function.cpp if generation fails.
Fixes bug #34346.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
2011-02-26 10:28:00 -08:00
Jakob Bornecrantz
052122a8cd i915g: Handle null constants properly 2011-02-26 15:45:47 +01:00
Daniel Vetter
b8e44f648e i915g: fix null deref in draw_rect emission
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-02-26 15:35:24 +01:00
Daniel Vetter
1df1e0841d i915g: simplify math in constants emission
The old code even falls apart for nr == 0 (which is caught earlier, but)!

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-02-26 15:35:24 +01:00
Jakob Bornecrantz
acc290aff0 i915g: Use the same debug env vars in drm and sw winsys 2011-02-26 15:35:13 +01:00
Jakob Bornecrantz
9a371b938c i915g: Use unchecked writes in sw winsys batchbuffer 2011-02-26 15:29:21 +01:00
Alan Hourihane
53fe5b334e Check for out of memory when creating fence 2011-02-26 10:30:19 +00:00
Jakob Bornecrantz
ca8a91ff7e util: Don't destroy shaders null shaders
Fixes regression from a08e612fd8
2011-02-26 02:32:22 +01:00
Jakob Bornecrantz
a08e612fd8 util: Don't create array texture shaders if the driver doesn't support it 2011-02-26 00:50:52 +01:00
Kenneth Graunke
58f7c9c72e i965/fs: Initial plumbing to support TXD.
This adds the opcode and the code to convert ir_txd to OPCODE_TXD;
it doesn't actually add support yet.
2011-02-25 15:30:45 -08:00
Kenneth Graunke
2830b1ae90 i965/fs: Complete TXL support on gen5+.
Initial plumbing existed to turn the ir_txl into OPCODE_TXL, but it was
never handled.
2011-02-25 15:30:45 -08:00
Kenneth Graunke
4ddd11aad6 i965/fs: Complete TXL support on gen4.
Initial plumbing existed to turn the ir_txl into OPCODE_TXL, but it was
never handled.
2011-02-25 15:30:45 -08:00
Kenneth Graunke
e54d62b896 i965/fs: Use a properly named constant in TXB handling.
The old value, BRW_SAMPLER_MESSAGE_SIMD8_SAMPLE makes it sound like we're
doing a non-bias texture lookup.  It has the same value as the new constant
BRW_SAMPLER_MESSAGE_SIMD8_SAMPLE_BIAS_COMPARE, so there should be no
functional changes.
2011-02-25 15:30:45 -08:00
Kenneth Graunke
a3cd542894 i965: Add #defines for gen4 SIMD8 TXB/TXL with shadow comparison.
From volume 4, page 161 of the public i965 documentation.
2011-02-25 15:30:45 -08:00
Jerome Glisse
b0e8aec5ab gallium/tgsi: shuffle ureg_src structure to work around gcc4.6.0 issue
There is an issue with gcc 4.6.0 that leads to segfault/assert with mesa
due to ureg_src size, reshuffling the structure member to better better
alignment work around the issue.

http://gcc.gnu.org/bugzilla/show_bug.cgi?id=47893

7.9 + 7.10 candidate

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2011-02-25 12:44:07 -05:00
Jerome Glisse
8e17adfdbd gallium/st: place value check before value is use
7.9 & 7.10 candidate

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2011-02-25 11:49:23 -05:00
Dave Airlie
179ff0551c gallium/util: add 1d/2d mipmap generation support
so far only hw mipmap generation is testing on softpipe,
passes test added to piglit.

this requires another patch to mesa to let array textures mipmaps
even start to happen.
2011-02-25 16:06:15 +10:00
Vinson Lee
eb17802386 scons: Reduce all Cygwin platform names to 'cygwin'.
platform.system in SCons on Cygwin includes the OS version number.
Windows XP - CYGWIN_NT-5.1
Windows Vista - CYGWIN_NT-6.0
Windows 7 - CYGWIN_NT-6.1

Reduce all Cygwin platform variants to just 'cygwin' so anything
downstream can simply use 'cygwin' instead of the different full
platform names.
2011-02-24 19:49:37 -08:00
Dave Airlie
b2413de916 r600g: explicity set sign bits for RGTC 2011-02-25 09:18:42 +10:00
Dave Airlie
c9bca01819 r600g: bc 4/5 or rgtc textures need to be tiled as well.
Make the s3tc upload code more generic.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-25 09:18:42 +10:00
Dave Airlie
79ad6f5375 r300g: explicit sign bits on RGTC textures 2011-02-25 09:18:41 +10:00
Kenneth Graunke
e6e5c1f46d i965: Increase Sandybridge point size clamp in the clip state.
255.875 matches the hardware documentation.  Presumably this was a typo.

NOTE: This is a candidate for the 7.10 branch, along with
      commit 2bfc23fb86.

Reviewed-by: Eric Anholt <eric@anholt.net>
2011-02-24 11:23:08 -08:00
Neil Roberts
c0ad70ae31 intel: Try using glCopyTexSubImage2D in _mesa_meta_BlitFramebuffer
In the case where glBlitFramebuffer is being used to copy to a texture
without scaling it is faster if we can use the hardware to do a blit
rather than having to do a texture render. In most of the drivers
glCopyTexSubImage2D will use a blit so this patch makes it check for
when glBlitFramebuffer is doing a simple copy and then divert to
glCopyTexSubImage2D.

This was originally proposed as an extension to the common meta-ops.
However, it was rejected as using the BLT is only advantageous for Intel
hardware.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=33934
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-24 16:43:39 +00:00
Christoph Bumiller
11b9f4439c nvc0: fix PointCoord enable in FP header 2011-02-24 17:35:36 +01:00
Christoph Bumiller
d0caaba370 nvc0: change TGSI CMP translation to use slct
Saves us the explicit compare instruction needed with selp.
2011-02-24 17:35:36 +01:00
Christoph Bumiller
b0bf4ee85f nvc0: sprite coord enable is per GENERIC, not overall index 2011-02-24 17:35:36 +01:00
Christoph Bumiller
9dd7d0803e nvc0: fix new_value calls using type instead of size 2011-02-24 17:35:36 +01:00
Christoph Bumiller
1a82971393 nvc0: set local memory usage info in shader header
Before this, l[] access was a no-op.
2011-02-24 17:35:36 +01:00
Christoph Bumiller
b5f04b2008 nvc0: don't fold loads from local memory 2011-02-24 17:35:36 +01:00
Christoph Bumiller
9612139907 nvc0: presin and preex2 can load from const space 2011-02-24 17:35:36 +01:00
Christoph Bumiller
f017483553 nvc0: kick out empty live ranges
They affect overlap tests even though they're actually empty.
2011-02-24 17:35:35 +01:00
Christoph Bumiller
cd47f10c90 nvc0: preemptively insert branch at ENDIF
Might be necessary if a block sneaks in somewhere, like a common
block for moves of phi sources after a loop break.

This is harmless and normally will be removed before emission.
2011-02-24 17:35:35 +01:00
Christoph Bumiller
4377657f8e nvc0: correct allocation of constrained registers
In linear scan we can't allocate multiple values with different
live ranges at the same time to assign them consecutive regs.

Maybe we should just switch to graph coloring for all values ...
2011-02-24 17:35:35 +01:00
Christoph Bumiller
67c7aefea3 nvc0: sync textures with render targets ourselves
Fixes for example piglit/fbo-flushing and nexuiz' bloom effect.
2011-02-24 17:35:35 +01:00
Christoph Bumiller
a6ea37da4b nvc0: improve userspace fencing
Before, there were situations in which we never checked the fences
for completion (some loading screens for example) and thus never
released memory.
2011-02-24 17:35:35 +01:00
Christoph Bumiller
410a13c5ce nvc0: values for undefined outputs must have file GPR 2011-02-24 17:35:35 +01:00
Christoph Bumiller
1579017b08 nvc0: multiply polygon offset units by 2
Wasn't sure if this still was necessary because the piglit test
started to fail at some point on nv50 where we already do this.
2011-02-24 17:35:35 +01:00
Christoph Bumiller
7d8ff54feb nvc0: fix SSG 2011-02-24 17:35:35 +01:00
Christoph Bumiller
88066d62ae nvc0: don't visit target blocks of a loop break multiple times 2011-02-24 17:35:35 +01:00
Christoph Bumiller
3d190e44de nvc0: don't overwrite phi sources at the end of a loop
Except the reference to its own result.
2011-02-24 17:35:35 +01:00
Fabian Bieler
728695b435 gallium/utils: Fix vertex element setup
Check if element was translated per element instead of per buffer.
2011-02-24 15:05:10 +01:00
José Fonseca
369ece1702 svga: Ensure rendertargets and textures are always rebound at every command buffer start.
The svga_update_state() mechanism is inadequate as it will always end up
flushing the primitives before processing the SVGA_NEW_COMMAND_BUFFER
dirty state flag.
2011-02-24 14:00:13 +00:00
Chris Wilson
f19439940c i965: Remember to pack the constant blend color as floats into the batch
Fixes regression from aac120977d.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=34597
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-24 12:59:52 +00:00
Chris Wilson
5ce0f7f109 intel: Reset the buffer offset after releasing reference to packed upload
Fixes oglc/vbo(basic.bufferdata)

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=34603
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-24 12:29:51 +00:00
Chris Wilson
135ccb2dae i965: Unmap the correct pointer after discontiguous upload
Fixes piglit/fbo-depth-sample-compare:

==14722== Invalid free() / delete / delete[]
==14722==    at 0x4C240FD: free (vg_replace_malloc.c:366)
==14722==    by 0x84FBBFD: intel_upload_unmap (intel_buffer_objects.c:695)
==14722==    by 0x85205BC: brw_prepare_vertices (brw_draw_upload.c:457)
==14722==    by 0x852F975: brw_validate_state (brw_state_upload.c:394)
==14722==    by 0x851FA24: brw_draw_prims (brw_draw.c:365)
==14722==    by 0x85F2221: vbo_exec_vtx_flush (vbo_exec_draw.c:389)
==14722==    by 0x85EF443: vbo_exec_FlushVertices_internal (vbo_exec_api.c:543)
==14722==    by 0x85EF49B: vbo_exec_FlushVertices (vbo_exec_api.c:973)
==14722==    by 0x86D6A16: _mesa_set_enable (enable.c:351)
==14722==    by 0x42CAD1: render_to_fbo (in /home/ickle/git/piglit/bin/fbo-depth-sample-compare)
==14722==    by 0x42CEE3: piglit_display (in /home/ickle/git/piglit/bin/fbo-depth-sample-compare)
==14722==    by 0x42F508: display (in /home/ickle/git/piglit/bin/fbo-depth-sample-compare)
==14722==  Address 0xc606310 is 0 bytes after a block of size 18,720 alloc'd
==14722==    at 0x4C244E8: malloc (vg_replace_malloc.c:236)
==14722==    by 0x85202AB: copy_array_to_vbo_array (brw_draw_upload.c:256)
==14722==    by 0x85205BC: brw_prepare_vertices (brw_draw_upload.c:457)
==14722==    by 0x852F975: brw_validate_state (brw_state_upload.c:394)
==14722==    by 0x851FA24: brw_draw_prims (brw_draw.c:365)
==14722==    by 0x85F2221: vbo_exec_vtx_flush (vbo_exec_draw.c:389)
==14722==    by 0x85EF443: vbo_exec_FlushVertices_internal (vbo_exec_api.c:543)
==14722==    by 0x85EF49B: vbo_exec_FlushVertices (vbo_exec_api.c:973)
==14722==    by 0x86D6A16: _mesa_set_enable (enable.c:351)
==14722==    by 0x42CAD1: render_to_fbo (in /home/ickle/git/piglit/bin/fbo-depth-sample-compare)
==14722==    by 0x42CEE3: piglit_display (in /home/ickle/git/piglit/bin/fbo-depth-sample-compare)
==14722==    by 0x42F508: display (in /home/ickle/git/piglit/bin/fbo-depth-sample-compare)

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=34604
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-24 10:58:22 +00:00
Chris Wilson
a2029a78c3 intel: Protect against waiting on a NULL render target bo
If we fall back to software rendering due to the render target being
absent (GPU hang or other error in creating the named target), then we
do not need to nor should we wait upon the results.

Reported-by: Magnus Kessler <Magnus.Kessler@gmx.net>
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=34656
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-24 10:12:37 +00:00
Dave Airlie
69d969e8fa r600g: EXT_texture_array support.
This adds EXT_texture_array support to r600g, it passes the piglit
array-texture test but I suspect may not be complete.

It currently requires a kernel patch to fix the CS checker to allow
these, so you need to use R600_ARRAY_TEXTURE=true for now
to enable them.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-24 13:26:28 +10:00
Dave Airlie
13f5a4d316 st/mesa: treat 1D ARRAY upload like a depth or 2D array upload.
This is because the HW doesn't always store a 1D array like a
2D texture, it more likely stores it like 2D texture (i.e.
alignments etc).

This means we upload each slice separately and let the driver
work out where to put it.

this might break nvc0 as I can't test it, I have only nv50 here.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-24 13:26:16 +10:00
Vinson Lee
100cd214e3 scons: Fix Cygwin platform names.
Fixes immediate Python exceptions with SCons on Cygwin.
2011-02-23 18:21:14 -08:00
Jakob Bornecrantz
8fb0ecd0cf i915g: Lazy emit dynamic state 2011-02-24 00:26:02 +00:00
Jakob Bornecrantz
b9baad2aff i915g: Lazy emit immediate state 2011-02-24 00:26:02 +00:00
Jakob Bornecrantz
69cfc16cb6 i915g: Disable LIS7 state updates for now 2011-02-24 00:26:02 +00:00
Jakob Bornecrantz
42b8b2be85 i915g: Clean up in i915_state_immediate 2011-02-24 00:26:02 +00:00
Jakob Bornecrantz
481fad1552 i915g: Remove outdated comment 2011-02-24 00:26:02 +00:00
Jakob Bornecrantz
fbd681f1a0 i915g: Use dump function in sw winsys 2011-02-24 00:26:02 +00:00
Jakob Bornecrantz
fc77dee0bd i915g: Enable mirror repeat wrap mode 2011-02-24 00:26:02 +00:00
Jakob Bornecrantz
4407e5078f i915g: Always set vbo to flush on flushes
Reported-by Chris Wilson <chris@chris-wilson.co.uk>
2011-02-24 00:26:02 +00:00
Chris Wilson
671018aa99 intel: gen3 is particular sensitive to batch size
... and prefers a small batch whereas gen4+ prefer a large batch to
carry more state.

Tuning using openarena/padman indicate that a batch size of just 4096 is
best for those cases.

Bugzilla: https://bugs.freedesktop.org/process_bug.cgi
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-23 23:11:26 +00:00
Chris Wilson
19ac5fa50d i915: And remember assign the new value to the state reg...
Fixes regression from 298ebb78de.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=34589
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-23 22:10:43 +00:00
Tom Fogal
4484297505 Fix GLX_USE_TLS define.
It was only getting set in the case of DRI drivers.
2011-02-23 10:40:26 -07:00
Fabian Bieler
0ed5bf668d r600g: Request DWORD aligned vertex buffers.
The spec says that the offsets in the vertex-fetch instructions need to be byte-aligned and makes no specification with regard to the required alignment of the offset and stride in the vertex resource constant register.

However, testing indicates that all three values need to be DWORD aligned.
2011-02-23 11:42:32 -05:00
Wiktor Janas
b65e2195c4 st/mesa: fix computing the lowest address for interleaved attribs
Ptr can be very well NULL, so when there are two arrays, with one having
offset 0 (and thus NULL Ptr), and the other having a non-zero offset,
the non-zero value is taken as minimum (because of !low_addr ? start ...).
On 32-bit systems, this somehow works. On 64-bit systems, it leads to crashes.

Signed-off-by: Marek Olšák <maraeo@gmail.com>
2011-02-23 15:19:37 +01:00
Brian Paul
6d1f28d6c0 vbo: added vbo_check_buffers_are_unmapped() debug function 2011-02-22 14:32:37 -07:00
Brian Paul
bcd017f16f vbo: removed unused #defines, add comments 2011-02-22 14:23:50 -07:00
Brian Paul
eb24a5a9be mesa: move comment, change debug code 2011-02-22 13:37:30 -07:00
Brian Paul
d7fcb2ac81 vbo: simplify NeedFlush flag clearing 2011-02-22 13:31:09 -07:00
Brian Paul
d8aebc4e4b vbo: use ctx intstead of exec->ctx 2011-02-22 13:24:56 -07:00
Brian Paul
cbe47a2459 r300g: fix missing initializers warning 2011-02-22 12:47:18 -07:00
Brian Paul
7898d2ae16 i915g: remove extra semicolons 2011-02-22 12:47:18 -07:00
Andy Skinner
90e227f079 xlib: pass Display pointer to XMesaGarbageCollect()
Fixes an issue when different displays are used on different threads.

Signed-off-by: Brian Paul <brianp@vmware.com>
2011-02-22 12:47:17 -07:00
Kenneth Graunke
2bfc23fb86 i965: Increase Sandybridge point size clamp.
255.875 matches the hardware documentation.  Presumably this was a typo.

Found by inspection.  Not known to fix any issues.

Reviewed-by: Eric Anholt <eric@anholt.net>
2011-02-22 10:52:45 -08:00
Kenneth Graunke
4a3b28113c i965/fs: Correctly set up gl_FragCoord.w on Sandybridge.
pixel_w is the final result; wpos_w is used on gen4 to compute it.

NOTE: This is a candidate for the 7.10 branch.

Reviewed-by: Eric Anholt <eric@anholt.net>
2011-02-22 10:52:44 -08:00
Kenneth Graunke
df2aef0e19 i965/fs: Refactor control flow stack handling.
We can't safely use fixed size arrays since Gen6+ supports unlimited
nesting of control flow.

NOTE: This is a candidate for the 7.10 branch.

Reviewed-by: Eric Anholt <eric@anholt.net>
2011-02-22 10:52:44 -08:00
Kenneth Graunke
2c2686b912 i965/fs: Avoid register coalescing away gen6 MATH workarounds.
The code that generates MATH instructions attempts to work around
the hardware ignoring source modifiers (abs and negate) by emitting
moves into temporaries.  Unfortunately, this pass coalesced those
registers, restoring the original problem.  Avoid doing that.

Fixes several OpenGL ES2 conformance failures on Sandybridge.

NOTE: This is a candidate for the 7.10 branch.

Reviewed-by: Eric Anholt <eric@anholt.net>
2011-02-22 10:52:44 -08:00
Kenneth Graunke
72cd7e87d3 i965/fs: Apply source modifier workarounds to POW as well.
Single-operand math already had these workarounds, but POW (the only two
operand function) did not.  It needs them too - otherwise we can hit
assertion failures in brw_eu_emit.c when code is actually generated.

NOTE: This is a candidate for the 7.10 branch.

Reviewed-by: Eric Anholt <eric@anholt.net>
2011-02-22 10:52:44 -08:00
Kenneth Graunke
3e91070ea8 i965: Fix shaders that write to gl_PointSize on Sandybridge.
gl_PointSize (VERT_RESULT_PSIZ) doesn't take up a message register,
as it's part of the header.  Without this fix, writing to gl_PointSize
would cause the SF to read and use the wrong attributes, leading to all
kinds of random looking failure.

Reviewed-by: Eric Anholt <eric@anholt.net>
2011-02-22 10:52:44 -08:00
José Fonseca
c6cedd43fe mesa: Avoid undeclared ffs function warning on mingw. 2011-02-22 14:59:09 +00:00
José Fonseca
7aeb610fe1 gallium: s/PIPE_TRANSFER_CPU_READ/PIPE_TRANSFER_READ/ in comments. 2011-02-22 14:14:45 +00:00
José Fonseca
0562f44625 gallium/docs: Update PIPE_TRANSFER_xx docs. Reformat to use definitions. 2011-02-22 14:14:22 +00:00
Keith Whitwell
fad8497d3b gallium: new transfer flag: DISCARD_WHOLE_RESOURCE 2011-02-22 14:13:07 +00:00
Marek Olšák
695cdee678 st/mesa: fix crash when using both user and vbo buffers with the same stride
If two buffers had the same stride where one buffer is a user one and
the other is a vbo, it was considered to be one interleaved buffer,
resulting in incorrect rendering and crashes.

This patch makes sure that the interleaved buffer is either user or vbo,
not both.
2011-02-20 22:16:22 +01:00
Marek Olšák
7942e6a5ae st/mesa: fix crash when DrawBuffer->_ColorDrawBuffers[0] is NULL
This fixes the game Tiny and Big.
2011-02-20 22:16:22 +01:00
Chris Wilson
3adc108b4a i965: Trim the interleaved upload to the minimum number of vertices
... should have no impact on a properly formatted draw operation.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-22 11:24:47 +00:00
Chris Wilson
b4cbd2b312 i965: Reinstate max-index paranoia
Don't trust the applications not to reference beyond the end of the
vertex buffers.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-22 11:24:45 +00:00
Chris Wilson
3377faffcd i965: Zero the offset into the vbo when uploading non-interleaved
Fixes regression from 559435d915.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-22 11:24:34 +00:00
Jakob Bornecrantz
94ccc31ba4 st/dri: Track drawable context bindings
Needs to track this ourself since because we get into a race condition with
the dri_util.c code on make current when rendering to the front buffer.

This is what happens:
Old context is rendering to the front buffer.

App calls MakeCurrent with a new context. dri_util.c sets
drawable->driContextPriv to the new context and then calls the driver make
current. st/dri make current flushes the old context, which calls back into
st/dri via the flush frontbuffer hook. st/dri calls dri loader flush
frontbuffer, which calls invalidate buffer on the drawable into st/dri.

This is where things gets wrong. st/dri grabs the context from the dri
drawable (which now points to the new context) and calls invalidate
framebuffer to the new context which has not yet set the new drawable as its
framebuffers since we have not called make current yet, it asserts.
2011-02-20 16:31:48 +01:00
Eric Anholt
9e872a5865 i965: Fix VB packet reuse when offset for the new buffer isn't stride aligned.
Fixes regression in scissor-stencil-clear and 5 other tests.
2011-02-21 16:36:09 -08:00
Brian Paul
12f25eb6d5 Revert "mesa: convert macros to inline functions"
This reverts commit e9ff76aa81.

Need to use macros so __FUNCTION__ reports the caller.
2011-02-21 17:01:00 -07:00
Brian Paul
e2d108ec82 st/mesa: need to translate clear color according to surface's base format
When clearing a GL_LUMINANCE_ALPHA buffer, for example, we need to convert
the clear color (R,G,B,A) to (R,R,R,A).  We were doing this for texture border
colors but not renderbuffers.  Move the translation function to st_format.c
and share it.

This fixes the piglit fbo-clear-formats test.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-21 16:58:42 -07:00
Brian Paul
c966c6980c st/mesa: fix the default case in st_format_datatype()
Part of the fix for piglit fbo-clear-formats

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-21 16:58:42 -07:00
Daniel Vetter
55a3c35243 i915g: add some throttling
Intel classic drivers switched to this, too, so it must be good.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-02-21 23:42:54 +00:00
Daniel Vetter
1e966636d0 i915g: s/bool/boolean/ style-fixup in winsys
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-02-21 23:42:53 +00:00
Jakob Bornecrantz
593ba7b05b i915g: Fix warning 2011-02-21 23:42:53 +00:00
Jakob Bornecrantz
43e6fe5549 i915g: Add option to lie about caps 2011-02-21 23:42:53 +00:00
Jakob Bornecrantz
27b49e91c9 i915g: Move debug fields to screen 2011-02-21 23:42:53 +00:00
Jakob Bornecrantz
fe6800a1bb i915g: Use debug get once options 2011-02-21 23:42:53 +00:00
Jakob Bornecrantz
3c74ecf687 i915g: Rework texture tiling a bit 2011-02-21 23:42:53 +00:00
Jakob Bornecrantz
e7e1fd057e i915g: Anisotropic filtering works 2011-02-21 23:42:53 +00:00
Jakob Bornecrantz
a641766576 i915g: TODO about point sprites 2011-02-21 23:42:53 +00:00
Jakob Bornecrantz
e7cdcefbee i915g: TODO about untested code hidden behind caps
Should be fairly easy to test and fix since you can look at
the code in the classic driver.
2011-02-21 23:42:53 +00:00
Jakob Bornecrantz
e3c9bf1a67 i915g: Reorg caps 2011-02-21 23:42:53 +00:00
Brian Paul
7dbafea860 st/mesa: fix incorrect texture size allocation in st_finalize_texture()
If finalizing a non-POW mipmapped texture with an odd-sized base texture
image we were allocating the wrong size of gallium texture (off by one).
Need to be more careful about computing the base texture image size.

This fixes https://bugs.freedesktop.org/show_bug.cgi?id=34463
2011-02-21 15:15:53 -07:00
Brian Paul
4cdcec08d1 st/mesa: refactor guess_and_alloc_texture() code 2011-02-21 15:15:53 -07:00
Brian Paul
51f9713e39 st/mesa: fix mipmap generation for non-POW textures
This is part of the fix for https://bugs.freedesktop.org/show_bug.cgi?id=34463
2011-02-21 15:15:53 -07:00
Brian Paul
e9ff76aa81 mesa: convert macros to inline functions 2011-02-21 15:15:53 -07:00
Brian Paul
da9adb9613 vbo: more comments 2011-02-21 15:15:52 -07:00
Brian Paul
6f027ba20d vbo: make vbo_exec_FlushVertices_internal() static 2011-02-21 15:15:52 -07:00
Brian Paul
bbd756e824 vbo: remove old debug code, add comments 2011-02-21 15:15:52 -07:00
Brian Paul
7cba2df4a6 vbo: rename, document function params 2011-02-21 15:15:52 -07:00
Brian Paul
f0c8e7c327 vbo: comments 2011-02-21 15:15:52 -07:00
Brian Paul
0ba2810e47 vbo: replace assert(0) with proper assertions 2011-02-21 15:15:52 -07:00
Brian Paul
ae4b6e04cd vbo: rename some vars, add new comments, fix formatting, etc. 2011-02-21 15:15:52 -07:00
Brian Paul
8b2598d000 vbo: use ctx instead of exec->ctx 2011-02-21 15:15:52 -07:00
Brian Paul
f9e1542286 radeon: add default switch case to silence unhandled enum warning 2011-02-21 15:15:52 -07:00
Ian Romanick
497baf4e4a Use C-style system headers in C++ code to avoid issues with std:: namespace 2011-02-21 13:07:29 -08:00
Chris Wilson
5a1fbf0f70 intel: Fix insufficient integer width for upload buffer offset
I was being overly miserly and gave the offset of the buffer into the bo
insufficient bits, distracted by the adjacency of the buffer[4096].

Ref: https://bugs.freedesktop.org/show_bug.cgi?id=34541
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 20:58:09 +00:00
José Fonseca
dcb21d8b1c svga: Remove some remaining fake S3TC rendering support. 2011-02-21 18:36:51 +00:00
Chris Wilson
a43f20e069 i965: Remove spurious duplicate ADVANCE_BATCH
... a leftover from a bad merge.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 16:02:26 +00:00
Chris Wilson
2c6793fb6b i915: Emit a single relocation per vbo
Reducing the number of relocations has lots of nice knock-on effects,
not least including reducing batch buffer size, auxilliary array sizes
(vmalloced and copied into the kernel), processing of uncached
relocations etc.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 13:04:46 +00:00
Chris Wilson
298ebb78de i915: Suppress emission of redundant stencil updates
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 13:04:46 +00:00
Chris Wilson
7c97e288fb i915: Separate BLEND from general context state.
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 13:04:46 +00:00
Chris Wilson
4f82585e27 i915: Only flag context changes if the actual state is changed
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 13:04:45 +00:00
Chris Wilson
0b0cad38c5 i915: suppress repeated sampler state emission
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 13:04:41 +00:00
Chris Wilson
87641cffd9 i915: Eliminate redundant CONSTANTS updates
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:37 +00:00
Chris Wilson
41260a9bf6 i965: Use compiler builtins when available
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:37 +00:00
Chris Wilson
8ea6e98c7b i965: Micro-optimise check_state
Replace the intermediate tests due to the logical or with the bitwise
or.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:37 +00:00
Chris Wilson
50ade6ea69 intel: use throttle ioctl for throttling
Rather than waiting on the first batch after the last swapbuffers to be
retired, call into the kernel to wait upon the retirement of any request
less than 20ms old. This has the twofold advantage of (a) not blocking
any other clients from utilizing the device whilst we wait and (b) we
attain higher throughput without overloading the system.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:37 +00:00
Chris Wilson
46131a824f i965: Remove unused 'next_free_page' member
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:36 +00:00
Chris Wilson
57ca0803b3 intel: Skip the flush before read-pixels via blit
As we will flush when reading the return values of the blit, we can forgo
the earlier flush.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:36 +00:00
Chris Wilson
c625aa19cb intel: extend current vertex buffers
If the next vertex arrays are a (discontiguous) continuation of the
current arrays, such that the new vertices are simply offset from the
start of the current vertex buffer definitions we can reuse those
defintions and avoid the overhead of relocations and invalidations.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:36 +00:00
Chris Wilson
a07e481179 intel: Use specified alignment for writes into the upload buffer
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:36 +00:00
Chris Wilson
d9e591391d i965: Clean up brw_prepare_vertices()
Use a temporary glarray variable to replace the numerous input->glarray.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:36 +00:00
Chris Wilson
3630d5b69a intel: combine short memcpy using a temporary allocated buffer
Using a temporary buffer for large discontiguous uploads into the common
buffer and a single buffered upload is faster than performing the
discontiguous copies through a mapping into the GTT.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:36 +00:00
Chris Wilson
dfc6c96e5c i965: upload normal arrays as interleaved
Upload the non-vbo arrays into a single interleaved buffer object, and
so need to just emit a single vertex buffer relocation.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:35 +00:00
Chris Wilson
94d73d700e i965: interleaved vbo
If the user passed in several arrays interleaved in the same vbo, only
emit a single vertex buffer and relocation.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:35 +00:00
Chris Wilson
559435d915 i965: emit one vb packet per vbo
Track reuse of the vertex buffer objects and so minimise the number of
vertex buffers used by the hardware (and their relocations).

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:35 +00:00
Chris Wilson
abb5109756 i965: upload transient indices into the same discontiguous buffer
As we now pack the indices into a common upload buffer, we can reuse a
single CMD_INDEX_BUFFER packet and translate each invocation with a
start vertex offset.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:35 +00:00
Chris Wilson
60bb3e5614 i965: suppress repeat-emission of identical vertex elements
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:35 +00:00
Chris Wilson
aac120977d i965: Move repeat-instruction-suppression to batchbuffer core
Move the tracking of the last emitted instructions into the core
batchbuffer routines and take advantage of the shadow batch copy to
avoid extra memory allocations and copies.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:35 +00:00
Chris Wilson
8d68a90e22 intel: use pwrite for batch
It's faster. Not only is the memcpy more efficiently performed in the
kernel (making up for the system call overhead), but by not using mmap
we remove the greater overhead of tracking the vma of every batch.

And it means we can read back from the batch buffer without incurring
the cost of a uncached read through the GTT.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:35 +00:00
Chris Wilson
3f55683927 i965: drop state_bo references to batch_bo
As we use state relocations and we know that all the state belongs to
the same bo, we can drop the multiple references to the same bo.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:34 +00:00
Chris Wilson
1be3764dbe i965: directly write wm state to batch
As we write directly into the batch in system memory, we do not need to
write first to the stack (as was to avoid read back through the GTT)

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:34 +00:00
Chris Wilson
df156549e7 i965: write cc straight to batch
As we write directly into the batch in system memory, we do not need to
write first to the stack (as was to avoid read back through the GTT)

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:34 +00:00
Chris Wilson
f29606598e i965: switch gen6 to use its own cc state bo
In preparation for a greater change, use the color_calc_state_bo already
provisioned for this purpose.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:34 +00:00
Chris Wilson
8a9e67b8df intel: Buffered upload
Rather than performing lots of little writes to update the common bo
upon each update, write those into a static buffer and flush that when
full (or at the end of the batch). Doing so gives a dramatic performance
improvement over and above using mmaped access.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:34 +00:00
Chris Wilson
40ee15407a intel: Replace the bo for a complete update
Rather than performing a blit to completely overwrite a busy bo, simply
discard it and create a new one with the fresh data.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:34 +00:00
Chris Wilson
abb37861d9 i965: Combine vb upload buffer with the general upload buffer
Reuse the new common upload buffer for uploading temporary indices and
rebuilt vertex arrays.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:34 +00:00
Chris Wilson
e476e12220 intel: Pack dynamic draws together
Dynamic arrays have the tendency to be small and so allocating a bo for
each one is overkill and we can exploit many efficiency gains by packing
them together.

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:34 +00:00
Chris Wilson
d0809d7b15 intel: Use system memory for DYNAMIC_DRAW source objects
Dynamic draw buffers are used by clients for temporary arrays and for
uploading normal vertex arrays. By keeping the data in memory, we can
avoid reusing active buffer objects and reallocate them as they are
changed. This is important for Sandybridge which can not issue blits
within a batch and so ends up flushing the batch upon every update, that
is each batch only contains a single draw operation (if using dynamic
arrays or regular arrays from system memory).

Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:34 +00:00
Chris Wilson
45ba7afbd1 i965: Trim the trailing NOOP from 3DSTATE_INDEX_BUFFER
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:33 +00:00
Chris Wilson
13bab58f04 i965: Fallback on encountering a NULL render buffer
Following a GPU hang, or other error, the render target is not likely to
have an allocated BO and so we must fallback to avoid using it.

Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=32534
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2011-02-21 12:59:33 +00:00
Vinson Lee
8033700814 i915g: s/__func__/__FUNCTION__/ 2011-02-20 21:23:45 -08:00
Daniel Vetter
c0122daf10 i915g: kill remnants of mmapped batchbuffer support
We're using bo_subdata.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2011-02-21 00:50:16 +01:00
Jakob Bornecrantz
fa186804a6 i915g: Add winsys/i915/sw to scons build 2011-02-21 00:50:16 +01:00
Jakob Bornecrantz
20ff6a2752 i915g: Fix void ptr arith 2011-02-21 00:50:16 +01:00
Jakob Bornecrantz
ec3c5ac592 i915g: Add dummy flush_frontbuffer 2011-02-21 00:50:16 +01:00
Jon TURNEY
aa6a5cf1d5 Fix --enable-shared-glapi configure option
Fix a typo which meant that --enable-shared-glapi didn't actually cause a shared glapi to be built

Signed-off-by: Jon TURNEY <jon.turney@dronecode.org.uk>
2011-02-20 12:53:42 -07:00
Chia-I Wu
bf0c56522e egl_dri2: Return NULL when xcb_get_geometry_reply fails.
This should fix bug #33946.
2011-02-20 12:26:31 -07:00
José Fonseca
91ea60395e scons: Add aliases for the llvmpipe unit tests.
Now one can simply do

  scons lp_test_format
2011-02-19 10:56:05 +00:00
José Fonseca
57d4e922a6 gallivm: Use simple scaling plus casting in more unorm->float cases. 2011-02-19 10:56:05 +00:00
Kenneth Graunke
b1002e4aa5 glsl: Remove $(PWD) from Makefile in favor of .
Hopefully should fix bug #34468.
2011-02-19 00:06:00 -08:00
Marek Olšák
0b436cf511 r300g: fix a possible race when counting contexts
Atomics aren't sufficient here.
2011-02-19 00:17:27 +01:00
Marek Olšák
e9e5380f22 r300g: fix invalid dereference in winsys
radeon_bo_unref may destroy the buffer, so call it after p_atomic_dec, not before.
2011-02-19 00:06:52 +01:00
José Fonseca
e16e70610c svga: Fix NULL dereference.
Probably introduced with the surface view move from screen to context.
2011-02-18 19:03:43 +00:00
Brian Paul
7ea729a185 vbo: add debug code to verify that buffers are unmapped before drawing 2011-02-18 10:34:25 -07:00
Brian Paul
6364d75008 mesa: MESA_VERBOSE logging for glRead/Draw/CopyPixels, glBlitFramebuffer 2011-02-18 10:34:25 -07:00
Brian Paul
633c9fcf78 st/mesa: set renderbuffer _BaseFormat in a few places
NOTE: This is a candidate for the 7.9 and 7.10 branches
2011-02-18 10:28:27 -07:00
Brian Paul
09f14a6086 st/mesa: check buffer orientation in blit_copy_pixels()
Can't invert the region if copying between surfaces with different
orientations.
2011-02-18 10:24:41 -07:00
José Fonseca
0ced789a0b svga: Ensure pending drawing commands other surface operations are emitted before DMAs.
This behavior was last when moving the transfers to the contexts.

This fixes several piglit failures, which were reading the color renderbuffer
before the draw operations were emitted.
2011-02-18 16:43:59 +00:00
José Fonseca
f9b4867846 svga: Cannot use negate or abs on source to dsx/dsy instructions. 2011-02-18 16:43:44 +00:00
José Fonseca
0cb6329e89 svga: Ensure SWTNL is created after HWTNL.
Matches the internal driver layering, and prevents null svga->hwtnl
dereferencing from inside the swtnl.
2011-02-18 16:43:40 +00:00
José Fonseca
15c3e21097 svga: Ensure LRP's restrictions are observed in all uses.
The dst reg must be a temporary, and not be the same as src0 or src2.
2011-02-18 16:43:38 +00:00
José Fonseca
965ab5fed3 svga: Preserve src swizzles in submit_op2/3/4.
Several opcodes require scalar swizzle, and this requirement was
being was not being observed when creating temporaries for other reasons.
2011-02-18 16:43:36 +00:00
Marek Olšák
fd8d4b32ed r300g: remove tracking whether vertex buffers need to be validated
This was getting hard to maintain and didn't really bring any real benefits.
Instead, validate buffers when the vertex array state is dirty.
2011-02-18 16:15:03 +01:00
Marek Olšák
bb46eeade3 st/mesa: fix geometry corruption by always re-binding vertex arrays
This is a temporary workaround. It fixes sauerbrauten with shaders enabled.

I guess we might be changing vertex attribs somewhere and not updating
the appropriate dirty flags, therefore we can't rely on them for now.
Or maybe we need to make this state dependent on some other flags too.

More info:
https://bugs.freedesktop.org/show_bug.cgi?id=34378
2011-02-18 16:01:01 +01:00
Jakob Bornecrantz
e0481cac7d svga: Disable surface cache for textures
Signed-off-by: Jakob Bornecrantz <jakob@vmware.com>
2011-02-18 14:46:48 +00:00
Jakob Bornecrantz
912ad88742 svga: Describe svga_sampler_views for refcnt debugging
Signed-off-by: Jakob Bornecrantz <jakob@vmware.com>
2011-02-18 14:46:47 +00:00
Jakob Bornecrantz
99d955263b svga: Make sure that refcnt debugger gets the correct backtrace for create
Signed-off-by: Jakob Bornecrantz <jakob@vmware.com>
2011-02-18 14:46:46 +00:00
Jakob Bornecrantz
52ad45677d util: Make refcnt and symbol debuggers work on windows
Signed-off-by: Jakob Bornecrantz <jakob@vmware.com>
2011-02-18 14:46:23 +00:00
Cyril Brulebois
d252db7af1 Point to bugs.freedesktop.org rather than bugzilla.freedesktop.org
Suggested by a freedesktop.org admin.

Signed-off-by: Cyril Brulebois <kibi@debian.org>
2011-02-18 07:42:41 -07:00
Marek Olšák
449c4f3706 u_vbuf_mgr: initialize flag indicating that buffers have been updated
This fixes r300g errors:
r300: Cannot get a relocation in radeon_drm_cs_write_reloc.
2011-02-18 13:57:31 +01:00
Thomas Hellstrom
8cbd3b5ef1 gallium/svga: Fix unnecessary swtnl fallbacks
When we drop the in_swtnl_draw flag, we must force a rerun of
update_need_swtnl to reset the need_swtnl flag to its correct value outside
of a swtnl vbo draw.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2011-02-18 13:25:32 +01:00
Dave Airlie
dfa5928404 r600g: reorganise rgtc pieces.
when the cs checker fixes go upstream a lot of this can disappear
into a drm version check.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-18 16:00:49 +10:00
Brian Paul
b736b4a2b5 st/mesa: implement blit-based path for glCopyPixels
If doing a simple non-overlapping glCopyPixels with no per-fragment ops
we can use pipe_context::resource_copy_region().
2011-02-17 19:11:32 -07:00
Brian Paul
d44fbd3c9d mesa: fix comments for _mesa_clip_readpixels() 2011-02-17 19:11:32 -07:00
Brian Paul
de2f25de26 st/mesa: indentation fix 2011-02-17 19:11:32 -07:00
Fabian Bieler
8b5119aab3 r600g: Start a new TEX clause if the texture lookup address was fetched in the current clause
Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-18 10:04:41 +10:00
Fabian Bieler
51cc14471c r600g: Add support to dump vertex- and texture-fetch clauses
Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-18 10:04:34 +10:00
Dave Airlie
2a6cce09e3 r600g: add BC4/5 to RGTC conversion
this doesn't do anything much since the rest of mesa doesn't
support RGTC yet.
2011-02-18 09:39:23 +10:00
José Fonseca
262b785ccd util: Fix typo in last commit. 2011-02-17 17:15:57 +00:00
Brian Paul
d1becefb05 st/mesa: fix incorrect glCopyPixels position on fallback path
If we hit the pipe_get/put_tile() path for setting up the glCopyPixels
texture we were passing the wrong x/y position to pipe_get_tile().
The x/y position was already accounted for in the pipe_get_transfer()
call so we were effectively reading from 2*readX, 2*readY.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-17 10:13:33 -07:00
Brian Paul
1fa97ddb25 draw: update comments, rename vars in pstipple code 2011-02-17 10:13:33 -07:00
José Fonseca
0adeaf00e6 svga: Don't use more than one constant per IFC instruction. 2011-02-17 15:29:32 +00:00
José Fonseca
8902c42db4 mesa: Do copy propagation across if-else-endif.
Addresses excessive TEMP allocation in vertex shaders where all CONSTs are
stored into TEMPS at the start, but copy propagation was failing due to
the presence of IFs.

We could do something about loops, but ifs are easy enough.
2011-02-17 15:29:30 +00:00
José Fonseca
6c1fcf8583 util: Cleanup symbol name resolution on Windows.
- Support symbol name resolution on MinGW.
- Use dbghelp.dll (which should allow 64bit support), but untested yet.
- Cleanup.
2011-02-17 15:26:53 +00:00
Brian Paul
1bf9954bb4 docs: updated environment variable list 2011-02-17 07:29:20 -07:00
Brian Paul
f9df46f873 st/mesa: remove unused screen variables 2011-02-17 07:28:58 -07:00
Brian Paul
30ed4ced11 mesa: remove the MESA_NO_DITHER env var
This was sometimes useful back when 16-bit framebuffers were prominent.
2011-02-17 07:28:58 -07:00
Brian Paul
b1d485712f softpipe: rename env vars to be consistent 2011-02-17 07:28:58 -07:00
Haitao Feng
f55d027ac2 egl_dri2: add swrast
This enables the egl_dri2 driver to load swrast driver
for software rendering. It could be used when hardware
dri2 drivers are not available, such as in VM.

Signed-off-by: Haitao Feng <haitao.feng@intel.com>
2011-02-16 23:06:36 -05:00
Dave Airlie
231bf886da r600g: get s3tc working on cards with crappy 64/128 bit types.
Some cards don't appear to work correctly with the UNORM type,
so switch to the integer type, however since gallium has no
integer types yet from what I can see we need to do a hack to
workaround it for the blitter.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-17 10:27:09 +10:00
Dave Airlie
5cc35124b3 r600g: add missing type to color buffer swap. 2011-02-17 10:27:09 +10:00
Brian Paul
5d236d71c8 gallium/util: init key with memset()
To silence missing initializers warning.
2011-02-16 17:10:36 -07:00
Brian Paul
c8f8d7d873 svga: flush when transitioning between HW and SW rendering paths
To avoid mixing HW and SW rendering with the same vertex buffer.
2011-02-16 17:07:02 -07:00
Brian Paul
b5df194923 rtasm: add dummy return statement to silence MSVC warning
And use assert(0) instead of abort() to be consistent with rest
of Gallium.
2011-02-16 17:07:02 -07:00
Brian Paul
2f5032ec1e svga: use TRUE/FALSE instead of 0/1
Some fields are booleans, others are bitmasks.  Use TRUE/FALSE to
clarify what's what.
2011-02-16 17:07:02 -07:00
Brian Paul
64762af008 svga: fix incorrect comment 2011-02-16 17:07:02 -07:00
Brian Paul
d432f462c2 svga: dimension the dirty[] array with SVGA_STATE_MAX 2011-02-16 17:07:02 -07:00
Brian Paul
e162f28228 mesa: make _mesa_write_renderbuffer_image() non-static 2011-02-16 17:07:02 -07:00
Brian Paul
4b6c9b799b svga: disable a debug_printf() call 2011-02-16 17:07:02 -07:00
Sam Hocevar
3e8fb54fb8 docs: add glsl info 2011-02-16 17:05:08 -07:00
Sam Hocevar
fde4943688 docs: fix glsl_compiler name 2011-02-16 17:05:08 -07:00
Brian Paul
aaceca16df mesa: 80-column wrap 2011-02-16 17:05:08 -07:00
José Fonseca
fa05ddca15 svga: Proper redefine_user_buffer implementation.
Unfortunately still not enough to make GoogleEarth happy.
2011-02-16 21:53:10 +00:00
Marek Olšák
fa3f1348e4 r300g: fix a race between CS and SET_TILING ioctls 2011-02-16 22:23:23 +01:00
Marek Olšák
2d1cc27729 r300g: fix blitting NPOT compressed textures 2011-02-16 21:40:54 +01:00
Marek Olšák
8513d3405b mesa: fix texture3D mipmap generation for UNSIGNED_BYTE_3_3_2 and 4_4
Oops, I copy-pasted a typo from 3_3_2.

The 3_3_2 part is a candidate for 7.9 and 7.10.
The 4_4 part isn't, because AL44 is in neither branches.
2011-02-16 20:44:46 +01:00
Marek Olšák
4d6994e40e mesa: fix mipmap generation for MESA_FORMAT_AL44
This was missed when implementing AL44.
2011-02-16 20:21:40 +01:00
José Fonseca
33d8ff9c31 scons: Recognize 'AMD64' processor as well. 2011-02-16 18:02:08 +00:00
José Fonseca
590c2ee568 scons: Don't get fooled by 32bit python on a 64bit windows. 2011-02-16 18:02:06 +00:00
José Fonseca
9f9d6481de scons: Avoid depending on scons 2.0 in general. 2011-02-16 18:02:01 +00:00
José Fonseca
2a2b156ea5 mesa: Remove the DXT compression via blit path.
No longer used.
2011-02-16 16:50:24 +00:00
José Fonseca
697a3eb832 svga: Don't fake DXT compression ability. 2011-02-16 16:50:24 +00:00
Christoph Bumiller
3903e25a2c nvc0: fix blend factor mapping 2011-02-16 15:45:31 +01:00
Christoph Bumiller
3f1361e060 nvc0: fix emit_dfdx,dfdy 2011-02-16 15:45:31 +01:00
Christoph Bumiller
bb2c8e7099 nvc0: don't swap sources if either value is not in a GPR
The memory / immediate source should already be in the only valid
position.
2011-02-16 15:45:31 +01:00
Christoph Bumiller
2fa35eedd9 nvc0: add missing break statements in constant_operand 2011-02-16 15:45:31 +01:00
Christoph Bumiller
e7845e3196 nvc0: fix clipping and use VIEWPORT instead of SCISSOR 2011-02-16 15:45:31 +01:00
Christoph Bumiller
19f2272e94 nvc0: demagic the clear flags and fix region clears
The CLIP_RECTs always affect dedicated clears, and it's nicer than
having to mark the viewport or scissor state dirty after it.
2011-02-16 15:45:31 +01:00
Christoph Bumiller
293a8d1b60 nvc0: front stencil mask and func mask methods are swapped 2011-02-16 15:45:31 +01:00
Christoph Bumiller
a24e9bd497 nvc0: clone memory values with multiple refs before modifying them 2011-02-16 15:45:30 +01:00
Christoph Bumiller
80a7ae3cc5 nvc0: disable early fragment tests if KIL is used
Early-Z pass raises the occlusion counter.
2011-02-16 15:45:30 +01:00
Christoph Bumiller
17d680cc53 nvc0: force vertex data through FIFO if we need to convert it
We may want to put the converted vertex buffer in persistent
storage instead, but these are rare corner cases.
2011-02-16 15:45:30 +01:00
Christoph Bumiller
bf1ce9c64b nvc0: use format from the template on surface creation
Fixes piglit/fbo-srgb.
2011-02-16 15:45:30 +01:00
Christoph Bumiller
1b4c0c8ea0 nvc0: update the set of formats supported by the 2D engine 2011-02-16 15:45:30 +01:00
Christoph Bumiller
a3c62afa7c nvc0: fix user vertex buffer updates 2011-02-16 15:45:30 +01:00
Brian Paul
fc5ab1b197 mesa: use gl_format type instead of GLuint 2011-02-16 07:08:58 -07:00
Dave Airlie
f53436d821 r600g: fix typo in previous s3tc commit
pointed out by Marek on irc.
2011-02-16 16:51:41 +10:00
Marek Olšák
9e725b9123 r300g: fix texture border color for float formats 2011-02-16 07:46:36 +01:00
Dave Airlie
4ffef88899 Revert "util: fix DXT1 RGBA texture compression if the source color is (0, 0, 0, 0)"
This reverts commit 6e7d782da5.

Oops, I just had this locally for testing and forgot to remove it before pushing.
2011-02-16 16:13:58 +10:00
Dave Airlie
04903d1f63 r600g: add L8A8 SRGB formats.
this fixes the piglit mipmap generation sRGB on my rv730.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-16 16:09:43 +10:00
Marek Olšák
6e7d782da5 util: fix DXT1 RGBA texture compression if the source color is (0, 0, 0, 0)
This is a workaround for a bug in libtxc_dxtn.

Fixes:
- piglit/GL_EXT_texture_compression_s3tc/fbo-generatemipmap-formats

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-16 16:04:14 +10:00
Dave Airlie
4016a1b4c6 r600g: add L4A4 support.
this fixes piglit fbo-generatemipmap-formats on my rv730.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-16 16:01:36 +10:00
Dave Airlie
0863eaf91c r600g: fix s3tc-texsubimage
we need to translate the destination box as well.

fixes piglit's s3tc-texsubimage test.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-16 15:56:11 +10:00
Ian Romanick
25b36e8ff8 linker: Fix off-by-one error implicit array sizing
Arrays are zero based.  If the highest element accessed is 6, the
array needs to have 7 elements.

Fixes piglit test glsl-fs-implicit-array-size-03 and bugzilla #34198.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-15 18:22:33 -08:00
Vinson Lee
ae11707b83 st/python: add usage parameter to pipe_buffer_create
This is a follow-up to commit eafb7f234d.

Fixes Linux SCons build.
2011-02-15 17:29:43 -08:00
Marek Olšák
38104a767c r300g: disable linear filtering for float textures 2011-02-16 00:55:39 +01:00
Chad Versace
62c8c77333 glsl: Reinstate constant-folding for division by zero
Fixes regression: https://bugs.freedesktop.org/show_bug.cgi?id=34160

Commit e7c1f058d1 disabled constant-folding
when division-by-zero occured. This was a mistake, because the spec does
allow division by zero. (From section 5.9 of the GLSL 1.20 spec: Dividing
by zero does not cause an exception but does result in an unspecified
value.)

For floating-point division, the original pre-e7c1f05 behavior is
reinstated.

For integer division, constant-fold 1/0 to 0.
2011-02-15 15:46:12 -08:00
Chad Versace
f2e9981e43 Revert "glsl: Fix constant-folding for reciprocal expressions"
This reverts commit b3cf92aa91.

The reverted commit prevented constant-folding of reciprocal expressions
when the reciprocated expression was 0. However, since the spec allows
division by zero, constant-folding *is* permissible in this case.

From Section 5.9 of the GLSL 1.20 spec:
    Dividing by zero does not cause an exception but does result in an
    unspecified value.
2011-02-15 15:46:12 -08:00
Chad Versace
a231ac23f4 tnl: Add support for datatype GL_FIXED in vertex arrays
Before populating the vertex buffer attribute pointer (VB->AttribPtr[]),
convert vertex data in GL_FIXED format to GL_FLOAT.

Fixes bug: http://bugs.freedesktop.org/show_bug.cgi?id=34047

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-15 15:39:22 -08:00
Dave Airlie
632918d3ec r600g: add srgb compressed formats to the list. 2011-02-16 08:54:14 +10:00
Marek Olšák
eafb7f234d gallium: add usage parameter to pipe_buffer_create
And set a reasonable buffer usage flag everywhere instead of
just PIPE_USAGE_DEFAULT.
2011-02-15 22:44:21 +01:00
Fabian Bieler
82a9794a35 r600g: Fix RGB10_A2 format handling 2011-02-15 12:31:30 -05:00
Dave Airlie
4b81c5f6e1 r600g: fix regression in r6/7xx since mipmap rework
I typod this when copy-pasting.
2011-02-15 18:43:56 +10:00
Vinson Lee
cd8af3b60b nvc0: Fix uninitialized variable warning.
Fixes this GCC warning.
nvc0_tgsi_to_nc.c: In function 'bld_tex':
nvc0_tgsi_to_nc.c:1392: warning: 'dim' may be used uninitialized in this function
2011-02-15 00:27:16 -08:00
Marek Olšák
b9e2cde600 r300g: offload the CS ioctl to another thread
This is a multi-threading optimization which hides the kernel overhead
behind a thread. It improves performance in CPU-limited apps by 2-15%.
Of course you must have at least 2 cores for it to make any difference.

It can be disabled with:

export RADEON_THREAD=0
2011-02-15 09:17:39 +01:00
Dave Airlie
8e0437914b r600g: add support for s3tc formats.
On r600, s3tc formats require a 1D tiled texture format,
so we have to do uploads using a blit, via the 64-bit and 128-bit formats

Based on the r600c code we use a 64 and 128-bit type to do the
blits.

Still requires R600_ENABLE_S3TC until the kernel fixes are in,
this has only been tested on evergreen where the kernel doesn't
yet get in the way.
2011-02-15 14:44:09 +10:00
Dave Airlie
a661dacf14 r600g: fix miptree calculations
the miptree setup and pitch storing didn't work so well for block
based things like compressed textures. The CB takes blocks, where
the texture sampler takes pixels, and transfers need bytes,

So now we store blocks/bytes and translate to pixels in the sampler.

This is necessary for s3tc to work properly.
2011-02-15 14:44:08 +10:00
Dave Airlie
ea7a548d07 r600g: drop tiled flag
we can work this out from the array_mode and it makes more sense
to do that.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-15 14:44:08 +10:00
Dave Airlie
fdb4373a20 st/mesa: fix compressed mipmap generation.
If the underlying transfer had a stride wider for hw alignment reasons,
the mipmap generation would generate badly strided images.

this fixes a few problems I found while testing r600g with s3tc

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-15 14:44:08 +10:00
Marek Olšák
dc578188fa st/mesa: fix GLES build
Broken since d5062fb3a3.

I wonder why this code is hidden behind #if by default.
2011-02-15 04:56:09 +01:00
Marek Olšák
333d3daf47 r300g: actually implement the is_buffer_busy hook the right way
Ooops.
2011-02-15 04:00:47 +01:00
Marek Olšák
45e1cd522b r300g: handle interaction between UNSYNCHRONIZED and DONTBLOCK flags in bo_map
The VBO module uses both, but they are somewhat opposite to each other.
In this case, we pick UNSYNCHRONIZED and ignore DONTBLOCK.
2011-02-15 04:00:47 +01:00
Marek Olšák
8decb0a96d r300g: fix a possible race condition when mapping a buffer
This is the last one I think.
2011-02-15 04:00:47 +01:00
Marek Olšák
18b4978ac8 r300g: implement fences using dummy relocations
So finally we have them.
2011-02-15 04:00:46 +01:00
Marek Olšák
4faf11ad6c r300g: fix SIGFPE on debug builds 2011-02-15 01:19:54 +01:00
Marek Olšák
56029ce52b r300g: inline some of the pipe_buffer_map/unmap calls 2011-02-15 01:19:54 +01:00
Marek Olšák
20112cca26 r300g: do not track whether occlusion queries have been flushed
The winsys takes care of flushing automatically.
2011-02-14 23:36:12 +01:00
Marek Olšák
89ee0d527c r300g: flush CS in bo_map even if we get USAGE_DONTBLOCK
Because an app may do something like this:

while (!(ptr = bo_map(..., DONT_BLOCK))) {
    /* Do some other work. */
}

And it would be looping endlessly if we didn't flush.
2011-02-14 23:34:45 +01:00
Vinson Lee
ec21eabe2a st/python: remove pipe_vertex_buffer::max_index
This is a follow-up to commit cdca3c58aa.
2011-02-14 14:10:05 -08:00
Vinson Lee
7582448016 graw: remove pipe_vertex_buffer::max_index
This is a follow-up to commit cdca3c58aa.
2011-02-14 13:53:09 -08:00
Fabian Bieler
a476ca1fd1 st/mesa: Use blend equation and function of first render target for all render targets if ARB_draw_buffers_blend is not supported
If EXT_draw_buffers2 is supported but ARB_draw_buffers_blend isn't
_mesa_BlendFuncSeparateEXT only sets up the blend equation and function for the
first render target. This patch makes sure that update_blend doesn't try to use
the data from other rendertargets in such cases.

Signed-off-by: Brian Paul <brianp@vmware.com>
2011-02-14 14:37:18 -07:00
Marek Olšák
a87730ff3f r300g: implement pb_manager::is_buffer_busy 2011-02-14 22:02:40 +01:00
Marek Olšák
49579a4df8 pb_bufmgr_cache: add is_buffer_busy hook and use it instead of non-blocking map
This is cleaner and implementing the hook is optional.
2011-02-14 21:51:01 +01:00
Marek Olšák
588fa884d2 gallium: notify drivers about possible changes in user buffer contents
Also implement the redefine_user_buffer hook in the drivers.
2011-02-14 21:50:08 +01:00
Marek Olšák
2a904fd6a0 st/mesa: set vertex arrays state only when necessary
The vertex arrays state should be set only when (_NEW_ARRAY | _NEW_PROGRAM)
is dirty. This assumes user buffer content is mutable, which will be
sorted out in the next commit. The following usage case should be much faster
now:

for (i = 0; i < 1000; i++) {
   glDrawElements(...);
}

Or even:

for (i = 0; i < 1000; i++) {
   glSomeStateChangeOtherThanArraysOrProgram(...);
   glDrawElements(...);
}

The performance increase from this may be significant in some apps and
negligible in others. It is especially noticable in the Torcs game (r300g):
    Before: 15.4 fps
    After: 20 fps

Also less looping over attribs in st_draw_vbo yields slight speed-up
in apps with lots of glDraw* calls.
2011-02-14 21:50:08 +01:00
Marek Olšák
cdca3c58aa gallium: remove pipe_vertex_buffer::max_index
This is redundant to pipe_draw_info::max_index and doesn't really fit
in the optimizations I plan.
2011-02-14 21:50:08 +01:00
Marek Olšák
d5062fb3a3 gallium: always save and restore vertex buffers using cso_cache 2011-02-14 21:50:07 +01:00
Marek Olšák
cfaf217135 vbo: bind arrays only when necessary
We don't need to call bind_arrays in the vbo module if the states
which the function depends on are not dirty.
2011-02-14 21:50:07 +01:00
Marek Olšák
5a01361cea vbo: notify a driver that we change buffer offsets, strides, etc. 2011-02-14 21:50:07 +01:00
Vinson Lee
d123959ff7 r300g: Remove redundant initialization.
Remove redundant initialization from commit
3b01b52bd7 noticed by tstellar.
2011-02-14 10:47:58 -08:00
Alex Deucher
9e96ea0652 r600g: add alignment cases for linear aligned
Matches the drm and ddx.

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2011-02-14 13:07:29 -05:00
José Fonseca
07eb660fc9 draw: Don't define the last two mipmap levels in aa lines.
Some hardware needs to make a seperate copy of all levels to obey
max_lod, so simply do not define the last two levels instead of
clamping.
2011-02-14 10:56:48 +00:00
José Fonseca
9305e93114 svga: Set the appropriate flags when creating sampler/surface views. 2011-02-14 10:53:54 +00:00
Marek Olšák
a0c293ec11 r300g: put indices in CS if there's just a few of them and are in user memory 2011-02-14 11:43:14 +01:00
Marek Olšák
437583ea63 r300g: cleanup the draw functions 2011-02-14 11:43:14 +01:00
Marek Olšák
476cec37d6 r300g: do not create a user buffer struct for misaligned ushort indices fallback 2011-02-14 11:43:14 +01:00
Marek Olšák
d173f1ba8a r300g: fix fallback for misaligned ushort indices with num vertices >= 65535 2011-02-14 11:43:14 +01:00
Marek Olšák
3d5ac32f3b r300g: consolidate emission of common draw regs 2011-02-14 11:43:14 +01:00
Sedat Dilek
0f912534fd docs: Fix typo in GL3.txt 2011-02-14 00:45:44 -08:00
Vinson Lee
3b01b52bd7 r300g: Move declaration before code.
Fixes SCons build.
2011-02-14 00:07:07 -08:00
Marek Olšák
e9d993e9b9 r600g: do not destroy the original index buffer when translating indices
Because we only translate a subrange of the buffer.
2011-02-14 07:45:14 +01:00
Marek Olšák
5a6ba08c21 r300g: emit 3D_LOAD_VBPNTR only when necessary
I thought I couldn't skip emitting this packet in some cases.
Well it looks like I can.
2011-02-14 07:45:14 +01:00
Marek Olšák
004dd01583 r300g: fix reference counting when translating indices 2011-02-14 07:45:14 +01:00
Marek Olšák
9a90eeee67 u_index_modify: map buffers with PIPE_TRANSFER_UNSYNCHRONIZED 2011-02-14 07:45:14 +01:00
Marek Olšák
5197b09bee r300g: remove the relocation after AARESOLVE_PITCH 2011-02-14 07:45:14 +01:00
Dave Airlie
1f5b674168 egl_dri2: add nouveau support.
but really wtf? all these PCI IDs need to be ripped out of here, its totally
unscalable and the drivers already have this info so could export it some better way.

tested by Darxus on #wayland.
2011-02-14 07:54:28 +10:00
Marcin Slusarz
8fe5da89e3 nv50: fix query assertion 2011-02-13 22:05:28 +01:00
Marek Olšák
e6e4860555 r300g: correctly determine if a texture is blittable in texture_get_transfer 2011-02-13 08:49:15 +01:00
Marek Olšák
8ab1fcc66a r300g: fixup the handle_compare function
Accidentally negated in 685c3262b9.
2011-02-13 00:31:04 +01:00
Marek Olšák
1fd6bbc881 r300g: when printing shader linker errors to stderr, report it's not a bug 2011-02-12 23:38:00 +01:00
Marek Olšák
9ad9a6861a r300g: add debug options nozmask and nohiz which disable some hyper-z features 2011-02-12 23:37:14 +01:00
Marek Olšák
685c3262b9 r300g: typecast void* to unsigned correctly 2011-02-12 23:36:48 +01:00
Eric Anholt
04521c158f dri: Remove the old metaops code which has been superceded by ../common/ 2011-02-12 12:26:04 -08:00
Eric Anholt
211725eccd radeon: Remove setup of the old dri/ meta code, which is now unused. 2011-02-12 12:23:43 -08:00
Eric Anholt
47589c17b0 intel: Remove setup of the old dri/ meta code, which is now unused. 2011-02-12 12:23:20 -08:00
Dave Airlie
a6b7393eb8 update GL3.txt for GL_EXT_framebuffer_sRGB status 2011-02-12 18:08:04 +10:00
Tom Stellard
9106b98766 r300/compiler: Don't erase sources when converting RGB->Alpha
https://bugs.freedesktop.org/show_bug.cgi?id=34030

NOTE: This is a candidate for the 7.10 branch.
2011-02-11 19:42:35 -08:00
Christopher James Halse Rogers
d1e28b2267 mesa: Optionally build a dricore support library (v3)
This an adds --enable-shared-dricore option to configure.  When enabled,
DRI modules will link against a shared copy of the common mesa routines
rather than statically linking these.

This saves about 30MB on disc with a full complement of classic DRI
drivers.

v2: Only enable with a gcc-compatible compiler that handles rpath
    Handle DRI_CFLAGS without filter-out magic
    Build shared libraries with the full mklib voodoo
    Fix typos
v3: Resolve conflicts with talloc removal patches

Signed-off-by: Christopher James Halse Rogers <christopher.halse.rogers@canonical.com>
2011-02-11 18:31:05 -08:00
nobled
b5dc40710d glx: Put null check before use
'dpy' was being checked for null *after* it was already used once.

Also add a null check for psc, and drop gc's redundant initialization.
2011-02-11 18:19:10 -08:00
Marek Olšák
df54b53b7d r300g: improve function radeon_bo_is_referenced_by_cs
This should prevent calling into radeon_get_reloc when there's
only one context.
2011-02-12 03:08:39 +01:00
Marek Olšák
20a78b68a3 u_vbuf_mgr: fix segfault
max_index could have been less than min_index, which later caused integer
underflow followed by a segfault in memcpy.
2011-02-12 03:08:39 +01:00
Ian Romanick
3803295fc2 ir_to_mesa: Don't dereference a NULL pointer during copy propagation
The ACP may already be NULL, so don't try to make it NULL again.

This should fix bugzilla #34119.
2011-02-11 15:44:19 -08:00
Ian Romanick
a0120e6e0f glcpp: regerated files
These should have been committed right after fd1252ab, but they were
missed.  Soon, we'll never have to do this again...
2011-02-11 15:44:19 -08:00
Ian Romanick
afdceede55 glsl: Regenerate files modified by previous commits 2011-02-11 14:12:44 -08:00
Ian Romanick
8842158944 glsl: Finish out the reduce/reduce error fixes
Track variables, functions, and types during parsing.  Use this
information in the lexer to return the currect "type" for identifiers.

Change the handling of structure constructors.  They will now show up
in the AST as constructors (instead of plain function calls).

Fixes piglit tests constructor-18.vert, constructor-19.vert, and
constructor-20.vert.  Also fixes bugzilla #29926.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-11 14:12:43 -08:00
Keith Packard
f4b812e1a6 glsl: Eliminate reduce/reduce conflicts in glsl grammar
This requires lexical disambiguation between variable and type
identifiers (as most C compilers do).

Signed-off-by: Keith Packard <keithp@keithp.com>

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-11 14:12:43 -08:00
Benjamin Franzke
81affb8f4c st/mesa: Fix surfaceless opengl with non-dummy contexts
main/context.c:check_complatible() detecs an incomplete
framebuffer using its pointer, so do not copy it.

This should fix https://bugs.freedesktop.org/show_bug.cgi?id=34042
2011-02-11 16:54:04 -05:00
Brian Paul
6c3a82a1a3 svga: disable a debug_printf() call 2011-02-11 14:07:43 -07:00
Brian Paul
396da5df0e svga: comments and debug code 2011-02-11 14:02:30 -07:00
Brian Paul
f7d84c177f svga: more comments for need_pipeline field 2011-02-11 14:02:30 -07:00
José Fonseca
6826d58bbf scons: Need c99 also when cross compiling. 2011-02-11 20:09:26 +00:00
José Fonseca
982609f4cf scons: builtin_glsl_function on windows needs bundled getopt. 2011-02-11 20:09:26 +00:00
José Fonseca
ae760279f1 scons: Try to support building 64bit binaries on 32bit windows. 2011-02-11 20:09:26 +00:00
José Fonseca
051f8bbfee scons: Fix MSVC 64bit build. 2011-02-11 20:09:26 +00:00
Brian Paul
3ee97ead0b mesa: remove some unused gl_shader fields 2011-02-11 12:00:51 -07:00
Brian Paul
413511f796 draw: tweak AA line texture minimum alpha
AA lines drawn as textured quads look a little better with this change.
Conformance/piglit tests still pass.
2011-02-11 12:00:51 -07:00
Brian Paul
da2e541218 svga: add max DMA size check in svga_winsys_buffer_create()
This fixes a problem when trying to use large (2K x 2K) texture
images.  We'll DMA the image in chunks.

Patch written by Jose.
2011-02-11 11:56:45 -07:00
Brian Paul
8c61799051 svga: remove old comment, remove extra whitespace 2011-02-11 11:54:55 -07:00
Tobias Jakobi
11f35aa418 glsl: Fix parallel build.
Broken since e0c1fc3283.

Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
2011-02-11 10:36:14 -08:00
José Fonseca
6ed0f2ac11 svga: Enable the draw pipeline for smooth lines.
Spotted by Brian Paul.
2011-02-11 11:24:55 +00:00
José Fonseca
57a3d36a68 svga: Don't use the draw pipeline for non-AA lines with a fractional width.
Spotted by Jakob Bornecrantz.
2011-02-11 11:24:55 +00:00
José Fonseca
4586e6c8cb draw: Don't use the pipeline when drawing lines with fractional widths.
Spotted by Jakob Bornecrantz.
2011-02-11 11:24:55 +00:00
José Fonseca
7ac2db893a llvmpipe: Use u_math's round. 2011-02-11 11:24:54 +00:00
José Fonseca
151faa2258 util: Define round and roundf on MSVC. 2011-02-11 11:11:33 +00:00
José Fonseca
f0ca9f7134 svga: Stippled lines can also be drawn with triangles. 2011-02-11 07:48:05 +00:00
Marek Olšák
de22d8f1ee r300g: remove unused function prototypes, update copyright 2011-02-11 06:07:23 +01:00
Haitao Feng
3104e5cb4f egl_dri2: rename loader_extension to dri2_loader_extension
Signed-off-by: Haitao Feng <haitao.feng@intel.com>
2011-02-10 23:41:21 -05:00
Benjamin Franzke
9f213f6a4a st/egl wayland: Sync front buffer release 2011-02-10 23:07:01 -05:00
Benjamin Franzke
51f2820922 egl_dri2 wayland: Sync front buffer release 2011-02-10 23:07:01 -05:00
Benjamin Franzke
4e8f95f64d egl_dri2: Always unbind old contexts
This fixes __DRIdrawable refcounting.
Binding a context increases their refcount,
so we need to decrease it.
2011-02-10 23:07:01 -05:00
Benjamin Franzke
87dde5b1cd egl_dri2: Use double buffering for window surfaces 2011-02-10 23:07:01 -05:00
Benjamin Franzke
71fa227029 st/dri: Set render_buffer in dri_fill_st_visual
st/mesa/st_managaer.c needs render_buffer in order
to determinde which buffer should be rendered to.
2011-02-10 23:07:01 -05:00
Benjamin Franzke
fa3283cca8 st/dri: img_from_renderbuf: Fix incorrect usage of dri_context() 2011-02-10 23:07:01 -05:00
Benjamin Franzke
0acb31be17 st/dri: Fix surfaceless gl using contexts with previous bound surfaces
ctx->dPriv might be != NULL then draw which is NULL is accessed:

struct dri_drawable *draw = dri_drawable(driDrawPriv);
[..]
if (ctx->dPriv != driDrawPriv) {
      ctx->dPriv = driDrawPriv;
      draw->texture_stamp = driDrawPriv->lastStamp - 1;
}
2011-02-10 23:07:01 -05:00
Benjamin Franzke
c79a5a7067 st/egl wayland: Set color_format according to wl_visual 2011-02-10 23:07:01 -05:00
Dave Airlie
596684eb93 r600g: get correct height alignment
useful for s3tc
2011-02-11 13:47:35 +10:00
Dave Airlie
9d85aba0e3 r600g: drop two unused | 0 that are actually in word4 anyways.
these were NOPs anyways.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-11 13:47:35 +10:00
Dave Airlie
0d851f6e9c r600g: handle 16/32 u/s norm formats properly
add support for the 32-bit types, also fixup the
export setting to handle types with channels > 11 bits properly

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-11 13:47:34 +10:00
Marek Olšák
9a1fe76a20 r300g: prevent NULL pointer dereference in r300_buffer_create
Should fix:
https://bugs.freedesktop.org/show_bug.cgi?id=33185
2011-02-11 03:18:05 +01:00
Kenneth Graunke
2e8726f5b1 mesa: Remove empty header file s_trispan.h. 2011-02-10 17:37:01 -08:00
Kenneth Graunke
e0c1fc3283 glsl/Makefile: glcpp doesn't need libglsl.a.
Also, add a 'glcpp' target so you can type 'make glcpp' instead of
'make glcpp/glcpp'.
2011-02-10 17:37:01 -08:00
Marek Olšák
032b162ce8 r300g: plug a memory leak in winsys 2011-02-11 02:34:15 +01:00
Marek Olšák
862ebb411b r300g: remove unneeded code in winsys
We don't need the read/write flags.
2011-02-11 01:32:44 +01:00
Marek Olšák
98f344c504 r300g: fix warning 2011-02-11 01:18:53 +01:00
Marek Olšák
7da5105fb3 configure.ac: remove libdrm_radeon dependency for r300g and r600g 2011-02-11 01:16:06 +01:00
Marek Olšák
6ccab620a0 r300g: import the last bits of libdrm and cleanup the whole thing
Based on Dave's branch.

The majority of this commit is a cleanup, mainly renaming things.
There wasn't much code to import, just ioctl calls.

Also done:
- implemented unsynchronized bo_map (important optimization!)
- radeon_bo_is_referenced_by_cs is no longer a refcount hack
- dropped the libdrm_radeon dependency

I'm surprised that this has resulted in less code in the end.
2011-02-11 01:07:25 +01:00
Marek Olšák
c0beaf6e6d st/mesa: allow rendering to sRGB textures if EXT_fb_srgb is unsupported
In this case, we always use the corresponding linear format in create_surface,
therefore we should check for linear format support as well.
2011-02-11 01:07:21 +01:00
Ian Romanick
4c1dc1c4d7 i915: Force lowering of all types of indirect array accesses in the FS
NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-10 13:26:49 -08:00
Ian Romanick
53b8b68843 i915: Calculate partial result to temp register first
Previously the SNE and SEQ instructions would calculate the partial
result to the destination register.  This would cause problems if the
destination register was also one of the source registers.

Fixes piglit tests glsl-fs-any, glsl-fs-struct-equal,
glsl-fs-struct-notequal, glsl-fs-vec4-operator-equal,
glsl-fs-vec4-operator-notequal.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-10 13:26:49 -08:00
José Fonseca
05a16b8e1c u_upload_mgr: Use PIPE_TRANSFER_FLUSH_EXPLICIT.
This can avoid DMAing the whole buffer when just a fraction was changed.
2011-02-10 20:55:10 +00:00
José Fonseca
d60f07489e scons: Disable -mstackrealign on MinGW again.
It's still broken, however it doesn't show up on debug builds.
2011-02-10 16:29:10 +00:00
Kristian Høgsberg
1a8899d630 configure.ac: Fix typo 2011-02-10 10:45:27 -05:00
Marek Olšák
fea4ad8f66 r300g: implement accelerated copy_region for compressed formats 2011-02-10 11:27:35 +01:00
Marek Olšák
7c24a4c6a8 r300g: add a way to change texture properties arbitrarily
So that we can implement resource_copy on arbitrary data.
2011-02-10 11:27:35 +01:00
Marek Olšák
56ba7e913f r300g: consolidate buffers and textures to r300_resource
Transfers and create/destroy are still handled separately.
2011-02-10 11:27:35 +01:00
Marek Olšák
ce9c0d2801 r300g: simplify WRITE_RELOC API and cleanup 2011-02-10 11:27:35 +01:00
Marek Olšák
ac366af9fd u_blitter: let the driver check whether there's a recursion 2011-02-10 11:27:34 +01:00
Marek Olšák
fc9170d0cf r300g: use format from pipe_surface instead of pipe_resource 2011-02-10 02:11:38 +01:00
Marek Olšák
2314a2f45f Revert "r300g: support sRGB colorbuffers"
This partially reverts commit 91eba2567e.

Conflicts:

	src/gallium/drivers/r300/r300_blit.c
2011-02-10 01:43:27 +01:00
Dave Airlie
21b0996dfc mesa/st: enable GL_EXT_framebuffer_sRGB
If the formats don't match we need to update the surface with the new
format.

if we can render to SRGB formats, enable the extension

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-10 10:14:27 +10:00
José Fonseca
3b8bb7b449 scons: Restrict whole program optimization to release builds.
It just takes forever, so it is inadequate for continuous testings
(i.e., checked and profile build types).
2011-02-09 18:31:21 +00:00
José Fonseca
2d95885308 svga: Don't advertise pixel shader addr register support.
It's not fully supported.
2011-02-09 18:31:21 +00:00
Kristian Høgsberg
04c5cc5b8b eglplatform.h: Define Wayland native platform types
This is conditional on WL_EGL_PLATFORM being #defined, so application
must make sure to include wayland-egl.h before including any egl header.
2011-02-09 10:58:20 -05:00
Christoph Bumiller
b6e3130a3b nvc0: serialize on PIPE_FLUSH_RENDER_CACHE as well
Effects were easily visible in piglit/fbo-generatemipmap-formats.
2011-02-09 16:05:00 +01:00
Christoph Bumiller
fc798dc37d nvc0: fix stride of NVC0_3D_RT methods 2011-02-09 16:05:00 +01:00
Christoph Bumiller
95f0aa0e52 nvc0: correct storage type for 16 bit surface formats 2011-02-09 16:05:00 +01:00
Christoph Bumiller
0bd04cdd12 nvc0: make CSE work for ops with multiple results 2011-02-09 16:05:00 +01:00
Christoph Bumiller
0691530b7f nvc0: replace branching with predicated insns where feasible 2011-02-09 16:05:00 +01:00
Christoph Bumiller
0f776fea43 nvc0: implement local memory load and store ops 2011-02-09 16:05:00 +01:00
Christoph Bumiller
4124feabcb nvc0: make sure phi-ops really have one source per in-block 2011-02-09 16:05:00 +01:00
Christoph Bumiller
7401590ded nv50,nvc0: do not forget to apply sign mode to saved TGSI inputs 2011-02-09 16:05:00 +01:00
Christoph Bumiller
c485368efe nvc0: do not generate a backwards jump if a loop ends with BRK 2011-02-09 16:05:00 +01:00
Christoph Bumiller
8e240e6153 nvc0: store only one value per basic block for TGSI regs 2011-02-09 16:05:00 +01:00
Christoph Bumiller
d5263e4093 nv50,nvc0: fix condition code change when commuting SET sources 2011-02-09 16:04:59 +01:00
Christoph Bumiller
8f05134580 nvc0: set basic block on manual instruction insertion 2011-02-09 16:04:59 +01:00
Christoph Bumiller
92d8af582d nvc0: try to fix register conflicts for vector instructions
Vector here means using multiple 32 bit regs which are forced to be
consecutive in the register file.

This still isn't quite nice.
2011-02-09 16:04:59 +01:00
Christoph Bumiller
c62fc50c88 nvc0: reset texture base address after read transfer 2011-02-09 16:04:59 +01:00
Christoph Bumiller
d3ea15f5ca nvc0: don't combine memory loads across block boundaries 2011-02-09 16:04:59 +01:00
Christoph Bumiller
f0d7429623 nvc0: detect no-op MIN/MAX, do CSE earlier to succeed more often 2011-02-09 16:04:59 +01:00
Thomas Hellstrom
a7293cbe5c mesa/st: Clean up vertex buffer unreferencing
Avoid accessing draw module internal structures outside of the draw module.
Unreference vertex buffers in error path.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2011-02-09 09:45:34 +01:00
Marek Olšák
c264786809 gallium/docs: fix typo 2011-02-09 05:21:20 +01:00
Brian Paul
f70c98b6a6 r200: add cast to silence warning 2011-02-08 19:25:04 -07:00
Brian Paul
3b0c2eb07c mesa: remove unused BITFIELD64 macros 2011-02-08 19:25:04 -07:00
Brian Paul
6f2f449414 mesa: remove _mesa_create_context_for_api()
Just add the gl_api parameter to _mesa_create_context().
2011-02-08 19:25:04 -07:00
Brian Paul
5e4ca1ccc9 mesa: remove _mesa_initialize_context_for_api()
Just add the gl_api parameter to _mesa_initialize_context().
2011-02-08 19:25:04 -07:00
Brian Paul
2634e92dc0 mesa: add/update VERBOSE_API logging 2011-02-08 19:20:43 -07:00
Brian Paul
7230e1a228 st/mesa: fix shader deletion regression
Fixes a regression from commit 5cbff0932e.
The problem is *some* glDrawPixels fragment programs need to be deleted,
but not all.  Use an explicit flag to indicate whether or not the program
needs to be deleted.

This should fix http://bugs.freedesktop.org/show_bug.cgi?id=34049
2011-02-08 18:23:59 -07:00
Kenneth Graunke
f6f04ae29c i965: Add missing DEFINE_BITS for brw dirty bits.
These are only used for debugging, but should be there.
Found by inspection.
2011-02-08 16:56:18 -08:00
Kenneth Graunke
58b7e37722 i965: Separate the BRW_NEW_(VS|WM)_CONSTBUF dirty bits.
These were incorrectly defined to the same value - likely due to a cut
and paste error.  Found by inspection.
2011-02-08 16:55:20 -08:00
Kenneth Graunke
71acbb54f4 i965: Rename a few more commands to match the documentation. 2011-02-08 16:06:47 -08:00
Benjamin Franzke
15598fbf42 st/egl: Fix platform selection
A break for case _EGL_PLATFORM_X11 is missing.
introduced by: 381ea0d67a
2011-02-08 15:16:31 -05:00
Eric Anholt
df8ca3e0ec i965: Remove pointless keying of WM state on VUE size. 2011-02-08 11:42:44 -08:00
Eric Anholt
76857e8954 mesa: Fix the Mesa IR copy propagation to not read past writes to the reg.
Fixes glsl-vs-post-increment-01.

Reviewed-by: José Fonseca <jfonseca@vmware.com>
2011-02-08 11:42:35 -08:00
Eric Anholt
60aab5f335 glsl: Disable the new copy propagation pass until it gets fixed.
It apparently regressed a bunch of ES2 cases.
2011-02-08 11:41:05 -08:00
Chad Versace
82f994f386 glsl: Set operators '%' and '%=' to be reserved when GLSL < 1.30
From section 5.9 of the GLSL 1.20 spec:
   The operator modulus (%) is reserved for future use.

From section 5.8 of the GLSL 1.20 spec:
   The assignments modulus into (%=), left shift by (<<=), right shift by
   (>>=), inclusive or into ( |=), and exclusive or into ( ^=). These
   operators are reserved for future use.

The GLSL ES 1.00 spec and GLSL 1.10 spec have similiar language.

Fixes bug:
https://bugs.freedesktop.org//show_bug.cgi?id=33916

Fixes Piglit tests:
spec/glsl-1.00/compiler/arithmetic-operators/modulus-00.frag
spec/glsl-1.00/compiler/assignment-operators/modulus-assign-00.frag
spec/glsl-1.10/compiler/arithmetic-operators/modulus-00.frag
spec/glsl-1.10/compiler/assignment-operators/modulus-assign-00.frag
spec/glsl-1.20/compiler/arithmetic-operators/modulus-00.frag
spec/glsl-1.20/compiler/assignment-operators/modulus-assign-00.frag
2011-02-08 09:37:03 -08:00
Marek Olšák
69e5516308 r600g: fixup assertion 2011-02-08 18:18:13 +01:00
Marek Olšák
71df812146 r600g: add a faster implementation of transfer_inline_write
u_default_transfer_inline_write uses util_copy_rect, which is kinda slow.
2011-02-08 17:47:00 +01:00
Marek Olšák
f0b202ec73 r600g: slab-allocate buffer and transfer structures 2011-02-08 17:30:39 +01:00
Marek Olšák
b541a3c4c0 r300g: use the same upload buffer for vertices and indices 2011-02-08 16:35:02 +01:00
Marek Olšák
467023e808 r600g: use the same upload buffer for vertices, indices, and constants
This should reduce memory consumption.
2011-02-08 16:35:02 +01:00
Thomas Hellstrom
8042470057 mesa/st: Plug a fragment program variant parameter leak
Fixes a minor memory leak with the "engine" mesa demo.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-02-08 08:13:39 -07:00
Brian Paul
5cbff0932e st/mesa: free the temporary bitmap/drawpix shader code
Fixes a per-shader memory leak when drawing glBitmaps, glDrawPixels
or glCopyPixels.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-08 08:10:22 -07:00
Marek Olšák
1ee71bdc8a u_vbuf_mgr: add a way to specify the BIND flag for the upload buffer 2011-02-08 15:20:11 +01:00
Marek Olšák
7628c4ecb6 u_vbuf_mgr: remove tabs 2011-02-08 15:18:46 +01:00
Marek Olšák
f53cbf8bb0 u_vbuf_mgr: make the uploader public 2011-02-08 15:08:04 +01:00
Marek Olšák
d8d5c2660f Revert "r600g: do not flush the uploader" (with comments)
This reverts commit 1c2a4f0820.
2011-02-08 14:48:12 +01:00
Brian Paterni
4d78dafc84 r600g: silence a few valgrind warnings 2011-02-08 12:48:44 +01:00
Thomas Hellstrom
bb1036aae5 mesa/st: Fix vertex buffer leak
Make sure we unreference the vertex buffer pointers in a local array.
This fixes huge vertex buffer / memory leaks in mesa demos "fire" and "engine".

NOTE: This is a candidate for the 7.9 and 7.10 branches.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2011-02-08 11:01:21 +01:00
Kristian Høgsberg
1e1b89103e wayland-egl: Add struct wl_egl_display argument to +wl_egl_window_create() 2011-02-07 20:50:18 -05:00
Henri Verbeet
077c448d18 r600g: Add support for relative addressing on constant buffers.
Relative addressing of constant buffers can't work properly through the
kcache, since you can only address within the currently locked kcache window.
Instead, this patch binds the constant buffer as a shader resource, and then
explicitly fetches the constant using a vertex fetch with fetch type
VTX_FETCH_NO_INDEX_OFFSET from the shader. There's probably still some room
for improvement, doing the fetch right before the instruction that needs the
value may not be quite optimal for example.
2011-02-07 15:22:08 +01:00
Henri Verbeet
871460eb14 r600g: Set the fetch type in r600_bc_vtx_build(). 2011-02-07 15:22:08 +01:00
Henri Verbeet
4c30a80e38 r600g: Handle the ADD_INT instruction in r600_bc_get_num_operands(). 2011-02-07 15:22:07 +01:00
Henri Verbeet
5c59eebfae r600g: Generalize the pipe_add_vertex_attrib() functions.
This allows them to be used for VS or PS buffer resources as well.
2011-02-07 15:22:07 +01:00
Henri Verbeet
b9fd1a1e4b r600g: Remove vs_resource and ps_resource from the pipe context.
These are practically unused, only the vs_resource array is being abused for
fetch shader resources.
2011-02-07 15:22:07 +01:00
Henri Verbeet
7687eabaa0 r600g: Split constants in r600_shader_from_tgsi(). 2011-02-07 15:22:07 +01:00
Henri Verbeet
1fa95c7f9e r600g: Do the tgsi_full_src_register to r600_shader_src conversion in r600_shader_from_tgsi(). 2011-02-07 15:22:07 +01:00
Henri Verbeet
a77e813de3 r600g: Split r600_bc_alu_src.
The r600_bc_alu_src structure is used in two different ways, as a vector and
for the individual channels of that same vector. This is somewhat fragile,
and probably confusing.
2011-02-07 15:22:07 +01:00
Henri Verbeet
3b1c1f0253 r600g: Store literal values in the r600_bc_alu_src structure.
This is much easier to work with, and allows use to get rid of some of the
literal handling hacks.
2011-02-07 15:22:07 +01:00
Henri Verbeet
80235d92e6 r600g: tgsi_dst() can't fail. 2011-02-07 15:22:07 +01:00
Henri Verbeet
d0f2ffad76 r600g: tgsi_src() can't fail. 2011-02-07 15:22:07 +01:00
Kristian Høgsberg
56758c839f wayland-egl: Force roundtrips to get device name and authenticate correctly
If the client hasn't done the initial wl_display_iterate() at the time
we initialize the display, we have to do that in platform_wayland.c.
Make sure we detect that correctly instead of dup()ing fd=0, and use
the sync callback to make sure we don't wait forever for authorization that
won't happen.
2011-02-07 14:01:31 +01:00
Benjamin Franzke
93aea84f47 egl_dri2: Add wayland platform 2011-02-07 14:01:31 +01:00
Benjamin Franzke
9630437fc9 egl_dri2: Export dri2_get_driver_for_fd 2011-02-07 14:01:31 +01:00
Benjamin Franzke
a8128d7d4b egl_dri2: Enable pixmap bind_to_texture according to the extension 2011-02-07 14:01:30 +01:00
Benjamin Franzke
381ea0d67a st/egl: Add wayland platform 2011-02-07 14:01:16 +01:00
Benjamin Franzke
9b6dc9b7a4 st/egl: drm_image: Check for MESA_drm_image
MESA_drm_image isnt limited to drm platform,
others can enable the extension too.
2011-02-07 13:55:29 +01:00
Benjamin Franzke
464cb3a09e st/egl: native_helper: Add resource_surface_import_resource 2011-02-07 13:55:29 +01:00
Benjamin Franzke
214fc6e850 egl: Implement libwayland-egl
This library is required and defined by wayland for
EGL implementations supporting wayland.
2011-02-07 13:55:20 +01:00
Benjamin Franzke
e586c4b763 egl: Add wayland platform 2011-02-07 13:52:29 +01:00
Benjamin Franzke
2adfde3aae intel: Implement dri2::{Allocate,Release}Buffer 2011-02-07 13:52:28 +01:00
Benjamin Franzke
f8e939a3a7 st/dri: Implement dri2::{Allocate,Release}Buffer 2011-02-07 13:52:28 +01:00
Benjamin Franzke
1b8ef9416b Add dri2::{Allocate,Release}Buffer extension 2011-02-07 13:52:28 +01:00
Marek Olšák
a22bda9f80 r600g: correctly report supported vertex formats 2011-02-07 03:51:53 +01:00
Marek Olšák
c95bc1224a r300g: use the new vertex buffer manager 2011-02-07 02:46:23 +01:00
Marek Olšák
aa8a2224a3 r600g: use the new vertex buffer manager 2011-02-07 02:46:17 +01:00
Marek Olšák
975320ab76 util: import a new vertex buffer manager
This code has originally matured in r300g and was ported to r600g several
times. It was obvious it's a code duplication.

See also comments in the header file.
2011-02-07 02:23:46 +01:00
Marek Olšák
1c2a4f0820 r600g: do not flush the uploader 2011-02-06 21:13:58 +01:00
Marek Olšák
529d867207 r300g: do not flush the uploader
We don't have to unmap and recreate the upload buffer when a flush occurs.
This should also prevent buffer allocations from failing.
2011-02-06 21:12:51 +01:00
Marek Olšák
ec96b0ecdb configure.ac: correctly check for libdrm_radeon version 2011-02-06 15:47:00 +01:00
Marek Olšák
4ad3b27cee r300g: RS400 doesn't have ZMASK 2011-02-06 15:46:51 +01:00
Dave Airlie
780c183b8f r600g: use surface format not underlying texture format
This uses the surface format to set the CB up not the underlying texture
format, since these can and do differ.

Fixes piglit fbo-srgb.
2011-02-06 19:00:04 +10:00
Tom Stellard
68b701f5de r300/compiler: Disable register rename pass on r500
The scheduler and the register allocator are not good enough yet to deal
with the effects of the register rename pass.  This was causing a 50%
performance drop in Lightsmark.  The pass can be re-enabled once the
scheduler and the register allocator are more mature.  r300 and r400
still need this pass, because it prevents a lot of shaders from using
too many texture indirections.

NOTE: This is a candidate for the 7.10 branch.
2011-02-05 22:39:58 -08:00
Tom Stellard
19202284c0 r300/compiler: Don't count BEGIN_TEX instructions in the compiler stats 2011-02-05 00:27:24 -08:00
Dave Airlie
88ffa9ce5b mesa/965: add support for GL_EXT_framebuffer_sRGB (v2)
This adds i965 support for GL_EXT_framebuffer_sRGB, it introduces a new
constant to say that the driver can support sRGB enabled FBOs since enabling
the extension doesn't mean the driver can actually support sRGB.

Also adds the suggested state flush in the core code suggested by Brian.

fix the ARB_fbo color encoding.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-05 17:06:30 +10:00
Ian Romanick
5c3f1cdbbe mesa: Fix error checks in GetVertexAttrib functions
Querying index zero is not an error in OpenGL ES 2.0.

Querying an index larger than the value returned by
GL_MAX_VERTEX_ATTRIBS is an error in all APIs.

Fixes bugzilla #32375.
2011-02-04 12:10:05 -08:00
Ian Romanick
ce9171f9d8 linker: Generate link errors when ES shaders are missing stages
ES requires that a vertex shader and a fragment shader be present.

Fixes bugzilla #32214.
2011-02-04 12:10:04 -08:00
Vinson Lee
425ba19832 glsl: Add opt_copy_propagation_elements.cpp to SConscript.
Fixes SCons build.
2011-02-04 11:47:01 -08:00
Eric Anholt
1b80622c4e i965: Drop the dead tracking of color_regions[].
We pull the draw regions right out of the renderbuffers these days.
2011-02-04 12:18:38 -06:00
Eric Anholt
95cdce7f70 i965: Drop the INTEL_DEBUG=state spam about the cache size check.
There's way more interesting info in INTEL_DEBUG=state if you could find
it among the state size checks.
2011-02-04 12:18:38 -06:00
Eric Anholt
29a2e9133e glsl: Remove extra checks for constant true assignment conditions.
These are already stripped by opt_constant_folding.cpp.
2011-02-04 12:18:38 -06:00
Eric Anholt
b6d49ab843 glsl: Fix a comment typo in copy propagation. 2011-02-04 12:18:38 -06:00
Eric Anholt
e31266ed3e glsl: Add a new opt_copy_propagation variant that does it channel-wise.
This patch cleans up many of the extra copies in GLSL IR introduced by
i965's scalarizing passes.  It doesn't result in a statistically
significant performance difference on nexuiz high settings (n=3) or my
demo (n=10), due to brw_fs.cpp's register coalescing covering most of
those extra moves anyway.  However, it does make the debug of wine's
GLSL shaders much more tractable, and reduces instruction count of
glsl-fs-convolution-2 from 376 to 288.
2011-02-04 12:18:38 -06:00
Vinson Lee
cde443e0b9 ralloc: Add missing va_end following va_copy. 2011-02-03 22:10:16 -08:00
Dave Airlie
3188a7deb3 r600g: don't set tile_type on evergreen.
Since we never bind the actual DB to the CB/texture only the flushed one
we don't need to track the tile type at the moment.
2011-02-04 15:26:41 +10:00
Dave Airlie
fdd35dc912 r600g: fix evergreen sampler view + depth interaction 2011-02-04 15:26:09 +10:00
Vinson Lee
9ee765197c util: Change u_get_transfer_vtbl usage argument type to match prototype.
The type of u_get_transfer_vtbl of the usage argument in u_transfer.h is
unsigned and not enum pipe_transfer_usage. This patch changes the type
of usage to unsigned to match the prototype in the header file.
2011-02-03 20:15:25 -08:00
Vinson Lee
61c59234f9 glsl: Add using statements for standard library functions.
Standard library functions in C++ are in the std namespace. When using
C++-style header files for the standard library, some compilers, such as
Sun Studio, provide symbols only for the std namespace and not for the
global namespace.

This patch adds using statements for standard library functions. Another
option could have been to prepend standard library function calls with
'std::'.

This patch fixes several compilation errors with Sun Studio.
2011-02-03 19:19:12 -08:00
Dave Airlie
151a945d38 r600g: get offset for correct texture when setting up CB.
this fixes the mipmap tests with tiling forced on.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-04 09:38:01 +10:00
Dave Airlie
812c314e51 r600g: avoid trying to flush the flushing texture.
Since these textures still have the depth bit set.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-04 09:36:02 +10:00
Dave Airlie
8c643446f9 r600g: evergreen CB check for flushed texture 2011-02-04 09:34:32 +10:00
Dave Airlie
2271c793e8 r600g: flushing texture needs all levels.
For mipmap generation we need all levels in the flushing texture.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-04 09:09:45 +10:00
Dave Airlie
cd6864c079 r600g: remove unused variables 2011-02-04 09:09:45 +10:00
Dave Airlie
3e9bc43fba r600g: add a flag to just create flushed texture without flushing.
This just adds a flag to create the texture without doing any
flushing to it. Flushing occurs in the draw function. This avoids
unnecessary flushes when we end up rebinding a CB/DB/texture due
to the blitter just restoring state.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-04 09:09:45 +10:00
Dave Airlie
446bc12c17 r600g: also check CB bindings for textures to depth flush.
This checks the color buffer bindings to make sure there is something
to flush.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-04 09:09:44 +10:00
Dave Airlie
4b49fcbb9a r600g: flush depth texture before a blit from it.
If we are going to blit from a depth texture we need to flush
it before we blit from it.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-04 09:09:44 +10:00
Brian Paul
5026841d5e svga: rename a couple sampler, sampler view functions 2011-02-03 14:22:21 -07:00
Brian Paul
e40252d4d9 gallium/svga: added debug code for dumping framebuffer images (disabled) 2011-02-03 14:22:21 -07:00
Brian Paul
73e37d933d gallium/docs: more info about setting samplers and sampler views
Plus other assorted clarifications.
2011-02-03 13:47:12 -07:00
Brian Paul
c5fb2c60bf cso: don't tell drivers to bind null samplers, sampler views
Before, the set_sampler_views() and restore_sampler_views() functions
used MAX2(old,new) to tell the driver how many samplers or sampler
views to set.  This could result in cases such as:

pipe->set_fragment_sampler_views(pipe, 4, views={foo, bar, NULL, NULL})

Many/most gallium drivers would take this as-is and set
ctx->num_sampler_views=4 and ctx->sampler_views={foo, bar, NULL, NULL, ...}.
Later, loops over ctx->num_sampler_views would have to check for null
pointers.  Worse, the number of sampler views and number of sampler CSOs
could get out of sync:

ctx->num_samplers = 2
ctx->samplers = {foo, bar, ...}
ctx->num_sampler_views = 4
ctx->sampler_views={Foo, Bar, NULL, NULL, ...}

So loops over the num_samplers could run into null sampler_views pointers
or vice versa.

This fixes a failed assertion in the SVGA driver when running the Mesa
engine demo in AA line mode (and possibly other cases).

It looks like all gallium drivers are careful to unreference views
and null-out sampler CSO pointers for the units beyond what's set
with the pipe::bind_x_sampler_states() and pipe::set_x_sampler_views()
functions.

I'll update the gallium docs to explain this as well.
2011-02-03 13:47:11 -07:00
Henri Verbeet
a6a710cbe7 r600g: Make some more things static. 2011-02-03 21:13:12 +01:00
Henri Verbeet
d06b990096 r600g: Get rid of the unused r600_cf_vtx_tc() function. 2011-02-03 21:13:12 +01:00
Henri Verbeet
d17d03a8dc r300g: Make the buffer and texture vbtls static const. 2011-02-03 21:13:12 +01:00
Henri Verbeet
126e98966d r600g: Make the buffer and texture vbtls static const. 2011-02-03 21:13:12 +01:00
Alex Deucher
4668ad36f3 egl_dri2: Add new radeon pci ids
Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2011-02-03 14:35:54 -05:00
Kristian Høgsberg
9dc5de5bb1 egl_dri2: Split out drm platform implementation to a separate file 2011-02-03 11:59:38 -05:00
Kristian Høgsberg
2889d9640f egl_dri2: Split out x11 platform code 2011-02-03 11:59:38 -05:00
Haitao Feng
b43a147128 swrast: add an interface createNewContextForAPI
This new interface could set up context for OpenGL,
OpenGL ES1 and OpenGL ES2. It will be used by egl_dri2
driver.

Signed-off-by: Haitao Feng <haitao.feng@intel.com>
2011-02-03 11:59:30 -05:00
José Fonseca
610c24b19d svga: Fix resource leak; undo temporary workaround.
Leak was introduced when fixing strict aliasing violation in this code:
the reference counting was preserved, but the destructor call on zero
reference count was not.
2011-02-03 16:14:02 +00:00
José Fonseca
0f3eeb45c7 svga: Temporarily disable buffer DMA upload coalescing.
See comment for more details.
2011-02-03 15:15:23 +00:00
José Fonseca
637ed52f59 svga/drm: Flushing preemptively on a 1/3 of the aperture.
Exactly one half would be the ideal, but this is a soft limit, and one
more byte over brings us to synchronous behavior.

Flushing when the referred GMR exceeds one third of the aperture gives us
statistically better performance.
2011-02-03 15:15:23 +00:00
José Fonseca
b6b6b8f8bb util: Prevent transfer dangling pointer on map failure. 2011-02-03 15:15:23 +00:00
José Fonseca
5c296a583d svga: Don't call swc->flush directly.
Only svga_context_flush should do it, to ensure upload commands are not
submitted to hardware in an inconsistent state.
2011-02-03 15:15:23 +00:00
José Fonseca
9d4488e4a8 svga: Add an assert to catch reentrancy. 2011-02-03 15:15:23 +00:00
José Fonseca
63c0a504a0 svga/drm: Update for pb_vtbl::map argument addition. 2011-02-03 15:15:23 +00:00
Michel Dänzer
7535f93e5a r300c: Unbreak after R4xx support was added to r300/compiler. 2011-02-03 13:25:16 +01:00
José Fonseca
82e79e93ac scons: Eliminate libgcc_s_sjlj-1.dll dependency
Certain mingw32 cross compilers (e.g. RedHat's) defaults to use DLL gcc
runtime.

Given the main deliverable from this project are self-contained drivers,
which are loaded by any application, this dependency can cause havoc.
2011-02-03 09:16:49 +00:00
Dave Airlie
aa31a5cbc7 r600g: flush differences back to DB copy. 2011-02-03 14:19:52 +10:00
Dave Airlie
417cfa60b2 r600g: fix depth hw resource copies.
With the previous fixes we can now enabled hw depth copies

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-03 14:19:37 +10:00
Dave Airlie
5730d56549 r600g: only set depth bit for hw accessible depth buffers.
If we get a sw accessible buffer like the S8 texture we end up
doing depth tracking on it when there is no need since we won't
ever bind it to the hardware. This leads to a sw fallback in the
transfer destruction which leads to and endless recusion loop
of fail in transfer destroy.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-03 14:18:01 +10:00
Dave Airlie
b13b7b86b2 r600g: rework dirty / depth texture tracking.
this adds a flag to keep track of whether the depth texture structure
is the flushed texture or not, so we can avoid doing flushes when
we do a hw rendering from one to the other.

it also renames flushed to dirty_db which tracks if the DB copy
has been dirtied by being bound to the hw.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-03 14:17:05 +10:00
Dave Airlie
d0293290ad r600g: set correct pitch/offset for depth textures in flushed state.
This fixes zreaddraw in tiling mode
2011-02-03 14:12:32 +10:00
Brian Paul
4629be0509 softpipe: rename sampler[] -> fragment_samplers[] 2011-02-02 20:43:56 -07:00
Brian Paul
843f206a34 softpipe: rename fragment sampler/view fields
To be consistant with vertex, geometry sampler fields.
2011-02-02 20:30:56 -07:00
Brian Paul
c06fa98c86 cso: refactor texture sampler and sampler view code
This consolidates the code duplicated between the fragment sampler
and vertex sampler functions.  Plus, it'll make adding support for
geometry shader samplers trivial.
2011-02-02 20:28:00 -07:00
Brian Paul
5f30e0b231 cso: rename fragment sampler-related fields
To better distinguish from vertex sampler fields.
2011-02-02 18:14:48 -07:00
Brian Paul
d087cfaabf cso: fix loop bound in cso_set_vertex_samplers()
Before we were looping to nr_samplers, which is the number of fragment
samplers, not vertex samplers.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-02 18:11:30 -07:00
Chad Versace
fd1252ab67 glcpp: Raise error when modulus is zero
For example, this now raises an error:
   #define XXX 1 / 0

Fixes bug: https://bugs.freedesktop.org//show_bug.cgi?id=33507
Fixes Piglit test: spec/glsl-1.10/preprocessor/modulus-by-zero.vert

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-02 10:19:51 -08:00
Chad Versace
e7c1f058d1 glsl: Avoid division-by-zero during constant-folding
Avoid division-by-zero when constant-folding the following expression
types:
    ir_unop_rsq
    ir_binop_div
    ir_binop_mod

Fixes bugs:
https://bugs.freedesktop.org//show_bug.cgi?id=33306
https://bugs.freedesktop.org//show_bug.cgi?id=33508

Fixes Piglit tests:
glslparsertest/glsl2/div-by-zero-01.frag
glslparsertest/glsl2/div-by-zero-02.frag
glslparsertest/glsl2/div-by-zero-03.frag
glslparsertest/glsl2/modulus-zero-01.frag
glslparsertest/glsl2/modulus-zero-02.frag

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-02 09:55:35 -08:00
Chad Versace
b3cf92aa91 glsl: Fix constant-folding for reciprocal expressions
Do not constant-fold a reciprocal if any component of the reciprocated
expression is 0. For example, do not constant-fold `1 / vec4(0, 1, 2, 3)`.

Incorrect, previous behavior
----------------------------
Reciprocals were constant-folded even when some component of the
reciprocated expression was 0. The incorrectly applied arithmetic was:
   1 / 0 := 0
For example,
   1 / vec4(0, 1, 2, 3) = vec4(0, 1, 1/2, 1/3)

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-02 09:54:52 -08:00
José Fonseca
50278c0901 svga: Flush upload buffers or we get asserts
Based on work from Jakob Bornecrantz, Michel Dänzer, and Brian Paul.
2011-02-02 11:28:41 +00:00
Kenneth Graunke
dfdb9fda82 glsl: Fix use of uninitialized values in _mesa_glsl_parse_state ctor.
This has probably existed since e5e34ab18e or so.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-01 23:53:39 -08:00
Kenneth Graunke
cfd8d45ccd glsl: Fix invalid use of ralloc_asprintf in prototype_string.
This was my mistake when converting from talloc to ralloc.  I was
confused because the other calls in the function are to asprintf_append
and the original code used str as the context rather than NULL.

Fixes bug #33823.
2011-02-01 23:31:35 -08:00
Christian König
8ca3b140eb r600g: use burst exports in shaders
Join multiple exports into just one instruction
instead of exporting each register separately.
2011-02-02 01:33:03 +01:00
Alex Deucher
8503cffc4c r200: remove 0x4243 pci id
There's no such device.  0x4243 is a pci bridge id,
not a GPU.

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2011-02-01 19:13:54 -05:00
Ian Romanick
a04582739e i915: Only mark a register as available if all components are written
Previously a register would be marked as available if any component
was written.  This caused shaders such as this:

  0: TEX TEMP[0].xyz, INPUT[14].xyyy, texture[0], 2D;
  1: MUL TEMP[1], UNIFORM[0], TEMP[0].xxxx;
  2: MAD TEMP[2], UNIFORM[1], TEMP[0].yyyy, TEMP[1];
  3: MAD TEMP[1], UNIFORM[2], TEMP[0].zzzz, TEMP[2];
  4: ADD TEMP[0].xyz, TEMP[1].xyzx, UNIFORM[3].xyzx;
  5: TEX TEMP[1].w, INPUT[14].xyyy, texture[0], 2D;
  6: MOV TEMP[0].w, TEMP[1].wwww;
  7: MOV OUTPUT[2], TEMP[0];
  8: END

to produce incorrect code such as this:

  BEGIN
  DCL S[0]
  DCL T_TEX0
  R[0] = MOV T_TEX0.xyyy
  U[0] = TEXLD S[0],R[0]
  R[0].xyz = MOV U[0]
  R[1] = MUL CONST[0], R[0].xxxx
  R[2] = MAD CONST[1], R[0].yyyy, R[1]
  R[1] = MAD CONST[2], R[0].zzzz, R[2]
  R[0].xyz = ADD R[1].xyzx, CONST[3].xyzx
  R[0] = MOV T_TEX0.xyyy
  U[0] = TEXLD S[0],R[0]
  R[1].w = MOV U[0]
  R[0].w = MOV R[1].wwww
  oC = MOV R[0]
  END

Note that T_TEX0 is copied to R[0], but the xyz components of R[0] are
still expected to hold a calculated value.

Fixes piglit tests draw-elements-vs-inputs, fp-kill, and
glsl-fs-color-matrix.  It also fixes Meego bugzilla #13005.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-02-01 13:43:36 -08:00
Ian Romanick
20d278a7ff mesa: glGetUniform only returns a single element of an array
Also return it as the correct type.  Previously the whole array would
be returned and each element would be expanded to a vec4.

Fixes piglit test getuniform-01 and bugzilla #29823.
2011-02-01 09:48:41 -08:00
José Fonseca
3c701f1d61 glsl: Fix printf_length() on MSVC. 2011-02-01 10:41:46 +00:00
Kenneth Graunke
a7d350790b glsl: Fix memory error when creating the supported version string.
Passing ralloc_vasprintf_append a 0-byte allocation doesn't work.  If
passed a non-NULL argument, ralloc calls strlen to find the end of the
string.  Since there's no terminating '\0', it runs off the end.

Fixes a crash introduced in 14880a510a.
2011-02-01 00:20:01 -08:00
Dave Airlie
11bc8991e9 r600g: just change tile type when buffer is set to depth.
Not 100% sure on this one, but this is how it should work,
the question is whether it will uncover other bugs elsewhere.
2011-02-01 14:38:45 +10:00
Dave Airlie
a112cc283d r600g: align the tiling modes with what the DDX and kernel expects.
If we see a MACRO bit on r600g its 2D tiled,
if don't see a MACRO bit and we do see a MICRO bit then its 1D tiled.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-02-01 14:23:35 +10:00
Dave Airlie
8b5a50b31c r600g: fix evergreen for depth decompress test 2011-02-01 13:06:35 +10:00
Dave Airlie
aee5f1e40c r600: only decompress depth when its tile type is wrong.
If the tile type for the buffer is 1 then its been bound to the
DB at some point, we need to decompress it, otherwise its only
been bound as texture/cb so don't do anything.

This fixes 5 piglit tests here on r600g.
2011-02-01 13:02:56 +10:00
Kenneth Graunke
3ef397dafc texture_builtins.py: Fix a warning about mixed tabs/spaces. 2011-01-31 16:41:34 -08:00
Dave Airlie
42b5f68198 r600g: start looking at evergreen tiling.
this just adds the ioctl interface and sets the tile type
and array mode in the correct place.

This seems to bring eg 1D tiling to the same level, and issues
as on r600. No idea how to address 2D yet.
2011-02-01 10:36:57 +10:00
Henri Verbeet
d171ae086b r600g: Actually use the info from the flushed depth texture when creating a sampler view on a depth texture.
R600/R700 was using incorrect tiling information from the (compressed) depth
buffer. Evergreen worked anyway because tiling doesn't work.
2011-02-01 01:19:16 +01:00
Ian Romanick
5e19b5ad16 glsl: Refresh autogenerated lexer and parser files.
For the previous commit.
2011-01-31 15:32:56 -08:00
Ian Romanick
14880a510a glsl: Reject shader versions not supported by the implementation
Previously we'd happily compile GLSL 1.30 shaders on any driver.  We'd
also happily compile GLSL 1.10 and 1.20 shaders in an ES2 context.
This has been a long standing FINISHME in the compiler.

NOTE: This is a candidate for the 7.9 and 7.10 branches
2011-01-31 15:32:56 -08:00
Ian Romanick
e5e34ab18e glsl: Ensure that all GLSL versions are supported in the stand-alone compiler
NOTE: This is a candidate for the 7.9 and 7.10 branches
2011-01-31 15:32:56 -08:00
Ian Romanick
bf9850db22 glsl: Fix dependencies / linkage for glsl_compiler 2011-01-31 15:32:55 -08:00
Ian Romanick
09e15ac76a mesa: Initial size for secondary color array is 3
See table 6.7 on page 347 of the OpenGL 3.0 specification.
2011-01-31 15:32:55 -08:00
Christian König
7fb722c35c r600g: fix invalid ref count handling in r600_set_constant_buffer
Only decrement ref count if r600_upload_const_buffer
really changes the buffer.
2011-01-31 23:38:10 +01:00
Brian Paul
a8c144a388 llvmpipe: fix incorrect array index in image dump code 2011-01-31 14:09:24 -07:00
Brian Paul
a1f5c46d24 glsl: regerated files 2011-01-31 14:09:24 -07:00
Brian Paul
aacd07d623 glsl: make _token_list_is_empty_ignoring_space() static
To silence warning about missing prototype.
2011-01-31 14:09:24 -07:00
Brian Paul
3b8c7d70b3 scons/glsl: add top-level 'include' dir to CPPPATH
To avoid using the /usr/include/GL/gl.h file which may be lacking
some special #defines.
2011-01-31 14:09:24 -07:00
Brian Paul
59c957b688 glsl: add cast to silence signed/unsigned comparison warning 2011-01-31 14:09:24 -07:00
José Fonseca
3ae7aa3403 glsl: Define va_copy on MSVC. 2011-01-31 20:53:03 +00:00
Kenneth Graunke
0f7325b890 i965: Emit texel offsets in sampler messages. 2011-01-31 11:10:59 -08:00
Kenneth Graunke
ca418cbde6 glsl/builtins: Uncomment prototypes for texture*Offset functions. 2011-01-31 11:10:59 -08:00
Kenneth Graunke
ba3de801ec texture_builtins.py: Generate texture*Offset functions. 2011-01-31 11:10:59 -08:00
Kenneth Graunke
4c63f2de2f texture_builtins.py: Generalize the "use_proj" field to support offsets.
Rather than passing "True", pass a bitfield describing the particular
variant's features - either projection or offset.

This should make the code a bit more readable ("Proj" instead of "True")
and make it easier to support offsets in the future.
2011-01-31 11:10:59 -08:00
Kenneth Graunke
99f36486eb texture_builtins.py: Refactor coordinate dimension calculations.
For offsets, we'll want the straight sampler dimensionality, without the
+1 for array types.  Create a new function to do that; refactor.
2011-01-31 11:10:59 -08:00
Kenneth Graunke
819d57fce9 glsl: Introduce a new "const_in" variable mode.
This annotation is for an "in" function parameter for which it is only legal
to pass constant expressions.  The only known example of this, currently,
is the textureOffset functions.

This should never be used for globals.
2011-01-31 11:10:59 -08:00
Kenneth Graunke
c5a27b5939 glsl: Change texel offsets to a single vector rvalue.
Having these as actual integer values makes it difficult to implement
the texture*Offset built-in functions, since the offset is actually a
function parameter (which doesn't have a constant value).

The original rationale was that some hardware needs these offset baked
into the instruction opcode.  However, at least i965 should be able to
support non-constant offsets.  Others should be able to rely on inlining
and constant propagation.
2011-01-31 11:10:59 -08:00
Kenneth Graunke
60c8e91c79 glsl: Re-synchronize ir_variable_mode and the printer's string array.
Since the introduction of ir_var_system_value, system variables would be
printed as "temporary" and temporaries would result in out-of-bounds
array access, showing up as garbage in printed IR.
2011-01-31 11:04:37 -08:00
Vinson Lee
8c115aa247 scons: Gracefully handle pkg-config errors with libdrm_radeon.
Print warnings and continue build.
2011-01-31 10:50:06 -08:00
Kenneth Graunke
1568b19e3b Remove the talloc sources from the Mesa repository. 2011-01-31 10:17:10 -08:00
Kenneth Graunke
8aac5d123c Remove talloc from the SCons build system. 2011-01-31 10:17:10 -08:00
Kenneth Graunke
d1d8120545 Remove talloc from the make and automake build systems. 2011-01-31 10:17:09 -08:00
Kenneth Graunke
42fd9c2ebb ralloc: a new MIT-licensed recursive memory allocator. 2011-01-31 10:17:09 -08:00
Kenneth Graunke
d3073f58c1 Convert everything from the talloc API to the ralloc API. 2011-01-31 10:17:09 -08:00
Kenneth Graunke
dc55254f5b ralloc: Add a fake implementation of ralloc based on talloc. 2011-01-31 10:17:09 -08:00
Henri Verbeet
7d9e0ea739 glx: Properly check for a valid fd in dri2CreateScreen().
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-31 10:54:04 -07:00
Michel Dänzer
5a1ce49c82 svga: Fix translation of TGSI SSG opcode.
SVGA3D only supports SGN for vertex shaders, and this requires two additional
temporary registers for intermediate results.

For fragment shaders, lower to two CMPs and one ADD.
2011-01-31 17:47:57 +01:00
Michel Dänzer
11c11ee0bc svga: TEXLDL opcode dst/src register information is correct. 2011-01-31 17:47:14 +01:00
Michel Dänzer
a61b7aa90d svga: Print the number and mnemonic of the opcode we're missing information for.
Makes it easier to figure out which opcode it's about.
2011-01-31 17:45:07 +01:00
Henri Verbeet
0b47d59e5b glx: Fix leaks in DRISW screen creation error paths.
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-31 09:31:24 -07:00
Henri Verbeet
0e8e8ba29a glx: Fix leaks in DRI screen creation error paths.
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-31 09:31:21 -07:00
Henri Verbeet
bfc889517a glx: Fix leaks in DRI2 screen creation error paths.
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-31 09:29:54 -07:00
Julien Cristau
cbe9fc12a6 glx: fix length of GLXGetFBConfigsSGIX
The extra length is the size of the request *minus* the size of the
VendorPrivate header, not the addition.

NOTE: This is a candidate for the 7.9 and 7.10 branches

Signed-off-by: Julien Cristau <jcristau@debian.org>
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-31 09:28:55 -07:00
Julien Cristau
e27913f805 glx: fix GLXChangeDrawableAttributesSGIX request
xGLXChangeDrawableAttributesSGIXReq follows the GLXVendorPrivate header
with a drawable, number of attributes, and list of (type, value)
attribute pairs.  Don't forget to put the number of attributes in there.
I don't think this can ever have worked.

NOTE: This is a candidate for the 7.9 and 7.10 branches

Signed-off-by: Julien Cristau <jcristau@debian.org>
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-31 09:28:37 -07:00
Dave Airlie
ea5ede2178 r600g: fix eg OQ properly.
the context init is separate for these gpus.
2011-01-31 20:44:47 +10:00
Alex Deucher
26a4c1cb65 r600g: fix OQ on evergreen
6xx/7xx have a max of 4 DBs, evergreen have a max of 8.

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2011-01-31 02:49:27 -05:00
Dave Airlie
df8089df90 r600g: fix occlusion query results.
Like on some r5xx, there are multiple DB backends on the r600,
we need to add up the query results from each of these to get the
final correct value.

So far I'm not 100% sure how to calculate the num_db, value
setting it to 4 should be harmless enough until we do.

This fixes occulsion_query piglit test on my rv740.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-01-31 16:14:03 +10:00
Alex Deucher
2f7c876ff5 r600g: remove some non-existent evergreen reg fields
Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2011-01-30 22:41:59 -05:00
Dave Airlie
065c8696e7 r600g: fix regression in cubemap tests since eea1d8199b
Although CUBE is a reduction inst, it writes to more than just PV.X
so we need to keep the dst channel.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-01-31 13:06:17 +10:00
Dave Airlie
5555cd776b r600g: handle the write all cbufs property.
This only works on r600/r700 so far, evergreen doesn't appear
to have the multiwrite enable bit in the color control, so we
may have to actually do a shader rewrite on EG hardware.

remove some duplicate code reg defines also.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-01-31 10:01:06 +10:00
Henri Verbeet
f668b464c0 util: Call tables should be const. 2011-01-30 18:59:13 +01:00
Henri Verbeet
38b54158b6 r600g: Update the flushed depth texture after drawing to the corresponding texture.
I know Jerome will probably rewrite the way depth textures work sometime
soon. For the time being this should at least make common depth texture usage
for shadowing work properly though.
2011-01-30 18:59:13 +01:00
Chia-I Wu
3f0a966807 st/vega: Disable blending when the paint is opaque.
When the paint is opaque (currently, solid color with alpha 1.0f), no
blending is needed for VG_BLEND_SRC_OVER.  This eliminates the serious
performance hit introduced by 859106f196
for a common scenario.
2011-01-30 23:22:40 +08:00
Chia-I Wu
e919dee1ed st/vega: Remove an invalid sanity check.
Before create_handle returns, obj->handle is 0.  Calling
handle_to_object will fail.
2011-01-30 23:22:40 +08:00
Chia-I Wu
05e5b53128 st/vega: s/vg[A-Z]/vega[A-Z]/. 2011-01-30 23:22:40 +08:00
José Fonseca
11b15c4d25 scons: We have C++ in several libraries, so always link with the C++ compiler
Prevents missing symbols in libGL.so when LLVM is disabled.
2011-01-30 11:19:44 +00:00
Vinson Lee
cad0520179 r600g: Fix void pointer arithmetic.
Fixes SCons build.
2011-01-30 01:08:54 -08:00
Dave Airlie
71f610e26e r600g: fixes a segfault in the piglit fbo-genmipmap-formats test.
should be no need to unset this ptr here and if we don't end up using the
blitter we've just broken the state.
2011-01-30 18:09:25 +10:00
Tom Stellard
8f32c6cfc6 r300/compiler: Standardize the number of bits used by swizzle fields
Swizzles are now defined everywhere as a field with 12 bits that contains
4 channels worth of meaningful information.  Any channel that is unused is
set to RC_SWIZZLE_UNUSED.  This change is necessary because rgb instructions
and alpha instructions were initializing channels that would never be used
(channel 3 for rgb and channels 1-3 for alpha) with 0 (aka RC_SWIZZLE_X).
This made it impossible to use generic helper functions for swizzles,
because sometimes a channel value of 0 meant unused and other times it
meant RC_SWIZZLE_X.

All hacks that tried to guess how many channels were relevant have
also been removed.
2011-01-29 21:32:02 -08:00
Marek Olšák
debc45bca0 r300g: upload translated indices via the uploader 2011-01-30 03:29:49 +01:00
Marek Olšák
8d0a540020 r300g: rework vertex format fallback
1) Only translate the [min_index, max_index] range.
2) Upload translated vertices via the uploader.
3) Rename valid_vertex_buffer[] to real_vertex_buffer[]
2011-01-30 03:29:48 +01:00
Marek Olšák
77900843b4 r600g: upload translated indices via the uploader 2011-01-30 03:29:48 +01:00
Marek Olšák
73a40d1383 r600g: rework vertex format fallback
1) Only translate the [min_index, max_index] range.
2) Upload translated vertices via the uploader.
2011-01-30 03:29:48 +01:00
Marek Olšák
70e656b4eb r600g: fix vertex format fallback
This fixes:
- piglit/draw-vertices
- piglit/draw-vertices-half-float
2011-01-30 03:29:48 +01:00
Marek Olšák
8c631cfeae r600g: rework vertex buffer uploads
Only upload the [min_index, max_index] range instead of [0, userbuf_size].
This an important optimization.

Framerate in Lightsmark:
Before: 22 fps
After: 75 fps

The same optimization is already in r300g.
2011-01-30 03:29:48 +01:00
Marek Olšák
15730a8207 r600g: consolidate set_constant_buffer functions 2011-01-30 03:29:48 +01:00
Marek Olšák
73fb2b7c90 r600g: consolidate vertex_buffer_update functions 2011-01-30 03:29:48 +01:00
Marek Olšák
2d7738eb2b r600g: consolidate draw_vbo functions (v2)
Added a conditional to spi_update per Dave's comment.
2011-01-30 03:29:48 +01:00
Marek Olšák
5cefe1eddd r600g: make r600_drawl inherit pipe_draw_info 2011-01-30 03:29:48 +01:00
Marek Olšák
02f8f13464 r600g: add back u_upload_mgr integration
I can't see a performance difference with this code, which means all
the driver-specific code removed in this commit was unnecessary.

Now we use u_upload_mgr in a slightly different way than we did before it got
dropped. I am not restoring the original code "as is" due to latest
u_upload_mgr changes that r300g performance benefits from.

This also fixes:
- piglit/fp-kil
2011-01-30 03:29:48 +01:00
Christoph Bumiller
f8a7a0b6f3 nvc0: implement transform feedback state 2011-01-30 01:25:41 +01:00
Christoph Bumiller
7fd29468ec nvc0: enable PIPE_CAP_ARRAY_TEXTURES and fix them 2011-01-29 23:57:52 +01:00
Chia-I Wu
218381d927 egl_dri2: Export glapi symbols for DRI drivers.
When an app loads libEGL.so dynamically with RTLD_LOCAL, loading DRI
drivers would fail because of missing glapi symbols.  This commit makes
egl_dri2 load libglapi.so with RTLD_GLOBAL to export glapi symbols for
future symbol resolutions.

The same trick can be found in GLX.  However, egl_dri2 can only do so
when --enable-shared-glapi is given.  Because, otherwise, both libGL.so
and libglapi.so define glapi symbols and egl_dri2 cannot tell which
library to load.
2011-01-30 05:28:24 +08:00
Chia-I Wu
f36cba6cf3 egl: Make the transition to built-in drivers more smooth.
When the user sets EGL_DRIVER to egl_dri2 (or egl_glx), make sure the
built-in driver is used.  The user might leave the outdated egl_dri2.so
(or egl_glx.so) on the filesystem and we do not want to load it.
2011-01-30 04:55:08 +08:00
Chia-I Wu
b825e49552 mapi: Workaround a bug in makedepend.
makedepend would crash when a source includes a header indirectly, such
as

  #define HEADER "some-header.h"
  #include HEADER

Do not define HEADER (makedepend would detects this as an incomplete
include) and add the dependency manually in the Makefile.

This should hopefully fix bug #33374.
2011-01-29 19:22:54 +08:00
Marek Olšák
2a456dc123 u_blitter: use user buffers instead of real buffers
User buffers may be the fastest way to upload data.
2011-01-29 05:17:43 +01:00
Brian Paul
c5fb0518f4 gallium/docs: add info about transfer boxes and array textures 2011-01-28 20:25:27 -07:00
Brian Paul
f9a36a496f gallium: added comments to pipe_transfer 2011-01-28 20:25:27 -07:00
Brian Paul
1dd8e27578 st/mesa: fix texture array dimensions
For 1D/2D texture arrays use the pipe_resource::array_size field.
In OpenGL 1D arrays texture use the height dimension as the array
size and 2D array textures use the depth dimension as the array size.
Gallium uses a special array_size field instead.  When setting up
gallium textures or comparing Mesa textures to gallium textures we
need to be extra careful that we're comparing the right fields.

The new st_gl_texture_dims_to_pipe_dims() function maps OpenGL
texture dimensions to gallium texture dimensions and simplifies
this quite a bit.
2011-01-28 20:25:27 -07:00
Brian Paul
80777743b7 softpipe: fix array textures to use resource array_size
Don't use height for 1D array textures or depth for 2D array textures.
2011-01-28 20:25:27 -07:00
Brian Paul
b3cfcdf923 mesa: fix typo, wrap long line 2011-01-28 20:25:26 -07:00
Brian Paul
db3a8af7f9 st/mesa: pass layers param to st_texture_create() 2011-01-28 20:25:26 -07:00
Carl Worth
2a18d1950c Revert "glcpp: Demote "macro redefined" from an error to a warning"
This reverts commit d3df641f0a.

The original commit had sat unpushed on my machine for months. By the
time I found it again, I had forgotten that we had decided not to use
this change after all, (the relevant test was removed long ago).
2011-01-29 08:21:05 +10:00
Jakob Bornecrantz
3451ee056c util: Fix leak of transfers in upload manager 2011-01-28 22:10:53 +01:00
Brian Paul
e89fc33d7a docs: removed VC8 project files 2011-01-28 13:40:47 -07:00
Brian Paul
f247175e4a mesa: omit VC8 project files from tarball 2011-01-28 13:40:47 -07:00
Thierry Vignaud
d3d6beec96 Fix missing files in Mesa tarballs.
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
2011-01-28 12:31:04 -08:00
Chad Versace
c494763579 mesa: Fix available APIs for AMD_conservative_depth
Remove ES2, since AMD_conservative_depth is not listed in the OpenGL ES
extension registry.
2011-01-28 11:19:51 -08:00
Marek Olšák
c6ace30028 r300/compiler: print stats based on the initial number of instructions
The same number of shaders is now printed regardless of optimizations being
enabled or not, so that we can compare shader stats side by side easily.
2011-01-28 19:37:31 +01:00
Marek Olšák
0029979eee r300g: fix resource_copy_region for DXT SRGB formats 2011-01-28 17:15:22 +01:00
Carl Worth
d3df641f0a glcpp: Demote "macro redefined" from an error to a warning
The GLSL specification is vague here, (just says "as is standard for
C++"), though the C specifications seem quite clear that this should
be an error.

However, an existing piglit test (CorrectPreprocess11.frag) expects
this to be a warning, not an error, so we change this, and document in
README the deviation from the specification.
2011-01-28 15:16:36 +10:00
Dave Airlie
476db2bd3d dri: add a placeholder for the framebuffer sRGB capable bit.
This is needed to build the X server GLX_EXT_framebuffer_sRGB bits.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-01-28 11:45:44 +10:00
Dimitry Andric
cfb9aae3ec glapi: add @GOTPCREL relocation type
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=33440
This replaces commit 731ec60da3

NOTE: This is a candidate for the 7.9 and 7.10 branches

Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-27 18:04:57 -07:00
Marek Olšák
6dc0a0e71f r600g: handle PIPE_CAP_ARRAY_TEXTURES 2011-01-28 01:58:30 +01:00
Marek Olšák
588c925224 r300g: handle PIPE_CAP_ARRAY_TEXTURES 2011-01-28 01:56:57 +01:00
Marek Olšák
baf2a795eb r300g: 8x8-compressed zbuffer can only be point-sampled 2011-01-28 01:16:27 +01:00
Marek Olšák
2050f2ab96 r300g: fix and re-enable 8x8 zbuffer compression mode
Also cleanup the whole thing.
2011-01-28 01:04:51 +01:00
Marek Olšák
82e60236a9 r300g: print driver info if RADEON_DEBUG=info 2011-01-27 23:17:41 +01:00
Marek Olšák
39f16e2aa7 r300g: add winsys flag CAN_AACOMPRESS 2011-01-27 23:13:28 +01:00
Marek Olšák
2e3ccada07 r300g: rename flag squaretiling -> drm_2_1_0 2011-01-27 23:06:15 +01:00
Marek Olšák
e0b98cde41 docs: update GL3 status 2011-01-27 21:17:25 +01:00
Marek Olšák
387fe8dd47 util: fix parsing debug options
So that 'foo' can be found in: OPTION=prefixfoosuffix,foo

Also allow that debug options can be separated by a non-alphanumeric characters
instead of just commas.
2011-01-27 20:32:03 +01:00
Marek Olšák
db299a9f82 r300g: fix some bugs with zbuffer compression (v4)
This drops the memblock manager for ZMASK. Instead, only one zbuffer can be
compressed at a time. Note that this does not necessarily have to be slower.
When there is a large number of zbuffers, compression might be used more often
than it was before. It's also easier to debug.

How it works:
1) 'clear' turns the compression on.
2) If some other zbuffer is set or the currently-bound zbuffer is used
   for texturing, the driver decompresses it and then turns the compression off.

Notes:
- The ZMASK clear has been refactored, so that only one packet3 is used to clear
  ZMASK.
- The 8x8 compression mode is disabled. I couldn't make it work without issues.
- Also removed driver-specific stuff from u_blitter.

Driver status:
- RV530 and R580 appear to just work (finally).
- RV570 should work, but there may be an issue that we don't correctly
  calculate the number of dwords to clear, resulting in a partially
  uninitialized zbuffer.
- RS690 misrenders as if no ZMASK clear happened. No idea what's going on.
- RV350 may even hardlock. This issue was already present and this patch doesn't
  fix it.

I think we are still missing some hardware info we need to make the zbuffer
compression work fully.

Note that there is also an issue with HiZ, resulting in a sort of blocky
zigzagged corruption around some objects.
2011-01-27 18:12:01 +01:00
Brian Paul
7a4345fd83 glsl: use 'this' pointer to be consistent 2011-01-26 21:16:41 -07:00
Brian Paul
2b7be12d54 glsl: remove needless conditional 2011-01-26 21:16:32 -07:00
Brian Paul
86471246f0 glsl: move ir_var_out code 2011-01-26 21:16:14 -07:00
Brian Paul
7baa498ae4 glsl: move ir_var_system_value code 2011-01-26 21:15:52 -07:00
Brian Paul
304b239869 glsl: use local var to simplify code a bit 2011-01-26 21:15:39 -07:00
Zack Rusin
59dbdbbb7d mesa: fix compilation
this isn't c++ please don't mix declerations with code
2011-01-26 21:20:53 -05:00
Chad Versace
67c67ee80f glsl: Refresh autogenerated lexer file
For previous commit.
2011-01-26 16:37:45 -08:00
Chad Versace
cc4a787044 glsl: Remove extraneously extraneous parens
I found this parenthetical usage of parentheses to be extraneously
extraneous:
   (yyextra->ARB_fragment_coord_conventions_enable)
2011-01-26 16:37:45 -08:00
Chad Versace
ad3dc370d8 mesa: Allow extensions in MESA_EXTENSION_OVERRIDE to be prefixed with '+'
If an extension is prefixed with '+', attempt to enable it.  This
introduces symmetry with the prefix '-', which is already allowed.
2011-01-26 16:37:45 -08:00
Chad Versace
7cbcf4c583 mesa: Simplify logic in get_extension_override()
* Reduce max indentation level from 7 to 3.
* Eliminate counter variables.
* Remove function append().
2011-01-26 16:37:45 -08:00
Chad Versace
8ba260e099 glsl: Enable AMD_conservative_depth in parser
All the necessary compiler infrastructure for AMD_conservative_depth is in
place, so it's safe to enable it in the parser.
2011-01-26 16:37:45 -08:00
Chad Versace
a1b83464ff mesa: Propagate gl_FragDepth layout from GLSL IR to Mesa IR 2011-01-26 16:37:45 -08:00
Chad Versace
addae33d6b glsl: Raise linking error if gl_FragDepth layout is inconsistent
From the AMD_conservative_depth spec:
   If gl_FragDepth is redeclared in any fragment shader in a program, it
   must be redeclared in all fragment shaders in that program that have
   static assignments to gl_FragDepth. All redeclarations of gl_FragDepth in
   all fragment shaders in a single program must have the same set of
   qualifiers.
2011-01-26 16:37:45 -08:00
Chad Versace
bc04d244f5 glsl: Propagate depth layout qualifier from AST to IR 2011-01-26 16:37:44 -08:00
Chad Versace
5fc57f471b glsl: Define enum ir_depth_layout 2011-01-26 16:37:44 -08:00
Chad Versace
39cad66a88 glsl: Refresh autogenerated parser files
For commits titled:
glcpp: Conditionally define macro GL_AMD_conservative_depth
glsl: Add support for AMD_conservative_depth to parser
2011-01-26 16:37:44 -08:00
Chad Versace
fb5db0570c glsl: Add support for AMD_conservative_depth to parser
When AMD_conservative_depth is enabled:
* Let 'layout' be a token.
* Extend the production rule of layout_qualifier_id to process the tokens:
   depth_any
   depth_greater
   depth_less
   depth_unchanged
2011-01-26 16:37:44 -08:00
Chad Versace
565a22090c glsl: Add depth layout qualifiers to ast_type_qualifier 2011-01-26 16:37:44 -08:00
Chad Versace
0423f24eb8 glcpp: Conditionally define macro GL_AMD_conservative_depth
Define macro GL_AMD_conservative_depth to 1 when its extension is
enabled.
2011-01-26 16:37:44 -08:00
Chad Versace
1aeecaa433 mesa: Add AMD_conservative_depth to extension list
The extension is off by default.

First in a patchset that implements support for AMD_conservative_depth in
the compiler.
2011-01-26 16:37:44 -08:00
Brian Paul
8697dbdfbc tgsi: add cases for array textures
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=33555
2011-01-26 16:22:32 -07:00
Kristian Høgsberg
3fe0185ba5 mesa: Support internalFormat=GL_BGRA for DRI drivers 2011-01-26 15:05:46 -05:00
Kristian Høgsberg
e28ecdee03 st/egl: Downgrade warning to debug when we can't create a drm screen
We try to load a DRI driver if this fails so don't confuse users.
2011-01-26 10:47:03 -05:00
Brian Paul
684c66bb8b mesa: fix MESA/EXT typo
Spotted by Bernd Buschinski.
2011-01-26 08:01:31 -07:00
Marek Olšák
c7c733545a util: require debug options to be separated by commas
Let's assume there are two options with names such that one is a substring
of another. Previously, if we only specified the longer one as a debug option,
the shorter one would be considered specified as well (because of strstr).
This commit fixes it by checking that each option is surrounded by commas.

(a regexp would be nicer, but this is not a performance critical code)
2011-01-26 10:48:21 +01:00
Zack Rusin
0657fc00dd gallium: add an interface for query predicates
as specified in the arb_occlusion_query2. just the interface.
2011-01-26 00:03:12 -05:00
Brian Paul
779e9cb658 softpipe: support for 1D/2D texture arrays 2011-01-25 20:27:10 -07:00
Brian Paul
9b56a2cb62 st/mesa: support for 1D/2D texture arrays 2011-01-25 20:26:22 -07:00
Brian Paul
c0d941877b tgsi: add support for 1D/2D texture arrays 2011-01-25 20:25:53 -07:00
Tormod Volden
903185bf3b configure.ac: define LIBDRM_INTEL_REQUIRED
To have the LIBDRM* requirements in one place

Signed-off-by: Tormod Volden <debian.tormod@gmail.com>
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-25 18:53:00 -07:00
Brian Paul
0bfd174fb5 mesa: remove isProxy local var 2011-01-25 18:53:00 -07:00
Brian Paul
365f658602 mesa: use texFormat local var in more places 2011-01-25 18:53:00 -07:00
Brian Paul
f322400970 mesa: consolidate error handling code in _mesa_GetTexLevelParameteriv() 2011-01-25 18:53:00 -07:00
Brian Paul
0f6b8e29ab mesa: consolidate error handling in set_tex_parameteri() 2011-01-25 18:53:00 -07:00
Brian Paul
f2dd11817a mesa: add checks for GL_EXT_texture_array
In case the driver enables GL_MESA_texture_array but not the EXT version.
2011-01-25 18:53:00 -07:00
Ian Romanick
0f4b2a0a23 linker: Propagate max_array_access while linking functions
Update the max_array_access of a global as functions that use that
global are pulled into the linked shader.

Fixes piglit test glsl-fs-implicit-array-size-01 and bugzilla #33219.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-25 13:41:26 -08:00
Ian Romanick
c87e9ef4d2 linker: Set sizes for non-global arrays as well
Previously only global arrays with implicit sizes would be patched.
This causes all arrays that are actually accessed to be sized.

Fixes piglit test glsl-fs-implicit-array-size-02.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-25 13:41:26 -08:00
Ian Romanick
5c2cec8337 ir_to_mesa: Add several assertions about sizes of arrays
Both of these assertions are triggered by the test case in bugzilla
size of 0.
2011-01-25 13:41:26 -08:00
Brian Paul
9f2bf3d65c glsl: silence uninitialized var warning in read_texture()
And generate an error if the texture pattern is not matched.
2011-01-25 13:11:47 -07:00
Mathias Fröhlich
90c2fd8640 r600g: Implement timer queries. 2011-01-25 14:18:19 -05:00
Mathias Fröhlich
e7ec532735 r600g: Implement asyncronous query results. 2011-01-25 14:18:19 -05:00
Mathias Fröhlich
b55fd961e1 r600g: Fix meaning of num_results for queries. 2011-01-25 14:18:19 -05:00
Tim Wiederhake
4102c7c7e2 fix potential leak in r600_context_init 2011-01-25 14:18:19 -05:00
Tim Wiederhake
9d41e5ee46 silences some valgrind warnings
==5547== Conditional jump or move depends on uninitialised value(s)
==5547==    at 0x8FE745D: r600_drm_winsys_create (r600_drm.c:86)
2011-01-25 14:18:19 -05:00
Brian Paul
ba0953da5b Revert "glapi: adding missing @GOTPCREL qualifer in glapi_x86-64.S"
This reverts commit 731ec60da3.

This change causes crashes in the x86-64 dispatch code.
2011-01-25 12:12:34 -07:00
Brian Paul
40ac24e631 softpipe: fix off-by-one error in setup_fragcoord_coeff()
If we invert Y, need to subtract one from the surface height.

Fixes https://bugs.freedesktop.org/show_bug.cgi?id=26795
for softpipe.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-25 11:58:15 -07:00
Brian Paul
23490d7a8b st/mesa: add comments in emit_wpos() 2011-01-25 11:57:10 -07:00
Brian Paul
bb56631f0c st/mesa: fix incorrect fragcoord.x translation
emit_adjusted_wpos() needs separate x,y translation values.  If we
invert Y, we don't want to effect X.

Part of the fix for http://bugs.freedesktop.org/show_bug.cgi?id=26795

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-25 11:54:07 -07:00
Dimitry Andric
37bffe8d12 glapi: adding @ char before type specifier in glapi_x86.S
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=33433
NOTE: This is a candidate for the 7.9 and 7.10 branches.

Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-25 09:23:46 -07:00
Dimitry Andric
731ec60da3 glapi: adding missing @GOTPCREL qualifer in glapi_x86-64.S
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=33440
NOTE: This is a candidate for the 7.9 and 7.10 branches

Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-25 09:22:14 -07:00
Roland Scheidegger
7acb98c67c svga: link libwsw for dri-vmwgfx target with make build system too 2011-01-25 16:32:32 +01:00
Marek Olšák
02d7d9ec36 u_blitter: remove bogus assertion
The module uses the 3D engine, so it can blit non-compatible formats.
2011-01-25 05:51:49 +01:00
Marek Olšák
9a3523e38b u_blitter: report recursion, update comments 2011-01-25 05:51:49 +01:00
Vinson Lee
db4f6c7eeb nvc0: Move declaration before code.
Fixes nvc0 SCons build.
2011-01-24 20:04:31 -08:00
Zack Rusin
3fa814d7f8 gallium/tgsi: update the docs for the new opcodes a bit 2011-01-24 21:46:03 -05:00
Brian Paul
d30156525f mesa: add red, red/green formats in _mesa_base_fbo_format() 2011-01-24 19:38:52 -07:00
Brian Paul
62c66b3430 mesa: plug in fallback function for ctx->Driver.ValidateFramebuffer()
The software renderer doesn't support GL_ALPHA, GL_LUMINANCE, etc
so we should report GL_FRAMEBUFFER_UNSUPPORTED during FBO validation.
2011-01-24 19:38:52 -07:00
Brian Paul
976ea9d76b mesa: new cases in _mesa_base_fbo_format()
The set of internalFormat parameters accepted by glRenderBufferStorage
depends on the EXT vs. ARB version of framebuffer_object.  The later
added support for GL_ALPHA, GL_LUMINANCE, etc. formats.  Note that
these formats might be legal but might not be supported.  That should
be checked with glCheckFramebufferStatus().
2011-01-24 19:38:52 -07:00
Brian Paul
f41bbc7c44 Revert "mesa: Simplify _mesa_base_fbo_format by making it exceptions to teximages."
This reverts commit 65c41d55a0.

There really are quite a few differences in the set of internal
formats allowed by glTexImage and glRenderbufferStorage.
2011-01-24 19:38:52 -07:00
Vinson Lee
e24f1ea594 scons: Add nvc0 to SConscript. 2011-01-24 17:48:24 -08:00
Brian Paul
99c67f27d3 vega: implement handler/pointer conversion using a hash table
Before, we were just casting between 32-bit VGHandles and 64-bit pointers.
2011-01-24 18:12:49 -07:00
Brian Paul
f3e6edc70b vega: remove redundant functions found elsewhere 2011-01-24 18:12:49 -07:00
Brian Paul
d41e694cf7 vega: replace casts with pointer/handle conversion functions
Per the spec, all OpenVG handles are 32-bit.  We can't just cast them
to/from integers on 64-bit systems.

Start fixing that mess by introducing a set of handle/pointer conversion
functions in handle.h.  The next step is to implement a handle/pointer
hash table...
2011-01-24 18:12:49 -07:00
Julien Cristau
4324d6fdfb glx: fix request lengths
We were sending too long requests for GLXChangeDrawableAttributes,
GLXGetDrawableAttributes, GLXDestroyPixmap and GLXDestroyWindow.

NOTE: This is a candidate for the 7.9 and 7.10 branches

Signed-off-by: Julien Cristau <jcristau@debian.org>
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-24 18:10:38 -07:00
Jakob Bornecrantz
c523f31f4a svga: Add more swrast debuging 2011-01-25 01:00:07 +01:00
Jakob Bornecrantz
daaf542220 svga: Use get once helpers for context debug envs 2011-01-25 00:58:46 +01:00
Jakob Bornecrantz
becb733dbc rbug: Fix surface reference leak 2011-01-25 00:58:46 +01:00
Jakob Bornecrantz
4fabdf72ea glsl: Fix mingw crosscompile 2011-01-25 00:58:46 +01:00
Henri Verbeet
1af59b28b5 r600g: FLT_TO_INT* are vector instructions on Evergreen.
FLT_TO_INT is a vector instruction, despite what the (current) documentation
says. FLT_TO_INT_FLOOR and FLT_TO_INT_RPI aren't explicitly mentioned in the
documentation, but those are vector instructions too.
2011-01-25 00:35:34 +01:00
Zack Rusin
3d9138781d graw: add a test showing the new sampling scheme in action 2011-01-24 17:53:29 -05:00
Zack Rusin
bdbe77f9c6 gallium: implement modern sampling scheme
largely a merge of the previously discussed origin/gallium-resource-sampling
but updated.
the idea is to allow arbitrary binding of resources, the way opencl, new gl
versions and dx10+ require, i.e.
    DCL RES[0], 2D, FLOAT

    LOAD DST[0], SRC[0], RES[0]
    SAMPLE DST[0], SRC[0], RES[0], SAMP[0]
2011-01-24 17:47:10 -05:00
Benjamin Franzke
b066983780 st/mesa: Enable EXT_texture_format_BGRA8888 for gles1/2 2011-01-24 16:41:29 -05:00
Benjamin Franzke
c5c1dc8b3f st/mesa: support internalFormat=GL_BGRA in TexImage2D 2011-01-24 16:41:29 -05:00
Benjamin Franzke
8bfbcba2b7 mesa/es: require internalFormat==format in TexImage2D 2011-01-24 16:41:29 -05:00
Benjamin Franzke
f1452844fe mesa: allow internalFormat=GL_BGRA_EXT in TexImage2D 2011-01-24 16:41:29 -05:00
Dimitry Andric
811ee32a9e mesa: s/movzxw/movzwl/ in read_rgba_span_x86.S
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=33386
NOTE: This is a candidate for the 7.9 and 7.10 branches

Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-24 14:37:52 -07:00
Dimitry Andric
3fda80246f mesa: s/movzx/movzbl/
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=33388
NOTE: This is a candidate for the 7.9 and 7.10 branches.

Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-24 14:34:28 -07:00
Kenneth Graunke
e0c4a59dc6 glsl: Remove long unused 'configure.ac' file.
This was from way back when glsl2 lived in its own repository.
2011-01-24 10:33:38 -08:00
José Fonseca
92badb4c8c draw: Do not use LLVM's opaque types.
Contrary what the name may suggest, LLVM's opaque types are used for
recursive types -- types whose definition refers itself -- so opaque
types correspond to pre-declaring a structure in C. E.g.:

   struct node;

   struct link {
      ....
      struct node *next;
   };

   struct node {
      struct link link;
   }

Void pointers are also disallowed by LLVM. So the suggested way of creating
what's commonly referred as "opaque pointers" is using byte pointer (i.e.,
uint8_t * ).
2011-01-24 17:27:14 +00:00
Tim Wiederhake
d14764815c add machine generated files to .gitignore
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-24 09:17:57 -07:00
Tim Wiederhake
c48dd8049c secure malloc in translate_cache_create
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-24 09:17:54 -07:00
Christopher James Halse Rogers
7d6abd254a osmesa: mklib requires arguments before objects
Fixes the build when selecting driver=osmesa and building static libraries.
Otherwise, mklib tries to add the ‘-ltalloc’ object to the archive, which
obviously fails.

Clients which statically link to osmesa will need to link to libtalloc also,
as specified in the Libs.private of osmesa.pc.

Fixes: https://bugs.freedesktop.org/show_bug.cgi?id=33360

NOTE: This is a candidate for the 7.10 branch.

Signed-off-by: Christopher James Halse Rogers <christopher.halse.rogers@canonical.com>
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-24 07:53:24 -07:00
Michel Dänzer
be0665b461 st/xorg: Fix build failure against xserver with XF86_CRTC_VERSION < 3.
Reported by Vinson Lee.
2011-01-24 15:48:13 +01:00
Marek Olšák
db234176b1 r300g: remove unused function 2011-01-24 13:37:23 +01:00
Marek Olšák
09109c11d9 r300g: remove any traces of depth_clamp
I couldn't make it work.

GB_TILE_CONFIG.Z_EXTENDED, which enables per-pixel Z clamping, and
VAP_CLIP_CNTL.CLIP_DISABLE, which disables clipping, do help, but they
also add regressions like random graphics corruptions in some games.
2011-01-24 13:32:52 +01:00
Marek Olšák
d78a984baa r300g: handle PIPE_CAP_INSTANCED_DRAWING in get_param 2011-01-24 11:40:26 +01:00
Andre Maasikas
92767e9052 r600c: only colors can be flat shaded
fixes stellarium text and menu display
2011-01-24 10:23:19 +02:00
Jakob Bornecrantz
b7d2919e8e util: Add function logger helpers 2011-01-24 03:37:57 +01:00
Jakob Bornecrantz
a82408c353 Revert "r300g/swtcl: re-enable LLVM"
This reverts commit 88550083b3.
2011-01-24 03:26:59 +01:00
Jakob Bornecrantz
4c73030d47 draw: Init llvm if not provided 2011-01-24 03:26:59 +01:00
Jakob Bornecrantz
832029e1c1 i915g: Remove draw_flushes and state that we don't need to track 2011-01-24 03:26:59 +01:00
Jakob Bornecrantz
9a9630dcf0 i915g: Improve constant handling 2011-01-24 03:26:59 +01:00
Tom Stellard
c40ec20c27 r300g: Increase fragment shader limits for r400 cards
r400 fragment shaders now support up to 64 temporary registers,
512 ALU instructions, and 512 TEX instructions.
2011-01-23 17:47:48 -08:00
Brian Paul
1bf3c75825 gldirect: remove _NEW_ACCUM 2011-01-23 14:06:21 -07:00
Brian Paul
c78b48d808 i965: remove _NEW_ACCUM 2011-01-23 14:06:21 -07:00
Christoph Bumiller
a287a758c6 nvc0: implement point coord replacement
But we have to cheat and peek at the GENERIC semantic indices the
state tracker uses for TEXn.
Only outputs from 0x300 to 0x37c can be replaced, and so we have to
know on shader compilation which ones to put there in order to keep
doing separate shader objects properly.

At some point I'll probably create a patch that makes gallium not
force us to discard the information about what is a TexCoord.
2011-01-23 21:35:27 +01:00
Marek Olšák
f154cd2315 mesa: add ARB_framebuffer_sRGB as alias of the EXT variant
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-23 20:59:46 +01:00
Marek Olšák
81ae8c6313 mesa: return GL_LINEAR for ..COLOR_ENCODING if framebuffer_sRGB is unsupported
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-23 20:59:46 +01:00
Brian Paul
2dac3f995b vega: sort filenames in Makefile, SConscript 2011-01-23 10:15:07 -07:00
Brian Paul
fb7efb1b19 mesa: get rid of _NEW_ACCUM, clean-up _NEW_* #defines
The _NEW_ACCUM flag was only set when changing the accumulation
buffer clear color and never used anywhere.  Reclaim that dirty bit.
Clean up the definitions of the other dirty bit flags.
2011-01-23 09:50:52 -07:00
Brian Paul
f4dc24a0b5 mesa: smarter glTexParameter state invalidation
Only a few texture object parameters can effect texture completeness:
min level, max level, minification filter.  Don't mark the texture
incomplete for other texture object state changes.
2011-01-23 09:50:52 -07:00
Marek Olšák
91eba2567e r300g: support sRGB colorbuffers
We are not required to do the linear->sRGB conversion if ARB_framebuffer_sRGB
is unsupported. However I think the conversion should work in hw except
for blending, which matches the D3D9 behavior.
2011-01-23 13:32:56 +01:00
Marek Olšák
ffcdd49c69 r300/compiler: remove any code related to relative addressing of temporaries
The hw can't do it and the code was useless anyway (it's lowered
in the GLSL compiler).
2011-01-23 13:32:56 +01:00
Christoph Bumiller
835c4ea105 nvc0: fix emit_cvt for ceil, floor and trunc 2011-01-23 13:09:10 +01:00
Christoph Bumiller
95eef7a705 nvc0: remove bad assert and emit TEMP movs instead 2011-01-23 13:07:30 +01:00
Christoph Bumiller
f9bb1c8b33 nvc0: fix address and value slot assignment in load combining 2011-01-23 13:05:44 +01:00
Christoph Bumiller
005d186d66 nvc0: don't omit highest bit of branch target
Fixes negative relative branch offsets.
2011-01-23 13:03:20 +01:00
Christoph Bumiller
419ff10b0e nvc0: recognize r63 as zero in constant folding 2011-01-23 13:03:15 +01:00
Christoph Bumiller
bf1df06773 nvc0: add MARK_RING where missing to avoid too many relocs errors 2011-01-23 13:03:10 +01:00
Christoph Bumiller
49f16c96f1 nvc0: don't apply base vertex to per-instance arrays 2011-01-23 13:03:00 +01:00
Christoph Bumiller
c18aa3c73f nvc0: commute sources of SET too if beneficial 2011-01-23 13:01:33 +01:00
Christoph Bumiller
8e572998fc nvc0: accept neg abs modifiers on lg2 2011-01-23 13:01:22 +01:00
Ian Romanick
2db46fe5f0 glsl: Don't assert when the value returned by a function has no rvalue
The rvalue of the returned value can be NULL if the shader says
'return foo();' and foo() is a function that returns void.

Existing GLSL specs do *NOT* say that this is an error.  The type of
the return value is void.  If the return type of the function is also
void, then this should compile without error.  I expect that future
versions of the GLSL spec will fix this (wink, wink, nudge, nudge).

Fixes piglit test glsl-1.10/compiler/expressions/return-01.vert and
bugzilla #33308.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-22 18:04:40 -08:00
Brian Paul
9d380f487a st/mesa: ensure that all pixel paths operation on linear RGB data, not sRGB
Before, we were converting between linear/sRGB in glReadPixels,
glDrawPixels, glAccum, etc if the renderbuffer was an sRGB texture.
Those all need to operate on pixel values as-is without conversion.

Also, when setting up render-to-texture, if the texture is sRGB the
pipe_surface view must be linear RGB.  This will change when we
support GL_ARB_framebuffer_sRGB.

This fixes http://bugs.freedesktop.org/show_bug.cgi?id=33353
2011-01-22 18:33:35 -07:00
Brian Paul
4c9ad084c1 softpipe: pass surface format to get/put_tile functions
When we read/write image tiles we need to use the format specified
in the pipe_surface, not the pipe_transfer format (which comes from
the underlying texture/resource format).

This comes up when rendering to sRGB surfaces (via OpenGL render to
texture).  Ignoring the new GL_ARB/EXT_framebuffer_sRGB extension
for now, when we render to a sRGB surface we need to treat it like
a regular, linear colorspace RGB surface.  Before, when we read/wrote
tiles to sRGB surfaces we were inadvertantly doing the color space
conversion.
2011-01-22 18:33:35 -07:00
Brian Paul
e75844b4e0 gallium/util: added pipe_put_tile_rgba_format() 2011-01-22 18:33:35 -07:00
Brian Paul
3ce1ec853b gallium/util: simplify pipe_get_tile_rgba()
Implement it in terms of pipe_get_tile_rgba_format()
2011-01-22 18:33:35 -07:00
Brian Paul
90671fcdda gallium/softpipe: replace pipe_get_tile_swizzle()
The new function, pipe_get_tile_rgba_format(), no longer takes a
swizzle (we weren't actually using it anywhere).  Rename it to
indicate that the format is passed explicitly.
2011-01-22 18:33:35 -07:00
Brian Paul
4e2c077879 softpipe: use proper type for format field 2011-01-22 18:33:35 -07:00
Brian Paul
11fbdf726d gallium/util: added util_format_linear() 2011-01-22 18:33:35 -07:00
Brian Paul
4c251b8861 st/mesa: update comment, use st_fb_orientation() 2011-01-22 18:33:35 -07:00
Brian Paul
bd67962c5e st/mesa: comments in update_viewport() 2011-01-22 18:33:35 -07:00
Chia-I Wu
bb770af3a5 scons: Add support for GLES.
GLES can be enabled by running scons with

  $ scons gles=yes

When gles=yes is given, the build is changed in three ways.  First,
libmesa.a will be built with FEATURE_ES1 and FEATURE_ES2.  This makes
DRI drivers and libEGL support and advertise GLES support.  Second, GLES
libraries will be created.  They are libGLESv1_CM, libGLESv2, and
libglapi.  Last, libGL or opengl32 will link to libglapi.  This change
is required as _glapi_* will be declared as __declspec(dllimport) in
libmesa.a on windows.  libmesa.a expects those symbols to be defined in
another DLL.  Due to this change to GL, GLES support is marked
experimental.

Note that GLES requires libxml2-python to generate some of its sources.
2011-01-22 11:59:05 +08:00
Chia-I Wu
3f04314ae2 mapi: ENTRY_CURRENT_TABLE_GET should be stringified.
So that it can be renamed to _glapi_get_dispatch.
2011-01-22 11:58:38 +08:00
Kenneth Graunke
0db3161036 glcpp: Regenerate parser files. 2011-01-21 15:41:19 -08:00
Kenneth Graunke
6ecee54a9a glcpp: Remove use of talloc reference counting.
We almost always want to simply steal; we only need to copy when copying
a token list (in which case we're already cloning stuff anyway).
2011-01-21 15:41:19 -08:00
Kenneth Graunke
e256e4743c glsl, i965: Remove unnecessary talloc includes.
These are already picked up by ir.h or glsl_types.h.
2011-01-21 15:41:19 -08:00
Kenneth Graunke
819f92deaa ra: Use the same context when realloc'ing arrays.
The original allocations use regs->regs as the context, so talloc will
happily ignore the context given here.  Change it to match to clarify
that it isn't changing.
2011-01-21 15:39:57 -08:00
Chad Versace
b66be7518a glsl: Improve error message when read-only vars are written
Improves the cases when:
* an explicit assignment references the read-only variable
* an 'out' or 'inout' function parameter references the read-only variable
2011-01-21 14:06:28 -08:00
Chad Versace
01a584d093 glsl: Mark 'in' variables at global scope as read-only
Fixes Piglit tests:
spec/glsl-1.30/compiler/storage-qualifiers/static-write-centroid-in-01.frag
spec/glsl-1.30/compiler/storage-qualifiers/static-write-in-01.frag
spec/glsl-1.30/compiler/storage-qualifiers/static-write-in-02.frag
2011-01-21 14:06:28 -08:00
Chad Versace
f633b993b0 glsl: Remove unused class ast_declaration_statment 2011-01-21 14:06:25 -08:00
Jakob Bornecrantz
8af583f6e8 i915g: Don't (un)map vbuf on each (un)map call 2011-01-21 20:53:29 +01:00
Jakob Bornecrantz
0c3352b6df i915g: Don't do unnecessary copies of constants
Even tho st/mesa use user buffers for constants align buffers
other state trackers doesn't use user buffers.
2011-01-21 20:53:29 +01:00
Jakob Bornecrantz
2e60aa511d i915g: Don't emit FS constants when VS contants change 2011-01-21 20:53:29 +01:00
Jakob Bornecrantz
7287964f94 i915g: Use slab allocator for transfers
Also remove unused i915_transfer struct
2011-01-21 20:53:29 +01:00
Jakob Bornecrantz
484edfc815 st/dri: Fix warning 2011-01-21 20:53:29 +01:00
Christian König
a40305dcdb r600g: check if hardware blits are possible bevore enabling tilling 2011-01-21 19:47:24 +01:00
Alex Deucher
4b3789427f r600g: FLT_TO_INT_FLOOR is trans instruction
Add missing evergreen FLT_TO_INT_FLOOR instruction.
2011-01-21 12:41:23 -05:00
Dave Airlie
a637280e42 mesa: EXT_framebuffer_sRGB interface additions.
This adds the get/enable enums and internal gl_config storage
for this extension.

In theory this is all that is needed to enable this extension
from what I can see, since its not mandatory to implement the
features if you don't advertise the visuals or the fb configs.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-01-21 19:56:13 +10:00
Andre Maasikas
634e889bb5 r600c: get OQ results only for 4 DBs on r600 class
- since evergreen addition which increased this to 8 depth backends
  other bytes may contain garbage values
2011-01-21 11:48:03 +02:00
Brian Paul
af4e2f4665 docs: update README.WIN32 per Karl's request 2011-01-20 18:52:53 -07:00
Ian Romanick
2fb0aebd4a intel: Fix typeos from 3d028024 and 790ff232
...and remove egg from face.
2011-01-20 13:51:07 -08:00
Ian Romanick
790ff232e2 i915: Set correct values for range/precision of fragment shader types 2011-01-20 13:35:59 -08:00
Ian Romanick
3d028024e5 i965: Set correct values for range/precision of fragment shader types 2011-01-20 13:35:59 -08:00
Ian Romanick
04dca296e0 mesa: Set correct values for range/precision of shader integer types 2011-01-20 13:35:59 -08:00
Ian Romanick
dde3270c19 mesa: Connect glGetShaderPrecisionFormat into the dispatch table 2011-01-20 13:35:59 -08:00
Brian Paul
37233f1ee0 softpipe: check for null pointers during context create/destroy
See http://bugs.freedesktop.org/show_bug.cgi?id=32309
Apparently, malloc() is failing during context creation.  Not
checking for nulls here led to crashes elsewhere.
2011-01-20 13:46:57 -07:00
Brian Paul
4ef955a12a graw: fix logic error in pixel format selection
The loop to choose a pixel format for the window was incrementing
'i' after we succeeded in creating the window so if we chose format[0]
for graw_create_window_and_screen() we were putting format[1] in
the pipe_resource template for creating the render target.

This only worked because of the order of the elements in the formats[]
array.

The graw_xlib.c code now properly compares the requested gallium pixel
format against the visual's color layout.

Update all the graw demos to fix the off-by-one-i error.
2011-01-20 13:37:26 -07:00
Ian Romanick
22eeb1b331 Fix the build from 887d2b64
Thanks to all the include frobbing, GLuint is not known in some places
that included enums.h.
2011-01-20 11:30:14 -08:00
Brian Paul
887d2b647b mesa: clean-up _mesa_lookup_prim_by_nr()
Remove the redundant public _mesa_prim_name[] array.
2011-01-20 09:44:33 -07:00
Brian Paul
fe49dcb3b0 mesa: move extra prim mode #defines 2011-01-20 09:44:33 -07:00
Brian Paul
b62e78c783 vbo: added comment 2011-01-20 09:44:33 -07:00
Brian Paul
cfae745a8b mesa: minor formatting fixes 2011-01-20 09:10:03 -07:00
Brian Paul
7330f8b2bc st/mesa: clean up the sampler view format code 2011-01-20 08:56:36 -07:00
Brian Paul
751fe9058b mesa: document sRGBDecode field 2011-01-20 08:56:36 -07:00
Brian Paul
f579a05a9f st/mesa: formatting, whitespace fixes 2011-01-20 08:56:32 -07:00
Andre Maasikas
c20778e76f r600c: bump sq gpr resources if a shader needs more than default
ideally this should be set once in the beginning of CS but there's
no way to change values there while in the middle of rendering.
For now reemitting SQ setup seems to work probably due to
r700WaitForIdleClean after each render

currently does not to try to decrease values once increased

fixes hangs in glsl-vs-vec4-indexing-temp-src-in-nested-loop-combined
glsl-vs-vec4-indexing-temp-dst-in-nested-loop-combined for my rv740
maybe more for other chips
2011-01-20 13:11:56 +02:00
Chia-I Wu
e8c7d7598f glapi: Fix OpenGL and OpenGL ES interop.
When --enable-shared-glapi is specified, libGL will share libglapi with
OpenGL ES instead of defining its own copy of glapi.  This makes sure an
app will get only one copy of glapi in its address space.

The new option is disabled by default.  When enabled, libGL and libglapi
must be built from the same source tree and distributed together.  This
requirement comes from the fact that the dispatch offsets used by these
libraries are re-assigned whenever GLAPI XMLs are changed.

For GLX, indirect rendering for has_different_protocol() functions is
tricky.  A has_different_protocol() function is assigned only one
dispatch offset, yet each entry point needs a different protocol opcode.
It cannot be supported by the shared glapi.  The fix to this is to make
glXGetProcAddress handle such functions specially before calling
_glapi_get_proc_address.

Note that these files are automatically generated/re-generated

 src/glx/indirect.c
 src/glx/indirect.h
 src/mapi/glapi/glapi_mapi_tmp.h
2011-01-20 17:15:50 +08:00
Chia-I Wu
9767d3b5ad glapi: Fix OpenGL ES 1.1 and 2.0 interop.
Move _glapi_* symbols from libGLESv1_CM.so and libGLESv2.so to
libglapi.so.  This makes sure an app will get only one copy of glapi in
its address space.

Note that with this change, libGLES* and libglapi must be built from the
same source tree and distributed together.  This requirement comes from
the fact that the dispatch offsets used by these libraries are
re-assigned whenever GLAPI XMLs are changed.
2011-01-20 17:15:50 +08:00
Chia-I Wu
97185bf265 mapi: Add support for bridge mode.
In bridge mode, mapi no longer implements glapi.h.  It becomes a user of
glapi.h.  Imagine an app that uses both libGL.so and libGLESv2.so.
There will be two copies of glapi in the app's memory.  It is possible
that _glapi_get_dispatch does not return what _glapi_set_dispatch set,
if they access different copies of the global variables.  The solution
to this situation to build either one of the libraries as a bridge to
the other.  Or build both libraries as bridges to another shared
glapi library.
2011-01-20 17:15:50 +08:00
Chia-I Wu
96c52d16c1 mapi: u_current_table may be renamed.
When MAPI_MODE_GLAPI is defined, u_current_table is renamed to
_glapi_Dispatch or _glapi_tls_Dispatch.  The ASM dispatchers should not
use hardcoded name.
2011-01-20 17:15:50 +08:00
Chia-I Wu
6fc152f660 mapi: Add a new glapi.h implementation.
The new implementation is based on mapi.  No new script is needed.  As
noted in sources.mk, the way to use it is to compile MAPI_GLAPI_SOURCES
with MAPI_MODE_GLAPI defined.
2011-01-20 17:15:50 +08:00
Chia-I Wu
23a89f1872 mapi: Fix glapi printers for gl_and_es_API.xml.
Fix GLAPIPrinter, ES1APIPrinter, and ES2APIPrinter to output files that
are ready for compilation.  Since gl_and_es_API.xml is based on
gl_API.xml, the hidden and handcode attributes of entries have to be
overridden for ES1APIPrinter and ES2APIPrinter.
2011-01-20 17:15:50 +08:00
Chia-I Wu
7828f554ab mapi: Allow prefix to be macro.
Treat prefix as macro when it is all uppercase.  Generate PREFIX(name)
instead of PREFIXname when it is a macro.
2011-01-20 17:15:49 +08:00
Chia-I Wu
f71a9acf59 mapi: Add the ability to parse GLAPI XML.
A prerequisite if we want to convert vgapi.csv to vgapi.xml, or to use
mapi for glapi.
2011-01-20 17:15:49 +08:00
Chia-I Wu
323b5e323a glapi: Add gl_and_es_API.xml.
gl_and_es_API.xml defines OpenGL ES 1.1 and 2.0 API as well as OpenGL
API.  It consists of gl_API.xml and the newly added es_EXT.xml,
ARB_get_program_binary.xml, OES_single_precision.xml, and
OES_fixed_point.xml.
2011-01-20 17:15:49 +08:00
Kenneth Graunke
4fafde6a8c doxygen: Add glsl to the Makefile and .gitignore. 2011-01-19 23:49:54 -08:00
twied
aec19381ec Add machine generated files to .gitignore 2011-01-19 23:48:47 -08:00
Kenneth Graunke
21031b4e88 glsl: Don't bother unsetting a destructor that was never set.
This was totally copied and pasted from glsl_symbol_table.
2011-01-19 23:40:33 -08:00
Chia-I Wu
c116a0e2dc autoconf: Fail when --with-state-trackers is incomplete.
When --enable-openvg or --enable-gallium-egl is enabled,
--with-state-trackers must have vega or egl.
2011-01-20 15:04:34 +08:00
Henri Verbeet
21148e6a88 softpipe: Bind samplers to views instead of the underlying resource.
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-19 21:47:27 -07:00
Henri Verbeet
54fdc351dd softpipe: Get rid of the redundant resource parameter to get_sampler_variant().
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-19 21:47:27 -07:00
Dave Airlie
8c68362d7c r200: fix up some problems with TFP on r200 2011-01-20 14:35:09 +10:00
Brian Paul
7e86d9bd8c llvmpipe: implement TGSI_PROPERTY_FS_COLOR0_WRITES_ALL_CBUFS
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=33284
2011-01-19 18:46:59 -07:00
Eric Anholt
b41d323c90 i965/fs: Take the shared mathbox into account in instruction scheduling.
I don't have evidence for this amounting to any improvement,
but it does codify a bit more what we understand so far about
the pipeline.
2011-01-19 16:30:00 -08:00
Eric Anholt
382c2d99da i965/fs: Add a helper function for detecting math opcodes. 2011-01-19 16:29:14 -08:00
Eric Anholt
1991d92207 i965/fs: Assign URB/CURB register numbers after instruction scheduling.
This fixes a bunch of unnecessary barriers due to the scheduler not
knowing what that arbitrary register description refers to when trying
to reason about its dependencies.

The result is rescheduling in the convolution kernel shader in
Lightsmark, which results in avoiding register spilling and increasing
the performance of the first scene from 6-7 fps midway through the
panning to 11fps.  The register spilling was a regression from Mesa
7.9 to Mesa 7.10.
2011-01-19 16:29:14 -08:00
Eric Anholt
63879d90ac i965/fs: Add an instruction scheduler.
Improves performance of my GLSL demo by 5.1% (+/- 1.4%, n=7).  It also
reschedules the giant multiply tree at the end of
glsl-fs-convolution-1 so that we end up not spilling registers,
producing the expected level of performance.
2011-01-19 16:29:11 -08:00
Eric Anholt
3f2fe31eee i965/fs: Add a helper for detecting texturing opcodes. 2011-01-19 16:29:10 -08:00
Christian König
a124490262 r600g: fix segfault if texture operand is a literal
This fixes Bug 33262
2011-01-19 23:48:02 +01:00
Brian Paul
3ee60a3558 mesa: implement glGetShaderPrecisionFormat()
Drivers should override the default range/precision info as needed.
No drivers do this yet.
2011-01-19 07:41:55 -07:00
Brian Paul
34613c66ac gallium/docs: document result type for some types of queries 2011-01-19 07:41:55 -07:00
Dave Airlie
a5da4acb95 radeon: avoid segfault on 3D textures.
This is a candidate for 7.9 and 7.10
2011-01-19 16:27:13 +10:00
Dave Airlie
4832403c38 radeon: oops didn't need this logbase2 fn 2011-01-19 16:17:03 +10:00
Dave Airlie
c6fb88fc5a radeon: calculate complete texture state inside TFP function
(really not sure why I'm doing this).

This is a candidate for 7.9 and 7.10 branches.
2011-01-19 16:11:29 +10:00
Ben Skeggs
c73a1c18b2 dri/nouveau: allow multiple maps of surface buffers
Can happen during swrast fallbacks if a buffer is somehow bound as
a render target and a texture.

Fixes gnome-shell on nv20, and gets it mostly working on nv10.

Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-01-19 15:51:57 +10:00
Dave Airlie
f7bab47e6c radeon/r200: fix fbo-clearmipmap + gen-teximage
sw clears were being used and not getting the correct offsets in the span
code.

also not emitting correct offsets for CB draws to texture levels.

(I've no idea why I'm playing with r100).

This is a candidate for 7.9 and 7.10
2011-01-19 12:55:04 +10:00
Eric Anholt
568e008365 i965: Fix a comment typo. 2011-01-18 16:30:59 -08:00
Eric Anholt
8ce425f3e3 i965: Fix a bug in i965 compute-to-MRF.
Fixes piglit glsl-fs-texture2d-branching.  I couldn't come up with a
testcase that didn't involve dead code, but it's still worthwhile to
fix I think.
2011-01-18 16:30:59 -08:00
Christian König
ba700d2ead r600g: fix reserve_cfile for R700+
According to R700 ISA we have only two channels for cfile constants.
This patch makes piglit tests "glsl1-constant array with constant
indexing" happy on RV710.
2011-01-19 00:40:28 +01:00
Chad Versace
46f7105df4 glsl: Fix segfault due to missing printf argument
Fixes the following Piglit tests:
glslparsertest/shaders/array2.frag
glslparsertest/shaders/dataType6.frag

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-18 15:23:18 -08:00
Chad Versace
45e8e6c6b1 glsl: Fix semantic checks on precision qualifiers
The check for
   Precision qualifiers only apply to floating point and integer types.
was incomplete. It rejected only type 'bool' and structures.
2011-01-18 14:43:49 -08:00
Brian Paul
42dbc2530b llvmpipe: make sure binning is active when we begin/end a query
This fixes a potential failure when a begin/end_query is the first
thing to happen after flushing the scene.

NOTE: This is a candidate for the 7.10 and 7.9 branches.
2011-01-18 14:02:01 -07:00
Brian Paul
fb7a8dedfa softpipe: rename some functions for consistency 2011-01-18 14:02:01 -07:00
Henri Verbeet
9e964baaf3 r600g: Kill trailing whitespace. 2011-01-18 20:57:04 +01:00
Henri Verbeet
7e2e8d09f7 r600g: Remove the unused eg_states_inc.h and r600_states_inc.h. 2011-01-18 20:57:04 +01:00
Henri Verbeet
495dec0a2b r600g: Simplify some r600_bc_add_alu_type() calls to r600_bc_add_alu(). 2011-01-18 20:57:04 +01:00
Brian Paul
90ff6178a2 vbo: initialize num_instances in a few places
This fixes https://bugs.freedesktop.org/show_bug.cgi?id=33247
There might still be some issues with drawing multiple instances
with VBO splitting to investigate someday.
2011-01-18 12:18:32 -07:00
Eric Anholt
d5a53ad271 ra: Take advantage of the adjacency list in finding a node to spill.
This revealed a bug in ra_get_spill_benefit where we only considered
the benefit of the first adjacency we were to remove, explaining some
of the ugly spilling I've seen in shaders.  Because of the reduced
spilling, it reduces the runtime of glsl-fs-convolution-1 36.9% +/-
0.9% (n=5).
2011-01-18 10:17:50 -08:00
Eric Anholt
ea8e21856e ra: Remove unused "name" field in regs. 2011-01-18 10:17:48 -08:00
Eric Anholt
604022abed ra: Take advantage of the adjacency list in ra_select() too.
Reduces runtime of glsl-fs-convolution-1 another 13.9% +/- 0.6% (n=5).
2011-01-18 10:17:44 -08:00
Eric Anholt
7cf648da63 ra: Add an adjacency list to trade space for time in ra_simplify().
This was recommended in the original paper, but I figued "make it run"
before "make it fast".  Now we make it fast.  Reduces the runtime of
glsl-fs-convolution-1 by 12.7% +/- 0.6% (n=5).
2011-01-18 10:17:40 -08:00
Eric Anholt
58c988ada5 glsl: Skip the rest of loop unrolling if no loops were found.
Shaves 1.6% (+/- 1.0%) off of ff_fragment_shader glean texCombine time
(n=5).
2011-01-18 10:17:37 -08:00
Eric Anholt
754b9c5363 ra: Trade off some space to get time efficiency in ra_set_finalize().
Our use of the register allocator in i965 is somewhat unusual.
Whereas most architectures would have a smaller set of registers with
fewer register classes and reuse that across compilation, we have 1,
2, and 4-register classes (usually) and a variable number up to 128
registers per compile depending on how many setup parameters and push
constants are present.  As a result, when compiling large numbers of
programs (as with glean texCombine going through ff_fragment_shader),
we spent much of our CPU time in computing the q[] array.  By keeping
a separate list of what the conflicts are for a particular reg, we
reduce glean texCombine time 17.0% +/- 2.3% (n=5).

We don't expect this optimization to be useful for 915, which will
have a constant register set, but it would be useful if we were switch
to this register allocator for Mesa IR.
2011-01-18 10:17:34 -08:00
Brian Paul
5b58b8c579 softpipe: added some null pointer checks
This shouldn't really be needed but it may help with
http://bugs.freedesktop.org/show_bug.cgi?id=32309
2011-01-18 09:59:28 -07:00
Brian Paul
c97e4532bb softpipe: s/tex_cache/fragment_tex_cache/
Just to be more consistant with the vertex and geometry tex cache fields.
2011-01-18 09:59:28 -07:00
José Fonseca
843f537cfb Remove executables from source tree. 2011-01-18 15:25:30 +00:00
Andre Maasikas
4ef3e261a4 r600c: preserve correct buffer when using fbo
Hopefully better than previous - this passes more mipgen tests
2011-01-18 16:25:19 +02:00
Andre Maasikas
0a85845c9e r600: set border color as RGBA
border color is RGBA for samples - this passes texenv tests
2011-01-18 16:21:14 +02:00
Andre Maasikas
52fbff2130 r600c: use STATE_FB_WPOS_Y_TRANSFORM variable to do wpos transform
use introduced STATE_FB_WPOS_Y_TRANSFORM variable (thanks Marek)
this gets coords also right when using fbo
2011-01-18 16:21:13 +02:00
Eric Anholt
e4be665bbd i965: Fix dead pointers to fp->Parameters->ParameterValues[] after realloc.
Fixes texrect-many regression with ff_fragment_shader -- as we added
refs to the subsequent texcoord scaling paramters, the array got
realloced to a new address while our params[] still pointed at the old
location.
2011-01-17 16:27:55 -08:00
Brian Paul
96a2e89dde llvmpipe: enable PIPE_CAP_INDEP_BLEND_FUNC
The driver was saying that independend blend functions was not supported,
but it really was.  The driver was using the per-target independend blend
factors but the state tracker was only setting the 0th one (per the
Gallium spec).

Fixes a piglit fbo-drawbuffers2-blend regression.
See https://bugs.freedesktop.org/show_bug.cgi?id=33215
2011-01-17 16:51:13 -07:00
Brian Paul
afeebecd95 st/mesa: move PIPE_CAP_INDEP_BLEND_FUNC code 2011-01-17 16:51:12 -07:00
Chad Versace
774750a32f doxygen: Add doxyfile for glsl module 2011-01-17 13:52:40 -08:00
Chad Versace
a54e2de4bb glsl: Refresh autogenerated parser files 2011-01-17 10:20:47 -08:00
Chad Versace
a9bf8c12ee glsl: Remove redundant semantic check in parser
The removed semantic check also exists in ast_type_specifier::hir(), which
is a more natural location for it.

The check verified that precision statements are applied only to types
float and int.
2011-01-17 10:20:47 -08:00
Chad Versace
08a286c9cc glsl: Add support for default precision statements
* Add new field ast_type_specifier::is_precision_statement.
* Add semantic checks in ast_type_specifier::hir().
* Alter parser rules accordingly.
2011-01-17 10:20:47 -08:00
Chad Versace
889e1a5b6c glsl: Add semantic checks for precision qualifiers
* Check that precision qualifiers only appear in language versions 1.00,
  1.30, and later.
* Check that precision qualifiers do not apply to bools and structs.

Fixes the following Piglit tests:
* spec/glsl-1.30/precision-qualifiers/precision-bool-01.frag
* spec/glsl-1.30/precision-qualifiers/precision-struct-01.frag
* spec/glsl-1.30/precision-qualifiers/precision-struct-02.frag
2011-01-17 09:41:25 -08:00
Chad Versace
33279cd2d3 glsl: Fix parser rule for type_specifier
Do not assign a value to ast_type_specifier::precision when no precision
qualifier is present.
2011-01-17 09:41:25 -08:00
Chad Versace
aaa31bf8f4 glsl: Change default value of ast_type_specifier::precision
Change default value to ast_precision_none, which denotes the absence of
a precision of a qualifier.

Previously, the default value was ast_precision_high. This made it
impossible to detect if a precision qualifier was present or not.
2011-01-17 09:41:25 -08:00
Chad Versace
1eb0f17fa4 glsl: Check that 'centroid in' does not occur in vertex shader
The check is performed only in GLSL versions >= 1.30.

From section 4.3.4 of the GLSL 1.30 spec:
   "It is an error to use centroid in in a vertex shader."

Fixes Piglit test
spec/glsl-1.30/compiler/storage-qualifiers/vs-centroid-in-01.vert
2011-01-17 09:41:25 -08:00
Chad Versace
8faaa4a672 glsl: Check that interpolation quals only apply to vertex ins and fragment outs
The check is performed only in GLSL versions >= 1.30.

Fixes the following Piglit tests:
* spec/glsl-1.30/compiler/interpolation-qualifiers/fs-smooth-02.frag
* spec/glsl-1.30/compiler/interpolation-qualifiers/vs-smooth-01.vert
2011-01-17 09:41:25 -08:00
Chad Versace
605aacc67d glsl: Check that interpolation qualifiers do not precede 'varying'
... and 'centroid varying'. The check is performed only in GLSL
versions >= 1.30.

From page 29 (page 35 of the PDF) of the GLSL 1.30 spec:
   "interpolation qualifiers may only precede the qualifiers in, centroid
    in, out, or centroid out in a declaration. They do not apply to the
    deprecated storage qualifiers varying or centroid varying."

Fixes Piglit test
spec/glsl-1.30/compiler/interpolation-qualifiers/smooth-varying-01.frag.
2011-01-17 09:41:24 -08:00
Chad Versace
0e2f8936c8 glsl: Add method ast_type_qualifier::interpolation_string()
If an interpolation qualifier is present, then the method returns that
qualifier's string representation. For example, if the noperspective bit
is set, then it returns "noperspective".
2011-01-17 09:41:24 -08:00
Brian Paul
5a64626ee5 vbo: init num_instances in split_prims()
Fixes a VTK regression after adding GL_ARB_draw_instanced.
2011-01-17 09:56:58 -07:00
Brian Paul
6179f7e38e tnl: assert that num_instances > 0 2011-01-17 09:40:16 -07:00
Brian Paul
72f2551017 mesa: s/primcount/numInstances/
primcount is also a parameter to glMultiDrawElements().  Use numInstances
to avoid confusion between these things.
2011-01-17 09:33:49 -07:00
Dave Airlie
2bf52e7c28 nouveau: fix build against out of tree libdrm
For doing builds against a separated libdrm these cflags are needed.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-01-17 15:42:34 +10:00
Christian König
ef3b8042e0 r600g: fix PIPE_CAP_INSTANCED_DRAWING warning 2011-01-16 23:52:53 +01:00
Christian König
b61afe13f1 r600g: fix alu inst group merging for relative adressing 2011-01-16 21:43:17 +01:00
Christoph Bumiller
a4742c6a07 nvc0: fix and enable instanced drawing and arrays 2011-01-16 14:10:46 +01:00
Chia-I Wu
326332a130 d3d1x: Fix broken build.
st/egl native.h changed its interface in
a22a332fc7.
2011-01-16 20:58:17 +08:00
Brian Paul
d136d1d2e1 mesa: minor tweaks in _mesa_set_fetch_functions() 2011-01-15 20:41:26 -07:00
Brian Paul
aad7219f80 mesa: add comment for _mesa_get_srgb_format_linear() 2011-01-15 20:41:06 -07:00
Brian Paul
bfad484505 mesa: move declarations before code 2011-01-15 20:37:57 -07:00
Dave Airlie
608ccfe316 docs: add GL_EXT_texture_sRGB_decode to relnotes 2011-01-16 12:54:57 +10:00
Dave Airlie
527bf67682 gallium: add EXT_texture_sRGB_decode.
This uses a sampler view to access the texture with the alternate format.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-01-16 12:54:07 +10:00
Dave Airlie
9b1a15e1cb i965: add support for EXT_texture_sRGB_decode
We just choose the texture format depending on the srgb decode bit
for the sRGB formats.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-01-16 12:54:06 +10:00
Dave Airlie
edc2dd8e47 mesa/swrast: implement EXT_texture_sRGB_decode
This implements the extension by choosing a different set of texture
fetch functions when the texture parameter changes.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-01-16 12:54:06 +10:00
Christian König
ac6334145e r600d: fix some bugs added reworking literal handling
If a literal slot isn't used it should be set
to 0 instead of an uninitialized value. Also the
channels for pre R700 trig functions were incorrect.
And most important literals were not counted against ndw,
resulting in an invalid force_add_cf detection.
2011-01-16 03:30:25 +01:00
Brian Paul
3bee900a72 docs: document GL_ARB_draw_buffers_blend 2011-01-15 18:38:46 -07:00
Brian Paul
b3ca110594 mesa: implement glGet queries for GL_ARB_draw_buffers_blend 2011-01-15 18:35:45 -07:00
Brian Paul
44c2122a73 mesa: display list support for GL_ARB_draw_buffers_blend functions 2011-01-15 18:35:45 -07:00
Brian Paul
7f48278edc mesa: plug in GL_ARB_draw_buffers_blend functions 2011-01-15 18:35:45 -07:00
Brian Paul
561307844f glapi: regenerated files 2011-01-15 18:35:45 -07:00
Brian Paul
1cf6ff3046 glapi: new entrypoint specs for GL_ARB_draw_buffers_blend 2011-01-15 18:35:45 -07:00
Brian Paul
74713e2d29 mesa: begin implementation of GL_ARB_draw_buffers_blend 2011-01-15 18:35:39 -07:00
Brian Paul
3dab2b1795 docs: update GL3.txt status 2011-01-15 17:41:43 -07:00
Brian Paul
9473ca356f docs: document GL_ARB_instanced_arrays 2011-01-15 17:40:56 -07:00
Brian Paul
a6860f0913 st/mesa: GL_ARB_instanced_arrays support 2011-01-15 17:37:41 -07:00
Brian Paul
1d1eb95787 mesa: support for GL_ARB_instanced_arrays 2011-01-15 17:37:41 -07:00
Brian Paul
1250e2330b glapi: regenerated files 2011-01-15 17:37:41 -07:00
Brian Paul
caee0d024f glapi: GL_ARB_instanced_arrays support 2011-01-15 17:37:40 -07:00
Brian Paul
5700bc6bac draw: add missing LP_CHECK_MEMBER_OFFSET() 2011-01-15 17:37:40 -07:00
Brian Paul
d1e284407c st/mesa: move/consolidate an assignment 2011-01-15 17:37:40 -07:00
Brian Paul
889f44bc90 docs: document GL_ARB_draw_instanced 2011-01-15 17:37:40 -07:00
Henri Verbeet
a25473b535 r600g: Remove the redundant radeon_new() prototype. 2011-01-15 19:48:43 +01:00
Henri Verbeet
5a2abf7a85 r600g: Fix some register value name typos.
SFR -> SRF.
2011-01-15 19:48:43 +01:00
Henri Verbeet
f6f7808028 r600g: Get rid of r600_translate_vertex_data_type().
This has been replaced with r600_vertex_data_type().
2011-01-15 19:48:43 +01:00
Brian Paul
652901e95b Merge branch 'draw-instanced'
Conflicts:
	src/gallium/auxiliary/draw/draw_llvm.c
	src/gallium/drivers/llvmpipe/lp_state_fs.c
	src/glsl/ir_set_program_inouts.cpp
	src/mesa/tnl/t_vb_program.c
2011-01-15 10:24:08 -07:00
Christoph Bumiller
21001d2ba7 nvc0: try to swap immediates to first source too 2011-01-15 14:14:55 +01:00
Christoph Bumiller
52474d4246 nvc0: make sure all sources of the BIND op are distinct
They're supposed to be assigned consecutive registers so they can't
contain the same SSA value more than once.
2011-01-15 14:14:50 +01:00
Christoph Bumiller
1ae982adfd nvc0: update user vbufs on each draw call
This is required in case set_vertex_buffers is not called again.
2011-01-15 12:18:52 +01:00
Christoph Bumiller
b50d02e2e0 nvc0: enable early fragment tests where possible 2011-01-15 12:17:57 +01:00
Christoph Bumiller
5ec66c6e70 nvc0: upload small buffers through the command buffer 2011-01-15 12:17:00 +01:00
Chia-I Wu
a4a5a9a5ce mesa: Add glDepthRangef and glClearDepthf to APIspec.xml.
Core mesa has gained support for GL_ARB_ES2_compatibility.  Make GLES
generated dispatch table use them.
2011-01-15 12:42:59 +08:00
Chia-I Wu
b70d0a6a51 targets/egl-static: Assorted cleanups and fixes.
Share more code between windows and non-windows platforms.  Check
env['x11'] for X11 and add env['X11_LIBS'] to LIBS.  Add ws_wrapper for
i965g.
2011-01-15 12:35:22 +08:00
Chia-I Wu
6f769a690b targets/egl: i965 needs libwsw.
Fix undefined symbol wrapper_sw_winsys_dewrap_pipe_screen.
2011-01-15 12:35:19 +08:00
Eric Anholt
4620de7eea mesa: Add getter for GL_SHADER_COMPILER with ARB_ES2_compatibility.
Fixes piglit arb_es2_compatibility-shadercompiler
2011-01-14 16:55:35 -08:00
Eric Anholt
8395f206a8 mesa: Add getters for ARB_ES2_compatibility MAX_*_VECTORS.
Fixes piglit arb_es2_compatibility-maxvectors.
2011-01-14 16:55:35 -08:00
Eric Anholt
e12c4faf7e mesa: Add support for glDepthRangef and glClearDepthf.
These are ARB_ES2_compatibility float variants of the core double
entrypoints.  Fixes arb_es2_compatibility-depthrangef.
2011-01-14 16:55:35 -08:00
Eric Anholt
25beab10cd ir_to_mesa: Fix segfaults on ir_to_mesa invocation after MSVC change. 2011-01-14 16:55:35 -08:00
Brian Paul
d42acef139 glsl: fix implicit int to bool warning
Maybe preprocess() should return a bool.
2011-01-14 17:46:47 -07:00
Brian Paul
7ff89b030f docs: skeleton file for 7.11 release notes, add missing links 2011-01-14 17:46:38 -07:00
Vinson Lee
7772a34f3a mesa: Dynamically allocate acp array in ir_to_mesa_visitor::copy_propagate.
Fixes these MSVC errors.
ir_to_mesa.cpp(2644) : error C2057: expected constant expression
ir_to_mesa.cpp(2644) : error C2466: cannot allocate an array of constant size 0
ir_to_mesa.cpp(2644) : error C2133: 'acp' : unknown size
ir_to_mesa.cpp(2646) : error C2070: 'ir_to_mesa_instruction *[]': illegal sizeof operand
ir_to_mesa.cpp(2709) : error C2070: 'ir_to_mesa_instruction *[]': illegal sizeof operand
ir_to_mesa.cpp(2718) : error C2070: 'ir_to_mesa_instruction *[]': illegal sizeof operand
2011-01-14 16:18:52 -08:00
Eric Anholt
7b987578a9 mesa: Add actual support for glReleaseShaderCompiler from ES2.
Fixes no-op dispatch warning in piglit
arb_es2_compatibility-releaseshadercompiler.c.
2011-01-14 15:30:04 -08:00
Eric Anholt
ed93f9f3a3 intel: Expose GL_ARB_ES2_compatibility.
We don't have all of the features of this extension hooked up yet, but
the consensus yesterday was that since those features are things that
we should also be supporting in our ES2 implementation, claiming ES2
here too doesn't make anything worse and will make incremental
improvement through piglit easier.
2011-01-14 15:30:01 -08:00
Eric Anholt
9c6954fc9d mesa: Add extension enable bit for GL_ARB_ES2_compatibility. 2011-01-14 15:28:50 -08:00
Eric Anholt
841ad6bfad glapi: Regenerate for GL_ARB_ES2_compatibility. 2011-01-14 15:28:01 -08:00
Eric Anholt
8560cb939b glapi: Add entrypoints and enums for GL_ARB_ES2_compatibility. 2011-01-14 15:28:00 -08:00
Alex Deucher
634dece281 r600g: compiler helper opcode fixes for evergreen
Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2011-01-14 17:50:49 -05:00
Alex Deucher
9dfc68314d r600g: pass r600_bc to some addition compiler helper functions
needed for asic specific opcodes

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2011-01-14 17:50:29 -05:00
Vinson Lee
57ef69dd88 generate_builtins.py: Whitespace fixes.
Also removed unnecessary semicolons.
2011-01-14 14:19:02 -08:00
Vinson Lee
0de6d7e991 generate_builtins.py: Fix builds using Python 2.5. 2011-01-14 14:17:03 -08:00
Eric Anholt
a6e4614ca1 i965: Replace broken handling of dead code with an assert.
This code should never have been triggered, but I often did anyway
when I disabled optimization passes during debugging, then spent my
time debugging that this code doesn't work.
2011-01-14 13:57:15 -08:00
Eric Anholt
7c7df146b5 i965: Add an invalidation of live intervals after register splitting.
No effect, since it was called before live intervals were calculated.
2011-01-14 13:57:15 -08:00
Eric Anholt
65c41d55a0 mesa: Simplify _mesa_base_fbo_format by making it exceptions to teximages.
The comment of "this is just like teximages except for..." is a pretty
good clue that we're handling this wrong.  By just using the teximage
code, we catch a bunch of cases we'd missed, like GL_RED and GL_RG.
2011-01-14 13:57:15 -08:00
Eric Anholt
34a9da4eb4 mesa: Add channel-wise copy propagation to ir_to_mesa.
This catches more opportunities than the prog_optimize.c code on
openarena's fixed function shaders turned to GLSL, mostly due to
looking at multiple source instructions for copy propagation
opportunities.  It should also be much more CPU efficient than
prog_optimize.c's code.
2011-01-14 13:57:14 -08:00
Eric Anholt
d53c8380bf i915: Fix compiler warning from sw fallback removal change. 2011-01-14 13:57:14 -08:00
Vinson Lee
4c6d6dd8fc r600g: Disable V_SQ_ALU_WORD1_OP2_SQ_OP2_INST_FLT_TO_INT_FLOOR case.
The usage of macro V_SQ_ALU_WORD1_OP2_SQ_OP2_INST_FLT_TO_INT_FLOOR was
introduced by commit 323ef3a1f0 but the
macro is undefined. Disable this case to fix the build for now.
2011-01-14 13:47:37 -08:00
Kristian Høgsberg
6e9b0f6807 gles2: Also support GL_BGRA_EXT for glTexSubImage2d 2011-01-14 16:12:21 -05:00
Christian König
323ef3a1f0 r600g: add more missing instructions to r600_bc_get_num_operands 2011-01-14 18:46:52 +01:00
Chia-I Wu
e7d8f92570 egl: Fix EGL_VERSION string.
Fix a copy-and-paste error in a4a38dcf61.
2011-01-14 14:29:19 +08:00
Chia-I Wu
36a59b29ef egl: Fix an assertion in _eglUpdateAPIsString.
dpy->ClientAPIs was renamed in a4a38dcf61.
2011-01-14 14:12:42 +08:00
Dave Airlie
483de8ef2e i965: fix fbo-srgb on i965.
Until we get the EXT_framebuffer_sRGB extension we should bind the sRGB
formats for FBO as linear.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-01-14 14:58:47 +10:00
Dave Airlie
7f652fc523 srgb: fix fbo base format picking.
Pointed out by Brian.
2011-01-14 14:58:47 +10:00
Chad Versace
7b9dc40b0d i915: Disable extension OES_standard_derivatives
OES_standard_derivatives must be manually disabled for i915 because Mesa
enables it by default.
2011-01-13 17:26:28 -08:00
Chad Versace
78838b2d1b mesa: Change OES_standard_derivatives to be stand-alone extension
Add a bit in struct gl_extensions for OES_standard_derivatives, and enable
the bit by default. Advertise the extension only if the bit is enabled.

Previously, OES_standard_derivatives was advertised in GLES2 contexts
if ARB_framebuffer_object was enabled.
2011-01-13 17:26:28 -08:00
Vinson Lee
a2ab929ab2 r600g: Move declaration before code in r600_asm.c.
Fixes SCons build.
2011-01-13 14:17:01 -08:00
Christian König
96f8f8db7b r600g: rework literal handling 2011-01-13 23:01:35 +01:00
Christian König
d7342f6a81 r600g: merge alu groups 2011-01-13 23:01:35 +01:00
Christian König
eea1d8199b r600g: implement replacing gpr with pv and ps 2011-01-13 23:01:35 +01:00
Ian Romanick
4bcff0c190 glsl: Emit errors or warnings when 'layout' is used with 'attribute' or 'varying'
The specs that add 'layout' require the use of 'in' or 'out'.
However, a number of implementations, including Mesa, shipped several
of these extensions allowing the use of 'varying' and 'attribute'.
For these extensions only a warning is emitted.

This differs from the behavior of Mesa 7.10.  Mesa 7.10 would only
accept 'attribute' with 'layout(location)'.  This behavior was clearly
wrong.  Rather than carrying the broken behavior forward, we're just
doing the correct thing.

This is related to (piglit) bugzilla #31804.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-13 13:38:50 -08:00
Ian Romanick
82c4b4f88a glsl: Allow 'in' and 'out' when 'layout' is also available
All of the extensions that add the 'layout' keyword also enable (and
required) the use of 'in' and 'out' with shader globals.

This is related to (piglit) bugzilla #31804.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-13 13:35:50 -08:00
José Fonseca
e1bc68b014 scons: Fix cross-compilation.
Hairy stuff. Don't know how to do it better though.
2011-01-13 20:53:42 +00:00
Christian König
0448f73f06 r600g: add missing RECIPSQRT_CLAMPED to r600_bc_get_num_operands 2011-01-13 21:29:47 +01:00
Christian König
a25b91c2c2 r600g: rework bank swizzle code 2011-01-13 21:22:00 +01:00
Christian König
89275c0b36 r600g: fix alu slot assignment 2011-01-13 19:41:07 +01:00
Christian König
236e99fe05 r600g: optimize away CF ALU instructions even if type doesn't match 2011-01-13 19:41:07 +01:00
Christoph Bumiller
370ae0bd61 nvc0: identify POINT_RASTER_RULES, add POINT_SMOOTH state
Point smoothing requires rasterization rules to be set to OGL.

Sorry for the extra noise caused by the header update.
2011-01-13 19:36:25 +01:00
Chia-I Wu
abbb1c8f08 draw: Fix an off-by-one bug in a vsplit assertion.
When use_spoken is true, istart (the first vertex of this segment) is
replaced by i0 (the spoken vertex of the fan).  There are still icount
vertices.

Thanks to Brian Paul for spotting this.
2011-01-14 02:02:26 +08:00
Vinson Lee
1f66930332 i965: Remove unnecessary headers. 2011-01-13 09:28:47 -08:00
Vinson Lee
d599df8a8c targets/egl-static: Remove unnecessary header. 2011-01-13 09:16:25 -08:00
Vinson Lee
eb70e58caf r600g: Silence uninitialized variable warnings. 2011-01-13 09:07:19 -08:00
Vinson Lee
d76f1da7cb mesa: Add missing break statement in SARGB8 case. 2011-01-13 08:53:33 -08:00
Brian Paul
ca31c596e8 egl: need stdio.h for non-Windows build too to avoid compiler warning 2011-01-13 09:25:55 -07:00
Paulo Zanoni
dad914f6b2 dri_util: fail driCreateNewScreen if InitScreen is NULL
Without this, X doesn't start with UMS on r300g.

NOTE: This is a candidate for the 7.9 and 7.10 branches.

Signed-off-by: Paulo Zanoni <pzanoni@mandriva.com>
Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-13 07:44:33 -07:00
José Fonseca
9277a62aa3 scons: Ensure the OpenVG/EGL import libs are also prefixed with 'lib'. 2011-01-13 12:33:41 +00:00
José Fonseca
63528c4510 scons: Build libOpenVG.dll & libEGL.dll
But without creating liblibOpenVG or liblibEGL elsewhere.

Thanks Chia-I Wu for pointing this out.
2011-01-13 11:54:43 +00:00
José Fonseca
80f18876f6 util: Undo spurious changes in last commit. 2011-01-13 11:45:40 +00:00
José Fonseca
fe2cfd9b19 util: Don't limit debug_printf message length on unices. 2011-01-13 11:44:16 +00:00
Chia-I Wu
a22a332fc7 egl: Improve driver selection.
The idea is to be able to match a driver using the following order

  try egl_gallium with hw renderer
  try egl_dri2
  try egl_gallium with sw renderer
  try egl_glx

given the module list

  egl_gallium
  egl_dri2
  egl_glx

For that, UseFallback initialization option is added.  The module list
is matched twice: with the option unset and with the option set.  In the
first pass, egl_gallium skips its sw renderer and egl_glx rejects to
initialize since UseFallback is not set.  In the second pass,
egl_gallium skips its hw renderer and egl_dri2 rejects to initialize
since UseFallback is set.  The process stops at the first driver that
initializes the display.
2011-01-13 18:15:45 +08:00
Chia-I Wu
655e459892 egl: Simplify driver matching.
Add initialization options that drv->API.Initialize should support.
Replace drv->Probe by TestOnly initialization option and simplify
_eglMatchDriver.
2011-01-13 18:10:38 +08:00
Chia-I Wu
a4a38dcf61 egl: Cleanup _EGLDisplay initialization.
Reorder/rename and document the fields that should be set by the driver during
initialization.  Drop the major/minor arguments from drv->API.Initialize.
2011-01-13 17:57:38 +08:00
Kenneth Graunke
47b2af2c62 glsl/s_expression: Read and ignore Scheme-style comments.
A single-semicolon until the end of the line, i.e.
; this is a comment.
2011-01-12 23:55:34 -08:00
Kenneth Graunke
5bfb68cd0f glsl/builtins: Remove unnecessary (constant bool (1)) from assignments.
This isn't strictly necessary, but is definitely nicer.
2011-01-12 23:55:34 -08:00
Kenneth Graunke
bbafd2b849 ir_reader: Make assignment conditions optional.
You can now simply write (assign (xy) <lhs> <rhs>) instead of the
verbose (assign (constant bool (1)) (xy) <lhs> <rhs>).
2011-01-12 23:55:34 -08:00
Kenneth Graunke
b74ff382a4 ir_reader: Convert to a class.
This makes it unnecessary to pass _mesa_glsl_parse_state around
everywhere, making at least the prototypes a lot easier to read.

It's also more C++-ish than a pile of static C functions.
2011-01-12 23:55:34 -08:00
Kenneth Graunke
ec7e4f0ec5 ir_reader: Combine the three dereference reading functions into one.
These used to be more complicated, but now are so simple there's no real
point in keeping them separate.
2011-01-12 23:55:34 -08:00
Kenneth Graunke
e486fca2d3 ir_reader: Relax requirement that function arguments be s_lists.
All of these functions used to take s_list pointers so they wouldn't all
need SX_AS_LIST conversions and error checking.  However, the new
pattern matcher conveniently does this for us in one centralized place.

So there's no need to insist on s_list.  Switching to s_expression saves
a bit of code and is somewhat cleaner.
2011-01-12 23:55:33 -08:00
Kenneth Graunke
d798815272 ir_reader: Remove s_list::length() method.
Most code now relies on the pattern matcher rather than this function,
and for the only remaining case, not using this saves an iteration.
2011-01-12 23:55:33 -08:00
Kenneth Graunke
daeb0c646e ir_reader: Add a pattern matching system and use it everywhere.
Previously, the IR reader was riddled with code that:
1. Checked for the right number of list elements (via a linked list walk)
2. Retrieved references to each component (via ->next->next pointers)
3. Downcasted as necessary to make sure that each sub-component was the
   right type (i.e. symbol, int, list).
4. Checking that the tag (i.e. "declare") was correct.

This was all very ad-hoc and a bit ugly.  Error checking had to be done
at both steps 1, 3, and 4.  Most code didn't even check the tag, relying
on the caller to do so.  Not all callers did.

The new pattern matching module performs the whole process in a single
straightforward function call, resulting in shorter, more readable code.

Unfortunately, MSVC does not support C99-style anonymous arrays, so the
pattern must be declared outside of the match call.
2011-01-12 23:55:33 -08:00
Dave Airlie
407184fe08 mesa/srgb: handle SARGB8 case in the sw fbo renderer. 2011-01-13 16:51:30 +10:00
Fredrik Höglund
71b889f904 st/mesa: fix a regression from cae2bb76
stObj->pt is null when a TFP texture is passed to st_finalize_texture,
and with the changes introduced in the above commit this resulted in a
new texture being created and the existing image being copied into it.

NOTE: This is a candidate for the 7.10 branch.

Reviewed-by: Alex Deucher <alexdeucher@gmail.com>
2011-01-13 01:22:20 -05:00
Ben Skeggs
bd2b72359e nvc0: disable calling of sw methods we don't implement
Left in the code as a marker of what NVIDIA do, just in case we need
to do this some day.

Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-01-13 15:26:31 +10:00
Dave Airlie
8c8e26d66a mesa/fbo: prevent assert trigger on i965 with piglit fbo-srgb test. 2011-01-13 15:17:34 +10:00
Ben Skeggs
0c1db2feb9 nvc0: fix mp_stack_bo relocation
Fixes a PT_NOT_PRESENT error cause by:
- allocating in VRAM
- emitting GART relocs to 0x17bc/0x17c0, moving the buffer
- telling the bufmgr that the buffer should be in VRAM when we use it,
  but not correcting the value sent to 0x17bc/0x17c0.

Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2011-01-13 13:31:29 +10:00
Vinson Lee
31b1051663 mesa: Move loop variable declarations outside for loop in extensions.c.
Fixes MSVC build.
2011-01-12 17:43:28 -08:00
Brian Paul
dd973cd9e8 mesa: check for dummy renderbuffer in _mesa_FramebufferRenderbufferEXT()
Fixes a failed assertion when a renderbuffer ID that was gen'd but not
previously bound was passed to glFramebufferRenderbuffer().  Generate
the same error that NVIDIA does.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-12 18:14:18 -07:00
Brian Paul
67722ae403 mesa: don't assert in GetIntegerIndexed, etc
We were getting an assertion upon invalid pname.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-12 18:13:18 -07:00
Brian Paul
2fa6012f6a mesa: fix num_draw_buffers==0 in fixed-function fragment program generation
This fixes a problem when glDrawBuffers(GL_NONE).  The fragment program
was writing to color output[0] but OutputsWritten was 0.  That led to a
failed assertion in the Mesa->TGSI translation code.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-12 17:55:45 -07:00
Brian Paul
30616fdacf st/mesa: add st_BeginQuery() case for GL_ANY_SAMPLES_PASSED
Fixes piglit occlusion_query2 failure.
2011-01-12 17:55:44 -07:00
Brian Paul
1b173fb3ba glsl: remove trailing comma to silence warning 2011-01-12 17:55:44 -07:00
Brian Paul
4d96af9337 noop: change var type to silence warning 2011-01-12 17:55:44 -07:00
Kenneth Graunke
b076551e3b glsl/Makefile: Fix build with --as-needed. 2011-01-12 16:37:03 -08:00
Vinson Lee
356e2e962f mesa: Move declaration before code in extensions.c.
Fixes SCons build.
2011-01-12 16:23:11 -08:00
Chad Versace
a7b5664c05 mesa: Change OES_point_sprite to depend on ARB_point_sprite
The extension string in GLES1 contexts always advertised
GL_OES_point_sprite. Now advertisement depends on ARB_point_sprite being
enabled.

Reviewed-by: Ian Romanick <idr@freedesktop.org>
2011-01-12 15:45:03 -08:00
Chad Versace
039150169e mesa: Change dependencies of some OES extension strings
Change all OES extension strings that depend on ARB_framebuffer_object to
instead depend on EXT_framebuffer_object.

Reviewed-by: Ian Romanick <idr@freedesktop.org>
2011-01-12 15:45:03 -08:00
Chad Versace
19418e921a mesa: Add/remove extensions in extension string
Add GL_OES_stencil8 to ES2.

Remove the following:
   GL_OES_compressed_paletted_texture : ES1
   GL_OES_depth32                     : ES1, ES2
   GL_OES_stencil1                    : ES1, ES2
   GL_OES_stencil4                    : ES1, ES2
Mesa advertised these extensions, but did not actually support them.

Reviewed-by: Ian Romanick <idr@freedesktop.org>
2011-01-12 15:45:03 -08:00
Chad Versace
9b260c377f mesa: Refactor handling of extension strings
Place GL, GLES1, and GLES2 extensions in a unified extension table. This
allows one to enable, disable, and query the status of GLES1 and GLES2
extensions by name.

When tested on Intel Ironlake, this patch did not alter the extension
string [as given by glGetString(GL_EXTENSIONS)] for any API.

Reviewed-by: Ian Romanick <idr@freedesktop.org>
Reviewed-by: Brian Paul <brianp@vmware.com>
2011-01-12 15:45:03 -08:00
Ian Romanick
bd33055ef4 glsl: Track variable usage, use that to enforce semantics
In particular, variables cannot be redeclared invariant after being
used.

Fixes piglit test invariant-05.vert and bugzilla #29164.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-12 14:30:31 -08:00
Eric Anholt
c3f000b392 i965/fs: Do flat shading when appropriate.
We were trying to interpolate, which would end up doing unnecessary
math, and doing so on undefined values.   Fixes glsl-fs-flat-color.
2011-01-12 13:51:01 -08:00
Christian König
6881262eff r600g: also look at tex inst when for maximum gpu count 2011-01-12 20:41:15 +01:00
Vinson Lee
a42906f862 generate_builtins.py: Add missing import.
Import sys for sys.exit.
2011-01-12 11:35:43 -08:00
Eric Anholt
e1fb511570 meta: Actually use mipmapping when generating mipmaps.
With the change to not reset baselevel, this GL_LINEAR filtering was
resulting in generating mipmaps off of the base level instead of the
next higher detail level.  Fixes fbo-generatemipmap-filtering.

Reported by: Neil Roberts <neil@linux.intel.com>
2011-01-12 11:08:07 -08:00
Eric Anholt
e880a57a71 i965: Clarify when we need to (re-)calculate live intervals.
The ad-hoc placement of recalculation somewhere between when they got
invalidated and when they were next needed was confusing.  This should
clarify what's going on here.
2011-01-12 11:08:07 -08:00
Christian König
c60cb25bfb r600g: implement output modifiers and use them to further optimize LRP 2011-01-12 19:44:49 +01:00
Christian König
7728bef290 r600g: use special constants for 0, 1, -1, 1.0f, 0.5f etc 2011-01-12 19:40:52 +01:00
Christian König
dffad730df r600g: optimize temp register handling for LRP 2011-01-12 19:36:55 +01:00
Christian König
8813842121 r600g: optimize away CF_INST_POP
If last instruction is an CF_INST_ALU we don't need to emit an
additional CF_INST_POP for stack clean up after an IF ELSE ENDIF.
2011-01-12 19:31:36 +01:00
Christian König
052b9e8fab r600g: make dumping of shaders an option 2011-01-12 19:17:49 +01:00
Christian König
95a2b265fa r600g: fix alu dumping 2011-01-12 19:17:49 +01:00
Christian König
47e7c6f571 r600g: improve r600_bc_dump 2011-01-12 19:17:49 +01:00
Eric Anholt
9351ef7a44 i965/vs: When MOVing to produce ABS, strip negate of the operand.
We were returning the negative absolute value, instead of the absolute
value.  Fixes glsl-vs-abs-neg.
2011-01-12 09:50:34 -08:00
Eric Anholt
ab56e3be9a i965/fs: When producing ir_unop_abs of an operand, strip negate.
We were returning the negative absolute value, instead of the absolute
value.  Fixes glsl-fs-abs-neg.
2011-01-12 09:50:10 -08:00
José Fonseca
416ca90138 glsl: Make builtin_compiler build on Windows with MSVC. 2011-01-12 16:58:37 +00:00
José Fonseca
0035d1d902 glsl: Make builtin_compiler portable for non-unices. 2011-01-12 16:54:25 +00:00
José Fonseca
f9bb5323eb getopt: Make code more portable. 2011-01-12 16:54:21 +00:00
José Fonseca
6d670f6c0f getopt: Import OpenBSD getopt implementation for MSVC. 2011-01-12 15:32:17 +00:00
José Fonseca
46662de68b scons: Update windows build for vgapi->openvg rename. 2011-01-12 15:13:57 +00:00
José Fonseca
b07ad1d6bd scons: Fix build on systems without libOpenVG.so 2011-01-12 15:06:57 +00:00
Chia-I Wu
1e4f412242 egl: When EGL_DRIVER is set, do not add other drivers.
Setting EGL_DRIVER forces the driver to be loaded, as documented.  There
should be no fallbacks.
2011-01-12 18:10:15 +08:00
Chia-I Wu
4924cb9036 egl: libEGL depends on LOCAL_LIBS.
So that libEGL is rebuilt whenever LOCAL_LIBS changes.
2011-01-12 18:10:15 +08:00
Chia-I Wu
39812c48df egl_dri2: Fix eglGetProcAddress.
The driver struct is zeroed after dri2_load.  Oops.
2011-01-12 18:10:15 +08:00
Chia-I Wu
a8b6b6555c scons: Updates for targets/egl-static.
Update SConscripts to re-enable or add support for EGL on windows and
x11 platforms respectively.  targets/egl-gdi is replaced by
targets/egl-static, where "-static" means pipe drivers and state
trackers are linked to statically by egl_gallium, and egl_gallium is a
built-in driver of libEGL.  There is no more egl_gallium.dll on Windows.
2011-01-12 17:40:01 +08:00
Chia-I Wu
49ed5bb28d targets/egl-static: New EGL target for scons.
This target is based on and replaces egl-gdi.  It is suitable for both
windows and x11.
2011-01-12 17:40:01 +08:00
Kenneth Graunke
1412dea949 glsl: Add type inference support for remaining expression opcodes. 2011-01-11 23:28:58 -08:00
Eric Anholt
4eb7284ef9 i965: Tighten up the check for flow control interfering with coalescing.
This greatly improves codegen for programs with flow control by
allowing coalescing for all instructions at the top level, not just
ones that follow the last flow control in the program.
2011-01-11 16:04:25 -08:00
Christian König
93a95ad8ff r600g: texture instructions also work fine with TGSI_FILE_INPUT 2011-01-12 00:44:30 +01:00
Christian König
a1146c1373 r600g: DP4 also supports writemasking 2011-01-12 00:41:49 +01:00
Christian König
7be5455796 r600g: Why all this fiddling with tgsi_helper_copy?
tgsi_helper_copy is used on several occasions to copy a temporary result
into the real destination register to emulate writemasks for OP3 and
reduction operations. According to R600 ISA that's unnecessary.

This patch fixes this use for MAD, CMP and DP4.
2011-01-12 00:40:55 +01:00
Christian König
cc0f604241 r600g: fix tex and vtx joining 2011-01-12 00:06:48 +01:00
Eric Anholt
c00bc13564 glsl: Fix the lowering of variable array indexing to not lose write_masks.
Fixes glsl-complex-subscript on 965.
2011-01-11 14:50:19 -08:00
Eric Anholt
5acf94e955 i965: Remove dead fallback for stencil _Enabled but no stencil buffer.
The _Enabled field is the thing that takes into account whether
there's a stencil buffer.  Tested with piglit glx-visuals-stencil.
2011-01-11 13:48:31 -08:00
Tilman Sauerbeck
242205404d r600g: Fixed SIN/COS/SCS for the case where the operand is a literal.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
Reviewed-by: Alex Deucher <alexdeucher@gmail.com>
2011-01-11 22:37:01 +01:00
Alberto Milone
ca8960234e r600c: add evergreen ARL support.
Signed-off-by: Alberto Milone <alberto.milone@canonical.com>
2011-01-11 14:48:44 -05:00
Jerome Glisse
0865af4b42 noop: remove dead dri target
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2011-01-11 14:46:09 -05:00
Jerome Glisse
63b9790a55 r600g: move user fence into base radeon structure
This avoid any issue when context is free and we still try to
access fence through radeon structure.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2011-01-11 14:34:25 -05:00
Brian Paul
483f566222 configure: bump libdrm version requirement to 2.4.23
NOTE: This is a candidate for the 7.10 (and 7.9?) branch.
2011-01-11 09:42:54 -07:00
Brian Paul
167db6d34f mesa: include teximage.h to silence warning 2011-01-11 09:37:35 -07:00
Brian Paul
d92e56460e mesa: do a debug check of _mesa_format_to_type_and_comps()
Make sure that all formats are handled in this function.  It's
easy to miss this function when adding new pixel formats.

See also http://bugs.freedesktop.org/show_bug.cgi?id=31544
2011-01-11 09:27:06 -07:00
Brian Paul
0073f50cd4 mesa: fix a few format table mistakes, assertions
The BaseFormat field was incorrect for a few R and RG formats.
Fix a couple assertions too.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-11 09:27:06 -07:00
Kenneth Graunke
33d0c44910 glsl: Autogenerate builtin_functions.cpp as part of the build process.
Python is already necessary for other parts of Mesa, so there's no
reason we can't just generate it.  This patch updates both make and
SCons to do so.
2011-01-10 19:03:27 -08:00
Ian Romanick
469ea695bb glsl: Disallow 'in' and 'out' on globals in GLSL 1.20
Fixes piglit tests glsl-1.20/compiler/qualifiers/in-01.vert and
glsl-1.20/compiler/qualifiers/out-01.vert and bugzilla #32910.

NOTE: This is a candidate for the 7.9 and 7.10 branches.  This patch
also depends on the previous two commits.
2011-01-10 17:39:16 -08:00
Ian Romanick
a0c2ec8e2d glsl: Refresh autogenerated parser file.
For the previous commit.
2011-01-10 17:39:16 -08:00
Ian Romanick
eebdfdfbcf glsl: Add version_string containing properly formatted GLSL version 2011-01-10 17:39:16 -08:00
Ian Romanick
a302d740bd glcpp: Refresh autogenerated lexer and parser files.
For the previous commit.
2011-01-10 17:38:56 -08:00
Ian Romanick
9ca5300b6e glcpp: Generate an error for division by zero
When GCC encounters a division by zero in a preprocessor directive, it
generates an error.  Since the GLSL spec says that the GLSL
preprocessor behaves like the C preprocessor, we should generate that
same error.

It's worth noting that I cannot find any text in the C99 spec that
says this should be an error.  The only text that I can find is line 5
on page 82 (section 6.5.5 Multiplicative Opertors), which says,

    "The result of the / operator is the quotient from the division of
    the first operand by the second; the result of the % operator is
    the remainder. In both operations, if the value of the second
    operand is zero, the behavior is undefined."

Fixes 093-divide-by-zero.c test and bugzilla #32831.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-10 17:37:51 -08:00
Chad Versace
4e09a786d2 glcpp: Regenerate glcpp-parse.c 2011-01-10 17:28:24 -08:00
Chad Versace
4fff52f1c9 glcpp: Fix segfault when validating macro redefinitions
In _token_list_equal_ignoring_space(token_list_t*, token_list_t*), add
a guard that prevents dereferncing a null token list.

This fixes test src/glsl/glcpp/tests/092-redefine-macro-error-2.c and
Bugzilla #32695.
2011-01-10 17:28:24 -08:00
Eric Anholt
c0cdae0368 i965: Use a new miptree to avoid software fallbacks due to drawing offset.
When attaching a small mipmap level to an FBO, the original gen4
didn't have the bits to support rendering to it.  Instead of falling
back, just blit it to a new little miptree just for it, and let it get
revalidated into the stack later just like any other new teximage.

Bug #30365.
2011-01-10 17:21:54 -08:00
Eric Anholt
6bdc319421 intel: Drop the speculatively-use-firstImage-mt in validation.
It's been replaced by just setting texObj->mt to image->mt at TexImage
time.
2011-01-10 17:21:11 -08:00
Eric Anholt
bdc6dc1d7e intel: Don't relayout the texture on maxlevel change.
This avoids relayouts in the common case of glGenerateMipmap() or
people doing similar things.

Bug #30366.
2011-01-10 17:21:11 -08:00
Eric Anholt
48024fb44c intel: When making a new teximage miptree, make a full one.
If we hit this path, we're level 1+ and the base level got allocated
as a single level instead of a full tree (so we don't match
intelObj->mt).  This tries to recover from that so that we end up with
2 allocations and 1 validation blit (old -> new) instead of
allocations equal to number of levels and levels - 1 blits.
2011-01-10 17:21:11 -08:00
Eric Anholt
bd4a2e9209 meta: Don't tweak BaseLevel when doing glGenerateMipmap().
We don't need to worry about levels other than MaxLevel because we're
minifying -- the lower levels (higher detail) won't contribute to the
result.  By changing BaseLevel, we forced hardware that doesn't
support BaseLevel != 0 to relayout the texture object.
2011-01-10 17:21:11 -08:00
Eric Anholt
5b3eb7538c Revert "intel: Always allocate miptrees from level 0, not tObj->BaseLevel."
This reverts commit 7ce6517f3a.
This reverts commit d60145d06d.

I was wrong about which generations supported baselevel adjustment --
it's just gen4, nothing earlier.  This meant that i915 would have
never used the mag filter when baselevel != 0.  Not a severe bug, but
not an intentional regression.  I think we can fix the performance
issue another way.
2011-01-10 17:21:10 -08:00
Kenneth Graunke
da0c0dbab0 i965: Add #defines for HiZ and separate stencil buffer commands. 2011-01-10 15:44:32 -08:00
Kenneth Graunke
4b929c75e2 i965: Add new HiZ related bits to WM_STATE. 2011-01-10 15:44:32 -08:00
Kenneth Graunke
1feee7b1b3 i965: Rename more #defines to 3DSTATE rather than CMD or CMD_3D.
Again, this makes it match the documentation.
2011-01-10 15:44:32 -08:00
Kenneth Graunke
6c5e6cd130 i965: Remove unused #defines which only contain the sub-opcode.
Most _3DSTATE defines contain the command type, sub-type, opcode, and
sub-opcode (i.e. 0x7905).  These, however, contain only the sub-opcode
(i.e. 0x05).  Since they are inconsistent with the rest of the code and
nothing uses them, simply delete them.

The _3DOP and _3DCONTROL defines seemed similar, and were also unused.
2011-01-10 15:44:32 -08:00
Chad Versace
61428dd2ab glsl: At link-time, check that globals have matching centroid qualifiers
Fixes bug 31923: http://bugs.freedesktop.org/show_bug.cgi?id=31923
2011-01-10 15:29:30 -08:00
Tom Fogal
0e3ff159f9 Add GLX_TLS setting to configs/default.
Should have gone in with 31351dc029,
thanks to Dan Nicholson for noticing.
2011-01-10 15:39:21 -07:00
Dave Airlie
a988ddf379 mesa/swrast: handle sRGB FBOs correctly (v2)
From reading EXT_texture_sRGB and EXT_framebuffer_sRGB and interactions
with FBO I've found that swrast is converting the sRGB values to linear for
blending when an sRGB texture is bound as an FBO. According to the spec
and further explained in the framebuffer_sRGB spec this behaviour is not
required unless the GL_FRAMEBUFFER_SRGB is enabled and the Visual/config
exposes GL_FRAMEBUFFER_SRGB_CAPABLE_EXT.

This patch fixes swrast to use a separate Fetch call for FBOs bound to
SRGB and avoid the conversions.

v2: export _mesa_get_texture_dimensions as per Brian's comments.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-01-11 08:32:33 +10:00
Tom Fogal
31351dc029 Export TLS support in gl.pc. 2011-01-10 12:34:02 -07:00
Marek Olšák
9d33e4e16c r300g: add debug option for buffer upload logging 2011-01-10 05:45:10 +01:00
Chia-I Wu
97e9a0e23f st/egl: Fix a void pointer arithmetic warning. 2011-01-10 11:51:13 +08:00
Chia-I Wu
12583174c5 mesa: Remove GLES overlay.
With core mesa doing runtime API checks, GLES overlay is no longer
needed.  Make --enable-gles-overlay equivalent to --enable-gles[12].
There may still be places where compile-time checks are done.  They
could be fixed case by case.
2011-01-10 11:50:35 +08:00
Chia-I Wu
c98ea26e16 egl: Make egl_dri2 and egl_glx built-in drivers.
These two drivers are small in size.  Making them built-in should
simplify packaging.
2011-01-10 11:50:34 +08:00
Chia-I Wu
15f0223931 egl_glx: Load libGL dynamically.
This is a step forward for compatibility with really old GLX.  But the
real reason for making this change now is so that we can make egl_glx a
built-in driver without having to link to libGL.
2011-01-10 11:25:31 +08:00
Chia-I Wu
fef5d14494 egl_dri2: Look up _glapi_get_proc_address dynamically.
In preparation for making egl_dri2 built-in.  It also handles

  symbol lookup error: /usr/local/lib/egl/egl_dri2.so: undefined symbol:
  _glapi_get_proc_address

more gracefully.
2011-01-10 11:23:24 +08:00
Vinson Lee
231ca0ec85 r600: Include mfeatures.h in files that perform feature tests. 2011-01-09 18:29:02 -08:00
Vinson Lee
c45814d6d3 r300: Include mfeatures.h in files that perform feature tests. 2011-01-09 18:25:36 -08:00
Vinson Lee
7a1cdef6c4 r200: Include mfeatures.h in files that perform feature tests. 2011-01-09 18:22:07 -08:00
Jerome Glisse
3349517351 noop: make noop useable like trace or rbug
If you want to enable noop set GALLIUM_NOOP=1 as an env variable.
You need first to enable noop wrapping for your driver see change
to src/gallium/targets/dri-r600/ in this commit as an example.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2011-01-09 21:04:41 -05:00
Marek Olšák
ac6306e9ca r300g: do not upload the same user buffer several times
Performance++.
2011-01-09 22:43:41 +01:00
Christoph Bumiller
b3d8e1fb3b nvc0: implement queries 2011-01-09 21:50:06 +01:00
Juan Zhao
e59fa4c46c dri2: release texture image.
Add release function for texture_from_pixmap extension.
Some platform need to release texture image for texture_from_pixmap
extension, add this interface for those platforms.
2011-01-09 14:55:16 -05:00
Vinson Lee
fb9c6e681f radeon: Include mfeatures.h in files that perform feature tests. 2011-01-09 01:45:04 -08:00
Vinson Lee
1933e97034 dri/nouveau: Include mfeatures.h in files that perform feature tests. 2011-01-09 01:33:14 -08:00
Vinson Lee
45a56e4730 intel: Include mfeatures.h in files that perform feature tests. 2011-01-09 01:25:54 -08:00
Vinson Lee
14b36cd568 vbo: Include mfeatures.h in files that perform feature tests. 2011-01-09 01:18:23 -08:00
Vinson Lee
edc09358f7 st/mesa: Include mfeatures.h in files that perform feature tests. 2011-01-09 01:04:19 -08:00
Vinson Lee
21750a2d9d mesa: Include mfeatures.h in program.c.
Include mfeatures.h for feature tests.
2011-01-09 00:47:33 -08:00
Dave Airlie
97195d04fd i965g: fix warnings 2011-01-09 17:25:12 +10:00
Dave Airlie
5e044e3900 i965g: update intel_decode from upstream. 2011-01-09 17:21:52 +10:00
Dave Airlie
3ee8d13c00 i965g: update disassembler code from classic.
still a bit of work to do, the winsys gen setting is a bit of a hack.
2011-01-09 17:21:10 +10:00
Dave Airlie
9562284114 i965g: update brw_defines.h from classic driver 2011-01-09 17:21:10 +10:00
Dave Airlie
571b317d02 i965g: update brw_structs.h from classic driver. 2011-01-09 17:21:10 +10:00
Dave Airlie
5826967d2e i965g: update to similiar gen stuff as i965 2011-01-09 17:21:10 +10:00
Marek Olšák
3332229b3b r300g: fix crash when flushing ZMASK
https://bugs.freedesktop.org/show_bug.cgi?id=32912

The fix is to call update_derived_state before user buffer uploads.
I've also moved some code around.

Unfortunately, there are still some ZMASK-related bugs which cause
misrendering, i.e. flushing doesn't always work and glean/fbo fails.
2011-01-09 06:14:23 +01:00
Marcin Slusarz
69191d4123 targets/egl: add libnvc0.a to nouveau libs 2011-01-09 00:46:35 +01:00
Christoph Bumiller
90e29afcb6 nvfx,nv50: pipe_reference the constant buffers 2011-01-08 15:40:14 +01:00
Christoph Bumiller
703f3597ad nvc0: fix primitive restart in immediate mode 2011-01-08 14:25:20 +01:00
Vinson Lee
d8cfe46442 mesa: Clean up header file inclusion in cpuinfo.c. 2011-01-08 03:03:17 -08:00
Marek Olšák
7c16a77b00 r300g: fix a surface leak when flushing ZMASK 2011-01-08 09:42:17 +01:00
Marek Olšák
1f0348c4a2 r300g: rework command submission and resource space checking
The motivation behind this rework is to get some speed by reducing
CPU overhead. The performance increase depends on many factors,
but it's measurable (I think it's about 10% increase in Torcs).

This commit replaces libdrm's radeon_cs_gem with our own implemention.
It's optimized specifically for r300g, but r600g could use it as well.
Reloc writes and space checking are faster and simpler than their
counterparts in libdrm (the time complexity of all the functions
is O(1) in nearly all scenarios, thanks to hashing).
(libdrm's radeon_bo_gem is still being used in the driver.)

It works like this:

cs_add_reloc(cs, buf, read_domain, write_domain) adds a new relocation and
also adds the size of 'buf' to the used_gart and used_vram winsys variables
based on the domains, which are simply or'd for the accounting purposes.
The adding is skipped if the reloc is already present in the list, but it
accounts any newly-referenced domains.

cs_validate is then called, which just checks:
    used_vram/gart < vram/gart_size * 0.8
The 0.8 number allows for some memory fragmentation. If the validation
fails, the pipe driver flushes CS and tries do the validation again,
i.e. it validates only that one operation. If it fails again, it drops
the operation on the floor and prints some nasty message to stderr.

cs_write_reloc(cs, buf) just writes a reloc that has been added using
cs_add_reloc. The read_domain and write_domain parameters have been removed,
because we already specify them in cs_add_reloc.

The space checking has been tested by putting small values in vram/gart_size
variables.
2011-01-08 07:05:42 +01:00
Eric Anholt
29c4f95cbc intel: Make renderbuffer tiling choice match texture tiling choice.
There really shouldn't be any difference between the two for us.
Fixes a bug where Z16 renderbuffers would be untiled on gen6, likely
leading to hangs.
2011-01-07 18:25:54 -08:00
Eric Anholt
8f593597fc intel: Use the _BaseFormat from MESA_FORMAT_* in renderbuffer setup. 2011-01-07 18:25:54 -08:00
Marek Olšák
aa6456dcd1 docs: fix messed up names with special characters in relnotes-7.9.1
(cherry picked from commit 67aeab0b77)
2011-01-08 03:10:18 +01:00
Marek Olšák
8d61a3f408 docs: fix messed up names with special characters in relnotes-7.10
(cherry picked from commit 36009724fd)
2011-01-08 03:09:47 +01:00
Eric Anholt
5df51c2bb0 i915: Drop old checks for the settexoffset hack. 2011-01-07 17:49:03 -08:00
Eric Anholt
372dc4cd6c i915: Don't claim to support AL1616 when neither 830 nor 915 does it.
Fixes an abort in fbo-generatemipmap-formats.
2011-01-07 17:49:03 -08:00
Eric Anholt
a7bf723056 intel: Add a vtbl hook for determining if a format is renderable.
By relying on just intel_span_supports_format, some formats that
aren't supported pre-gen4 were not reporting FBO incomplete.  And we
also complained in stderr when it happened on i915 because draw_region
gets called before framebuffer completeness validation.
2011-01-07 17:49:03 -08:00
Eric Anholt
f3240547f9 intel: expose ARB_framebuffer_object in the i915 driver.
ARB_fbo no longer disallows mismatched width/height on attachments
(shouldn't be any problem), mixed format color attachments (we only
support 1), and L/A/LA/I color attachments (we already reject them on
965 too).  It requires Gen'ed names (driver doesn't care), and adds
FramebufferTextureLayer (we don't do texture arrays).  So it looks
like we're already in the position we need to be for this extension.

Bug #27468, #32381.
2011-01-07 17:49:03 -08:00
Christoph Bumiller
8b2a46c0de nvc0: fix reloc domain conflict on buffer migration
Occurred because the code assumed that buf->domain would remain
equal to old_domain.
2011-01-08 02:14:00 +01:00
Christoph Bumiller
b2a79953a6 nvc0: upload user buffers only from draw info min to max index
There are actually applications that profit immensely from this.
2011-01-08 02:13:54 +01:00
Christoph Bumiller
64b639959f nvc0: fix emission of first 3 u8 indices to RING_NI 2011-01-08 02:13:10 +01:00
Christoph Bumiller
f5f086ca92 nvc0: reset mt transfer address after read loop over layers 2011-01-08 02:12:56 +01:00
Christoph Bumiller
bd301dfc12 nvc0: tie buffer memory release to the buffer fence
... instead of the next fence to be emitted. This way we have a
chance to reclaim the storage earlier.
2011-01-08 02:12:20 +01:00
Łukasz Krotowski
96d8a54716 r300g: Remove invalid assertion.
Invalid after be1af4394e (user buffer
creation with width0 == ~0).

Signed-off-by: Marek Olšák <maraeo@gmail.com>
2011-01-08 01:35:02 +01:00
Ian Romanick
1e1aef567f docs: Import 7.10 release notes from 7.10 branch 2011-01-07 14:38:23 -08:00
Eric Anholt
1d1ad6306d i965: Avoid double-negation of immediate values in the VS.
In general, we have to negate in immediate values we pass in because
the src1 negate field in the register description is in the bits3 slot
that the 32-bit value is loaded into, so it's ignored by the hardware.
However, the src0 negate field is in bits1, so after we'd negated the
immediate value loaded in, it would also get negated through the
register description.  This broke this VP instruction in the position
calculation in civ4:

MAD TEMP[1], TEMP[1], CONST[256].zzzz, CONST[256].-y-y-y-y;

Bug #30156
2011-01-07 14:35:42 -08:00
Ian Romanick
46a360b26a docs: Import 7.9.1 release notes from 7.9 branch 2011-01-07 13:39:40 -08:00
Henri Verbeet
82acc3b14c r600g: Also set const_offset if the buffer is not a user buffer in r600_upload_const_buffer(). 2011-01-07 18:21:12 +01:00
Henri Verbeet
f39dfa0ab0 r600g: Update some comments for Evergreen. 2011-01-07 18:21:12 +01:00
Henri Verbeet
97e2aa31c6 r600g: Split ALU clauses based on used constant cache lines. 2011-01-07 18:21:12 +01:00
Henri Verbeet
2a134534a6 r600g: Consistently use the copy of the alu instruction in r600_bc_add_alu_type(). 2011-01-07 18:21:12 +01:00
Henri Verbeet
8273921b7a r600g: Store kcache settings as an array. 2011-01-07 18:21:12 +01:00
Marek Olšák
be1af4394e r300g: derive user buffer sizes at draw time
This only uploads the [min_index, max_index] range instead of [0, userbuf size],
which greatly speeds up user buffer uploads.

This is also a prerequisite for atomizing vertex arrays in st/mesa.
2011-01-07 16:23:49 +01:00
Jian Zhao
2a7380e9c3 mesa: fix an error in uniform arrays in row calculating.
Fix the error in uniform row calculating, it may alloc one line
more which may cause out of range on memory usage, sometimes program
aborted when free the memory.

NOTE: This is a candidate for 7.9 and 7.10 branches.

Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-07 07:22:18 -07:00
Vinson Lee
db61b9ce39 mesa: Directly include mfeatures.h in files that perform feature tests. 2011-01-07 00:13:00 -08:00
Alex Deucher
7c320a869b r600c: fix up SQ setup in blit code for Ontario/NI 2011-01-07 03:10:50 -05:00
Dave Airlie
6d9ca78ef7 r600g: allow constant buffers to be user buffers.
This provides an upload facility for the constant buffers since Marek's
constants in user buffers changes.

gears at least work on my evergreen now.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2011-01-07 10:35:41 +10:00
Alex Deucher
7b97bdba40 r600c: add support for NI asics 2011-01-06 18:40:17 -05:00
Alex Deucher
f54366bcf6 r600g: add support for NI (Northern Islands) GPUs
This adds support for Barts, Turks, and Caicos asics.
2011-01-06 18:05:16 -05:00
Kenneth Graunke
e31defc825 i965: Rename various gen6 #defines to match the documentation.
This should make it easier to cross-reference the code and hardware
documentation, as well as clear up any confusion on whether constants
like CMD_3D_WM_STATE mean WM_STATE (pre-gen6) or 3DSTATE_WM (gen6+).

This does not rename any pre-gen6 defines.
2011-01-06 13:56:26 -08:00
Jakob Bornecrantz
ff0f087513 svga: Ensure that the wrong vdecls don't get used in swtnl path
The draw module set new state that didn't require swtnl which caused need_swtnl to
be unset. This caused the call from to svga_update_state(svga, SVGA_STATE_SWTNL_DRAW)
from the vbuf backend to overwrite the vdecls we setup there to be overwritten with
the real buffers vdecls.
2011-01-06 20:09:07 +00:00
Ian Romanick
f2d0f776b1 glsl: Refresh autogenerated lexer and parser files.
For the previous commit.
2011-01-06 10:53:38 -08:00
Ian Romanick
86b4398cd1 glsl: Support the 'invariant(all)' pragma
Previously the 'STDGL invariant(all)' pragma added in GLSL 1.20 was
simply ignored by the compiler.  This adds support for setting all
variable invariant.

In GLSL 1.10 and GLSL ES 1.00 the pragma is ignored, per the specs,
but a warning is generated.

Fixes piglit test glsl-invariant-pragma and bugzilla #31925.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-06 10:49:56 -08:00
Ian Romanick
e942f32836 glsl: Allow less restrictive uses of sampler array indexing in GLSL <= 1.20
GLSL 1.10 and 1.20 allow any sort of sampler array indexing.
Restrictions were added in GLSL 1.30.  Commit f0f2ec4d added support
for the 1.30 restrictions, but it broke some valid 1.10/1.20 shaders.
This changes the error to a warning in GLSL 1.10, GLSL 1.20, and GLSL
ES 1.00.

There are some spurious whitespace changes in this commit.  I changed
the layout (and wording) of the error message so that all three cases
would be similar.  The 1.10/1.20 and 1.30 text is the same.  The only
difference is that one is an error, and the other is a warning.  The
GLSL ES 1.00 wording is similar but not quite the same.

Fixes piglit test
spec/glsl-1.10/compiler/constant-expressions/sampler-array-index-02.frag
and bugzilla #32374.
2011-01-06 10:06:59 -08:00
Marek Olšák
c60f1d8b00 r300g: fix corruption when nr_cbufs==0 and multiwrites enabled
https://bugs.freedesktop.org/show_bug.cgi?id=32634
2011-01-06 19:05:31 +01:00
Marek Olšák
6125cbe983 r300g: remove the buffer range checking
It's no longer needed because the upload buffer remains mapped while the CS
is being filled (openarena, ut2004 and others that this code was for do not
use VBOs by default).
2011-01-06 16:59:32 +01:00
Marek Olšák
31afa7616e r300g: skip buffer validation of upload buffers when appropriate
because the upload buffers are reused for subsequent draw operations.
2011-01-06 16:51:54 +01:00
Marek Olšák
45b51a9e70 util: add comments to u_upload_mgr and u_inlines 2011-01-06 16:16:30 +01:00
Marek Olšák
984d64881f vbo: remove a redundant call to _ae_invalidate_state
It's called in vbo_exec_invalidate_state too.
2011-01-06 16:16:30 +01:00
Marek Olšák
009cecf246 st/mesa: remove unused members in st_context
What were these for?
2011-01-06 16:16:30 +01:00
Marek Olšák
92209314df tgsi: remove redundant name tables from tgsi_text, use those from tgsi_dump
I also specified the array sizes in the header so that one can use
the Elements macro on it.
2011-01-06 16:16:30 +01:00
Marek Olšák
3c9aa3a7b1 gallium: drivers should reference vertex buffers
So that a state tracker can unreference them after set_vertex_buffers.
2011-01-06 16:16:29 +01:00
Marek Olšák
58c5e782e3 st/mesa: optimize constant buffer uploads
The overhead of resource_create, transfer_inline_write, and resource_destroy
to upload constant data is very visible with some apps in sysprof, and
as such should be eliminated.

My approach uses a user buffer to pass a pointer to a driver. This gives
the driver the freedom it needs to take the fast path, which may differ
for each driver.

This commit addresses the same issue as Jakob's one that suballocates out
of a big constant buffer, but it also eliminates the copy to the buffer.
2011-01-06 16:16:29 +01:00
Marek Olšák
5adcd9c911 st/mesa: do sanity checks on states only in debug builds 2011-01-06 16:16:29 +01:00
Marek Olšák
06286110b4 u_upload_mgr: new features
- Added a parameter to specify a minimum offset that should be returned.
  r300g needs this to better implement user buffer uploads. This weird
  requirement comes from the fact that the Radeon DRM doesn't support negative
  offsets.

- Added a parameter to notify a driver that the upload flush occured.
  A driver may skip buffer validation if there was no flush, resulting
  in a better performance.

- Added a new upload function that returns a pointer to the upload buffer
  directly, so that the buffer can be filled e.g. by the translate module.
2011-01-06 16:16:29 +01:00
Marek Olšák
8b7bd3ce88 u_upload_mgr: keep the upload buffer mapped until it is flushed
The map/unmap overhead can be significant even though there is no waiting on busy
buffers. There is simply a huge number of uploads.

This is a performance optimization for Torcs, a car racing game.
2011-01-06 16:16:29 +01:00
Pierre Allegraud
8fd8de3995 mesa: fix build for NetBSD
See http://bugs.freedesktop.org/show_bug.cgi?id=32859

NOTE: This is a candidate for the 7.9 and 7.10 branches.

Signed-off-by: Brian Paul <brianp@vmware.com>
2011-01-06 08:00:01 -07:00
Brian Paul
1384aea50f glext: upgrade to version 67 2011-01-06 07:56:00 -07:00
Vinson Lee
ab564b516e mesa: Clean up header file inclusion in version.c.
Include imports.h directly instead of indirectly through context.h.
version.c does use any symbols that are added by context.h.
2011-01-06 00:45:08 -08:00
Vinson Lee
84ebd8e2d7 nvc0: Fix typo of nvc0_mm.c in SConscript. 2011-01-06 00:06:38 -08:00
Vinson Lee
becd98018b mesa: bump version to 7.11 2011-01-05 23:27:30 -08:00
Vinson Lee
0117da40cd mesa: Include mtypes.h in files that use gl_context struct.
Directly include mtypes.h if a file uses a gl_context struct. This
allows future removal of headers that are not strictly necessary but
indirectly include mtypes.h for a file.
2011-01-05 23:11:54 -08:00
Zou Nan hai
a728646fb5 i965: skip too small size mipmap
this fixes doom3 crash.
2011-01-06 11:36:23 +08:00
Eric Anholt
d60145d06d i915: Fix build for previous commit. 2011-01-05 18:28:13 -08:00
Eric Anholt
7ce6517f3a intel: Always allocate miptrees from level 0, not tObj->BaseLevel.
BaseLevel/MaxLevel are mostly used for two things: clamping texture
access for FBO rendering, and limiting the used mipmap levels when
incrementally loading textures.  By restricting our mipmap trees to
just the current BaseLevel/MaxLevel, we caused reallocation thrashing
in the common case, for a theoretical win if someone really did want
just levels 2..4 or whatever of their texture object.

Bug #30366
2011-01-05 18:23:54 -08:00
Eric Anholt
01b70c0628 intel: Drop unused first/lastlevel args to miptree_create_for_region.
We're always making a single-level, 0-baselevel miptree.
2011-01-05 18:11:31 -08:00
Vinson Lee
f84573d039 swrast: Include mtypes.h in s_triangle.c.
Include mtypes.h for gl_context symbol.
2011-01-05 17:46:39 -08:00
Vinson Lee
20d85865ec st/mesa: Include mtypes.h in st_cb_drawpixels.c.
Include mtypes.h for gl_context symbol.
2011-01-05 16:34:29 -08:00
Eric Anholt
1b18b45d79 intel: Clarify first_level/last_level vs baselevel/maxlevel by deletion.
This has always been ugly about our texture code -- object base/max
level vs intel object first/last level vs image level vs miptree
first/last level.  We now get rid of intelObj->first_level which is
just tObj->BaseLevel, and make intelObj->_MaxLevel clearly based off
of tObj->_MaxLevel instead of duplicating its code (incorrectly, as
image->MaxLog2 only considers width/height and not depth!)
2011-01-05 16:11:30 -08:00
Eric Anholt
9b7f57b18e mesa: Consider textures incomplete when maxlevel < baselevel.
See section 3.8.10 of the GL 2.1 specification.  There's no way to do
anything sane with that, and drivers would get all sorts of angry.
2011-01-05 15:51:37 -08:00
Eric Anholt
39cc0ee3ea i915: Enable LOD preclamping on 8xx like on 915/965.
Fixes lodclamp-between and lodclamp-between-max.
2011-01-05 14:50:27 -08:00
Eric Anholt
973e821a63 i915: Implement min/max lod clamping in hardware on 8xx.
This avoids 8xx-specific texture relayout for min/max lod changes.
One step closer to avoiding relayout for base/maxlevel changes!
2011-01-05 14:50:24 -08:00
Eric Anholt
6f31da584f intel: Drop TEXTURE_RECTANGLE check in miptree layout setup.
It's already handled by our non-mipmapped MinFilter, since
TEXTURE_RECTANGLE is always NEAREST or LINEAR.
2011-01-05 14:45:16 -08:00
Eric Anholt
8f0005bfd5 intel: Clean up redundant setup of firstLevel.
It's always BaseLevel (since TEXTURE_RECTANGLE's baselevel can't be
changed from 0), except for 8xx minlod hilarity.
2011-01-05 14:45:16 -08:00
Eric Anholt
e2ee0c55d3 intel: Drop a check for GL_TEXTURE_4D_SGIS.
The SGIS_texture4D extension was thankfully never completed, so we
couldn't implement it if we wanted to.
2011-01-05 14:45:16 -08:00
Vinson Lee
d5435b3f0c swrast: Remove unnecessary headers. 2011-01-05 13:47:02 -08:00
Eric Anholt
332a90e101 i965: Simplify the renderbuffer setup code.
It was quite a mess by trying to do NULL renderbuffers and real
renderbuffers in the same function.  This clarifies the common case of
real renderbuffers.
2011-01-05 10:28:10 -08:00
Michel Dänzer
c7c1e5338c st/xorg: Flesh out colour map support and support depth 8. 2011-01-05 11:41:56 +01:00
Xiang, Haihao
266d8eed69 i965: use BLT to clear buffer if possible on Sandybridge
This fixes https://bugs.freedesktop.org/show_bug.cgi?id=32713
2011-01-05 14:12:40 +08:00
Eric Anholt
06cb1a6a5b i965: Add support for SRGB DXT1 formats.
This makes
fbo-generatemipmap-formats GL_EXT_texture_sRGB-s3tc
match
fbo-generatemipmap-formats GL_EXT_texture_compression_s3tc

and swrast in bad DXT1_RGBA alpha=0 handling, but it means we won't
unpack and repack someone's textures into uncompressed SARGB8 format.
2011-01-04 16:43:35 -08:00
Vinson Lee
5a3f31575b glcpp: Add test for recursive #define. 2011-01-04 16:39:19 -08:00
Eric Anholt
3488b14a04 mesa: Fix the baseFormat for GL_COMPRESSED_SLUMINANCE_EXT.
It's just LUMINANCE, not LUMINANCE_ALPHA.  Fixes
fbo-generatemipmap-formats GL_EXT_texture_sRGB-s3tc assertion failure
when it tries to pack the L8 channels into LUMINANCE_ALPHA and wonders
why it's trying to do that.
2011-01-04 15:25:35 -08:00
Eric Anholt
5dbb856e96 intel: Merge our choosetexformat fallbacks into core.
We now share the type/format -> MESA_FORMAT_* mappings with software
mesa, and the core supports most of the fallbacks hardware drivers
will want.
2011-01-04 14:42:54 -08:00
Eric Anholt
001d944fd5 mesa: Make _mesa_choose_tex_format() choose formats out of a supported table.
Right now this is just tweaking the current code to look at the table.
Choosing actually supported formats will come later.
2011-01-04 14:14:17 -08:00
Vinson Lee
6530944b50 glcpp: Add division by zero test cases. 2011-01-04 13:18:19 -08:00
Marek Olšák
50630f9016 mesa: preserve 10 bits of precision in the texstore general path for ARGB2101010
Use make_temp_float_image instead of _make_temp_chan_image.
The latter converts the texture to 8 bits/component, losing 2 bits.
2011-01-04 21:59:56 +01:00
Marek Olšák
73e8a27387 st/mesa: advertise GL_ARB_half_float_pixel
This extension doesn't appear to need any driver-specific parts.
2011-01-04 21:59:56 +01:00
Marek Olšák
8543902bfb r300/compiler: disable the rename_regs pass for loops
This workaround fixes rendering of kwin thumbnails.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-04 21:58:51 +01:00
Alex Deucher
f28bb6bdd1 r600g: support up to 64 shader constants
From the r600 ISA:
Each ALU clause can lock up to four sets of constants
into the constant cache.  Each set (one cache line) is
16 128-bit constants. These are split into two groups.
Each group can be from a different constant buffer
(out of 16 buffers). Each group of two constants consists
of either [Line] and [Line+1] or [line + loop_ctr]
and [line + loop_ctr +1].

For supporting more than 64 constants, we need to
break the code into multiple ALU clauses based
on what sets of constants are needed in that clause.

Note: This is a candidate for the 7.10 branch.

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2011-01-04 15:37:12 -05:00
Tom Stellard
e96e86d07b r300/compiler: Fix black terrain in Civ4
rc_inst_can_use_presub() wasn't checking for too many RGB sources in
Alpha instructions or too many Alpha sources in RGB instructions.

Note: This is a candidate for the 7.10 branch.
2011-01-04 11:25:27 -08:00
Chad Versace
68d06b1454 glsl: Check that integer vertex outputs are qualified with flat
Perform this check in ast_declarator_list::hir().

From section 4.3.6 of the GLSL 1.30 spec:
   "If a vertex output is a signed or unsigned integer or integer
   vector, then it must be qualified with the interpolation
   qualifier
   flat."
2011-01-04 10:49:10 -08:00
Chad Versace
b84e3f570f glsl: Allow redeclaration of gl_Color and its variants in GLSL 1.30
Allow redeclaration of the following built-in variables with an
interpolation qualifier in language versions >= 1.30:
   * gl_FrontColor
   * gl_BackColor
   * gl_FrontSecondaryColor
   * gl_BackSecondaryColor
   * gl_Color
   * gl_SecondaryColor

See section 4.3.7 of the GLSL 1.30 spec.
2011-01-04 10:49:10 -08:00
Chad Versace
4a62a1c366 glsl: Comment ast_type_qualifier.flags 2011-01-04 10:49:10 -08:00
Eric Anholt
b7b2791c6b intel: When validating an FBO's combined depth/stencil, use the given FBO.
We were looking at the current draw buffer instead to see whether the
depth/stencil combination matched.  So you'd get told your framebuffer
was complete, until you bound it and went to draw and we decided that
it was incomplete.
2011-01-04 10:04:19 -08:00
Eric Anholt
0ea49380e2 intel: Fix segfaults from trying to use _ColorDrawBuffers in FBO validation.
The _ColorDrawBuffers is a piece of computed state that gets for the
current draw/read buffers at _mesa_update_state time.  However, this
function actually gets used for non-current draw/read buffers when
checking if an FBO is complete from the driver's perspective.  So,
instead of trying to just look at the attachment points that are
currently referenced by glDrawBuffers, look at all attachment points
to see if they're driver-supported formats.  This appears to actually
be more in line with the intent of the spec, too.

Fixes a segfault in my upcoming fbo-clear-formats piglit test, and
hopefully bug #30278
2011-01-04 10:04:15 -08:00
Christoph Bumiller
cd1cf78828 Merge remote branch 'origin/nvc0' 2011-01-04 18:20:05 +01:00
Brian Paul
c94996f057 st/mesa: skip glDrawPixels/glBitmap-related code for ES build
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=32560
2011-01-04 08:28:17 -07:00
Christoph Bumiller
4884ca5f67 nvc0: fix index size method value for u8 indices 2011-01-04 16:16:52 +01:00
Christoph Bumiller
2f08d872b2 nvc0: set the correct FP header bit for multiple colour outputs 2011-01-04 16:14:58 +01:00
Christoph Bumiller
6de94e1012 nvc0: delete memory caches and fence on screen destruction 2011-01-04 16:14:46 +01:00
Christoph Bumiller
471025929c nvc0: use mov instead of ld for scalar const loads 2011-01-04 16:14:42 +01:00
Christoph Bumiller
c024c1d75f nvc0: fix resource unmap after vertex push 2011-01-04 16:14:38 +01:00
Christoph Bumiller
e1e29395df nvc0: use the proper typed opcodes in constant folding 2011-01-04 16:14:33 +01:00
Christoph Bumiller
92caa65c24 nvc0: demagic GP invocation count bitfield 2011-01-04 16:14:26 +01:00
Christoph Bumiller
997f84ff4e nvc0: rewrite the 9097 GRAPH macros 2011-01-04 16:13:42 +01:00
Brian Paul
6a102074bb i965g: include brw_types.h instead of GL/gl.h
Alternately, some search&replace could be used to replace all
occurances of GLint with int, etc. in the driver.
2011-01-04 07:24:38 -07:00
Brian Paul
c8a6a8bf2c osmesa: pass context to _mesa_update_framebuffer_visual()
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=32814
2011-01-04 07:13:52 -07:00
Vinson Lee
90b7a4cc1a llvmpipe: Include p_compiler.h in lp_scene_queue.h.
Include p_compiler.h for boolean symbol.
2011-01-04 01:08:47 -08:00
Vinson Lee
f67dad7b82 llvmpipe: Include p_compiler.h in lp_perf.h.
Include p_compiler.h for int64_t symbol.
2011-01-04 01:01:18 -08:00
Vinson Lee
c72eb72ca6 llvmpipe: Include missing headers in lp_bld_depth.h
Include p_compiler.h for boolean symbol.
Include p_state.h for pipe_stencil_state symbol.
2011-01-04 00:54:14 -08:00
Vinson Lee
deb9a6ae79 llvmpipe: Include p_compiler.h in lp_bld_alpha.h.
Include p_compiler.h for boolean symbol.
Add forward declaration for gallivm_state struct.
2011-01-04 00:50:48 -08:00
Vinson Lee
7bfc54ea5d i965g: Include p_compiler.h in intel_decode.h.
Include p_compiler.h for uint32_t symbol.
2011-01-04 00:44:23 -08:00
Vinson Lee
cf15e9b343 i965g: Include gl.h in intel_structs.h.
Include gl.h for OpenGL symbols.
2011-01-04 00:41:10 -08:00
Zhenyu Wang
bea6539abf i965: Use last vertex convention for quad provoking vertex on sandybridge
Until we know how hw converts quads to polygon in beginning of
3D pipeline, for now unconditionally use last vertex convention.

Fix glean/clipFlat case.
2011-01-04 15:56:26 +08:00
Vinson Lee
9095947fa7 mesa: Include mtypes.h in renderbuffer.h.
Include mtypes.h for gl_buffer_index symbol.

This is a follow-up to commit 65da73c5f8.
2011-01-03 22:42:12 -08:00
Zhenyu Wang
1df795f958 i965: Correct comment for gen6 fb write control message setting
Remove incorrect headless comment for gen6 fb write message.
Note current SIMD16 mode has already done right for control message.
2011-01-04 13:57:16 +08:00
Zhenyu Wang
9977297ad9 i965: Fix provoking vertex select in clip state for sandybridge
Triangle fan provoking vertex for first convention should be
'vertex 1' in sandybridge clip state.

Partly fix glean/clipFlat case
2011-01-04 13:51:39 +08:00
Brian Paul
7bd2c5d1f9 mesa: fix AL44 texture fetch function nybble -> float conversion
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=32804
2011-01-03 17:16:48 -07:00
Eric Anholt
bd8e658884 intel: Bump libdrm configure.ac requirement for the gen6 BLT ring support. 2011-01-03 15:04:19 -08:00
Eric Anholt
30fef21aa3 intel: Use tri clears when we don't know how to blit clear the format.
Bug #32207.  Fixes ARB_texture_rg/fbo-clear-formats (see my
fbo-clear-formats piglit branch currently)
2011-01-03 13:28:26 -08:00
Eric Anholt
5f13c39484 mesa: Also report the number of renderbuffer alpha bits for GL_LUMINANCE_ALPHA.
Noticed by code inspection.
2011-01-03 13:28:26 -08:00
Eric Anholt
f45aea0ec9 mesa: Also report renderbuffer red/green size for GL_RED and GL_RG.
Noticed by code inspection.
2011-01-03 13:28:26 -08:00
Eric Anholt
059cca92a8 mesa: Use the common logic for "is this baseformat a color format?"
When figuring out whether a renderbuffer should be used to set the
visual bits of an FBO, we were missing important baseformats like
GL_RED, GL_RG, and GL_LUMINANCE.
2011-01-03 13:28:24 -08:00
Eric Anholt
beac6ee62a mesa: Allow color renderbuffers besides just RGB and RGBA.
We did so already for textures to do ARB_fbo's
GL_ALPHA/GL_LUMINANCE/etc. support and for ARB_texture_rg's GL_RED and
GL_RG, but this path was missed.
2011-01-03 13:22:38 -08:00
Eric Anholt
2d29349c00 mesa: Update comment about the list of BaseFormats for gl_formats. 2011-01-03 13:22:38 -08:00
Eric Anholt
94ed481131 intel: Handle forced swrast clears before other clear bits.
Fixes a potential segfault on a non-native depthbuffer, and possible
accidental swrast fallback on extra color buffers.
2011-01-03 13:22:38 -08:00
Brian Paul
efbd33aff9 st/mesa: fix renderbuffer pointer check in st_Clear()
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=30694

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2011-01-03 14:01:41 -07:00
Brian Paul
65da73c5f8 mesa: s/GLuint/gl_buffer_index/ 2011-01-03 14:01:41 -07:00
Brian Paul
35266fbe4f st/mesa: 80-column wrapping 2011-01-03 14:01:41 -07:00
Brian Paul
337f6e7b0e st/mesa: 80-column wrapping 2011-01-03 14:01:41 -07:00
Chia-I Wu
ada9c78c29 autoconf: Fix --with-driver=xlib --enable-openvg.
st/egl should be enabled with --enable-openvg even the driver is xlib or
osmesa.  Also, GLX_DIRECT_RENDERING should not be defined because libdrm
is not checked.
2011-01-04 01:13:49 +08:00
Chia-I Wu
cba7786954 docs: Add an example for EGL_DRIVERS_PATH.
EGL_DRIVERS_PATH can be set to test EGL without installation.
2011-01-04 00:54:55 +08:00
Dave Airlie
fb03510738 radeon: fix build on non-KMS systems.
Reported on irc by adamk.
2011-01-03 06:03:44 +10:00
Kenneth Graunke
1d40cf57f8 glsl: Really remove unused "instructions" parameter.
I forgot about this file, and it didn't show up until I tried to do
"make builtins" from a clean build.
2011-01-01 12:29:24 -08:00
Kenneth Graunke
81168351a7 glsl: Remove unused "instructions" parameter.
I think was used long ago, when we actually read the builtins into the
shader's instruction stream directly, rather than creating a separate
shader and linking the two.  It doesn't seem to serve any purpose now.
2011-01-01 12:01:54 -08:00
Brian Paul
1eceb9d323 mapi: add missing newline in error message 2010-12-31 16:37:41 -07:00
Brian Paul
e227f4bf50 egl: add missing case in _eglError() 2010-12-31 09:14:25 -07:00
Henri Verbeet
59051ad443 st/mesa: Handle wrapped depth buffers in st_copy_texsubimage(). 2010-12-31 07:49:59 +01:00
Vinson Lee
8d79765feb util: Add forward declarations in u_index_modify.h. 2010-12-30 01:54:35 -08:00
Vinson Lee
8114cf9ad8 tgsi: Clean up header file inclusion in tgsi_text.h. 2010-12-30 01:51:27 -08:00
Vinson Lee
8bfb9061b7 graw: Include p_shader_tokens.h for tgsi_token struct. 2010-12-30 01:49:26 -08:00
Vinson Lee
20a0f34283 tgsi: Clean up header file inclusion in tgsi_sanity.h. 2010-12-30 01:40:53 -08:00
Vinson Lee
79fa5acf26 x86: Clean up header file inclusion in mmx.h. 2010-12-30 01:26:47 -08:00
Vinson Lee
a1cd093a72 tnl: Clean up header file inclusion in t_vertex.h. 2010-12-30 01:05:33 -08:00
Vinson Lee
43c291683c vbo: Clean up header file inclusion in vbo.h. 2010-12-30 00:57:03 -08:00
Vinson Lee
176a8359b9 tnl: Clean up header file inclusion in t_vp_build.h. 2010-12-30 00:50:56 -08:00
Vinson Lee
9db9761874 tnl: Clean up header file inclusion in tnl.h. 2010-12-30 00:46:13 -08:00
Ben Skeggs
5b0e5e7389 drm/nvc0: don't un-bind every subchannel on init
The initial values in the grctx are 0x0000 anyway, and re-binding them
all to 0x0000 destroys some init done by the nouveau drm.

Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2010-12-30 12:34:12 +10:00
Marek Olšák
76db330e2c util: add a way to store translated indices to a user memory in u_index_modify
I am about to use the upload buffer in r300g instead.
2010-12-29 18:32:41 +01:00
Marek Olšák
48ed458e87 r300g: support user buffers as constant buffers 2010-12-29 18:32:41 +01:00
Chih-Wei Huang
f189dfe9e9 mesa: fix compiling issues with gcc 4.4.x
Gcc 4.4 requires a class with virtual functions has to
define the virtual destructor.
2010-12-29 17:35:47 +08:00
Chia-I Wu
d1ccafa5b7 android: Enable OpenGL ES 2.0. 2010-12-29 16:56:47 +08:00
Eric Anholt
df4d83dca4 i965: Do lowering of array indexing of a vector in the FS.
Fixes a regression in ember since switching to the native FS backend,
and the new piglit tests glsl-fs-vec4-indexing-{2,3} for catching this.
2010-12-28 17:32:20 -08:00
Eric Anholt
54df8e48bc i965: Fix regression in FS comparisons on original gen4 due to gen6 changes.
Fixes 26 piglit cases on my GM965.
2010-12-28 15:35:00 -08:00
Eric Anholt
74dffb39c3 i965: Factor out the ir comparision to BRW_CONDITIONAL_* code. 2010-12-28 14:23:52 -08:00
Vinson Lee
f3319561a4 glcpp: Add negative tests for redefintions with valueless macros. 2010-12-27 23:20:35 -08:00
Dave Airlie
17004b3954 tgsi_dump: fix assert due to missing property name. 2010-12-28 16:52:19 +10:00
Marek Olšák
33e0b726e8 r300g: rename aos to vertex arrays 2010-12-28 04:52:36 +01:00
Marek Olšák
d9b84017e0 r300g: mark vertex arrays as dirty after a buffer_offset change
We shouldn't hit this bug in theory.

NOTE: This is a candidate for the 7.10 branch.
2010-12-28 04:40:05 +01:00
Zhenyu Wang
689aca7822 i965: Fix occlusion query on sandybridge
Clear target query buffer fixed occlusion query on sandybridge.

https://bugs.freedesktop.org/show_bug.cgi?id=32167
2010-12-28 11:11:40 +08:00
Zhenyu Wang
59fa8600d8 Revert "i965: upload multisample state for fragment program change"
This reverts commit de6fd527a5.

Revert this workaround as it seems the real trouble is caused by
lineloop, which doesn't require GS convert on sandybridge actually.
2010-12-28 09:36:43 +08:00
Kenneth Graunke
6bb1e4541e i965: Internally enable GL_NV_blend_square on ES2.
Hopefully should fix bug #32520.
2010-12-27 15:44:52 -08:00
Christoph Bumiller
0cb6d1a4eb nvc0: reference the vertex buffers 2010-12-27 21:00:40 +01:00
Christoph Bumiller
4fa429c876 nvc0: reenable some shader optimizations
CSE and constants folding.
2010-12-27 20:59:53 +01:00
Christoph Bumiller
a10b1c1204 nvc0: use VTX_ATTR for stride 0 vertex attributes 2010-12-27 13:59:43 +01:00
Christoph Bumiller
e4349027f6 nvc0: implement VRAM buffer transfers with bounce buffers 2010-12-27 13:57:46 +01:00
Christoph Bumiller
abd08f4c01 nvc0: init miptree transfer layer stride 2010-12-27 13:29:10 +01:00
Xiang, Haihao
b832ae8a4a i965: don't spawn GS thread for LINELOOP on Sandybridge
LINELOOP is converted to LINESTRIP at the beginning of the 3D pipeline.
This fixes https://bugs.freedesktop.org/show_bug.cgi?id=32596
2010-12-27 17:05:58 +08:00
Kenneth Graunke
634a7dce9c i965: Flatten if-statements beyond depth 16 on pre-gen6.
Gen4 and Gen5 hardware can have a maximum supported nesting depth of 16.
Previously, shaders with control flow nested 17 levels deep would
cause a driver assertion or segmentation fault.

Gen6 (Sandybridge) hardware no longer has this restriction.

Fixes fd.o bug #31967.
2010-12-27 00:59:31 -08:00
Kenneth Graunke
9ac6a9b2fa glsl: Support if-flattening beyond a given maximum nesting depth.
This adds a new optional max_depth parameter (defaulting to 0) to
lower_if_to_cond_assign, and makes the pass only flatten if-statements
nested deeper than that.

By default, all if-statements will be flattened, just like before.

This patch also renames do_if_to_cond_assign to lower_if_to_cond_assign,
to match the new naming conventions.
2010-12-27 00:59:31 -08:00
Christoph Bumiller
780fbecc20 nvc0: respond please inline to PIPE_SHADER_CAP_SUBROUTINES 2010-12-23 15:22:00 +01:00
Christoph Bumiller
96def0c314 nvc0: fix layer stride state 2010-12-23 15:21:36 +01:00
Christoph Bumiller
2c20aae233 nvc0: use most defs/decls from nouveau_pushbuf.h 2010-12-23 15:19:22 +01:00
Ben Skeggs
82e0a38eed nvc0: remove unused 'buf' parameter in pipe_buffer_unmap 2010-12-21 06:41:09 +10:00
Ben Skeggs
317a1445c8 nvc0: BEGIN_RING->BEGIN_RING_NI in a couple of places 2010-12-21 06:33:17 +10:00
Ben Skeggs
e4e1a85bf8 nvc0: fence.bo is mappable, mark it as such 2010-12-21 06:32:13 +10:00
Ben Skeggs
e52ebd6e85 Merge remote branch 'origin/master' into nvc0-new
Conflicts:
	src/gallium/drivers/nouveau/nouveau_winsys.h
2010-12-21 06:30:39 +10:00
Ben Skeggs
5c102dd94f nouveau: fix includes for latest libdrm
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2010-12-21 06:28:08 +10:00
Tom Fogal
cd9ed3da68 Regenerate gl_mangle.h.
NOTE: This is a candidate for the 7.10 branch.
2010-12-20 19:29:48 -07:00
Jerome Glisse
abe9ffc25c r600g: properly unset vertex buffer
Fix bug http://bugs.freedesktop.org/show_bug.cgi?id=32455

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-20 15:33:28 -05:00
Vinson Lee
a14f79f801 st/python: remove unused 'buf' parameter in pipe_buffer_unmap
This is a follow-up to commit ec51092a72.

Fixes SCons build.
2010-12-20 11:40:54 -08:00
Marek Olšák
ec51092a72 gallium: remove unused 'buf' parameter in pipe_buffer_unmap 2010-12-20 17:42:55 +01:00
Vinson Lee
c451aade88 st/mesa: Remove comment cruft from st_context.h.
This was unintentionally added by commit
1525fb4afe.
2010-12-20 01:24:26 -08:00
Vinson Lee
2dd788663a st/mesa: Clean up header file inclusion in st_cb_texture.h. 2010-12-20 01:15:04 -08:00
Vinson Lee
10eb0c39d5 st/mesa: Clean up header file inclusion in st_cb_readpixels.h. 2010-12-20 01:00:26 -08:00
Christoph Bumiller
9f2cf89957 nvc0: s/INLIN_RING/IMMED_RING 2010-12-19 22:53:47 +01:00
Christoph Bumiller
608b3c4432 nvc0: improve shader support for texturing
Fixed shadow and cube texture fetches, add array texture fetches.
2010-12-19 21:49:32 +01:00
Christoph Bumiller
ca5deb0c35 nvc0: adapt to array textures interface change 2010-12-19 21:48:39 +01:00
Christoph Bumiller
0f68236a24 Merge remote branch 'origin/master' into nvc0-new 2010-12-19 21:46:33 +01:00
Christoph Bumiller
d047168d81 nvc0: fix clipping with scissors/viewport
Also setup optional path to use proper primitive clipping instead,
which is probably slower.
2010-12-19 21:42:00 +01:00
Christoph Bumiller
e9de2a31a5 nvc0: use BIND_RING to set subchannel classes 2010-12-19 21:40:24 +01:00
Christoph Bumiller
f0f1cce962 nvc0: switch to the proper constants upload path
Makes things suddenly go surprisingly fast.
2010-12-19 21:38:42 +01:00
Christoph Bumiller
99f9a9727c nvc0: add the index buffer offset where missing 2010-12-19 21:33:37 +01:00
Marek Olšák
237880463d r300g: optimize the fallback for misaligned ushort indices 2010-12-19 04:05:34 +01:00
Vinson Lee
c87f82bc40 st/mesa: Clean up header file inclusion in st_cb_program.h. 2010-12-18 01:44:52 -08:00
Vinson Lee
ac09685d2a st/mesa: Clean up header file inclusion in st_cb_accum.h. 2010-12-18 01:28:18 -08:00
Vinson Lee
488e994ba9 mesa: Clean up header file inclusion in prog_statevars.h. 2010-12-18 01:16:53 -08:00
Dave Airlie
aa4d311873 mesa: fix queryobj whitespace.
Had done this before pushing but forgot to amend, doh.
2010-12-18 17:48:21 +10:00
Dave Airlie
ff7aa554a1 mesa/swrast/st: add ARB_occlusion_query2 support.
This gets my vote for most pointless extension of all time, I'm guessing
some driver could possibly optimise for this instead of counting it might
just get a true/false, but I'm not really sure.

need this to eventually advertise 3.3 despite its total uselessness.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-12-18 17:33:25 +10:00
Chia-I Wu
7048095513 mapi: Clean up sources.mk.
Rename MAPI_GLAPI_SOURCES to MAPI_UTIL_SOURCES.  Rename macro
MAPI_GLAPI_CURRENT to MAPI_MODE_UTIL.  Update the comments to make it
clear that mapi may be used in two ways and how.
2010-12-18 15:05:58 +08:00
Chia-I Wu
c17d4999f1 mapi: Clean up u_current interface.
Try not to use macros to make u_current.h appear to be glapi.h.  Use
u_current.h to implement glapi.h instead whenever possible.
2010-12-18 15:05:52 +08:00
Chia-I Wu
c7119e281b mapi: Add ABI-tag note.
TLS requires kernel >= 2.4.20.  Per glapi.
2010-12-18 14:46:10 +08:00
Kenneth Graunke
a954dbeb8c Refresh autogenerated file builtin_function.cpp.
NOTE: The 7.9 and 7.10 branches will need their builtins refreshed too.
Rather than cherry-picking this commit, run 'make builtins'.
2010-12-17 19:40:56 -08:00
Kenneth Graunke
d7423a6531 glsl/builtins: Compute the correct value for smoothstep(vec, vec, vec).
These mistakenly computed 't' instead of t * t * (3.0 - 2.0 * t).

Also, properly vectorize the smoothstep(float, float, vec) variants.

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2010-12-17 19:29:22 -08:00
José Fonseca
3f94d96fce gallivm: Cleanup util_format_xxx_fetch_xxx call generation.
No need to register function prototypes in the module now that we call
the C function pointer directly -- less LLVM objects lying around.

Limited testing with lp_test_format.
2010-12-17 20:14:31 +00:00
Kenneth Graunke
5c229e5fbd glsl: Expose a public glsl_type::void_type const pointer.
This is analogous to glsl_type::int_type and all the others.
2010-12-17 10:55:17 -08:00
Marek Olšák
daffaca53e r300g: finally fix the texture corruption on r3xx-r4xx
Even though a bound texture stays bound when calling set_fragment_sampler_views,
it must be assigned a new cache region depending on the occupancy of other
texture units.

This fixes:
https://bugs.freedesktop.org/show_bug.cgi?id=28800

Thanks to Álmos <aaalmosss@gmail.com> for finding the bug in the code.

NOTE: This is a candidate for both the 7.9 and 7.10 branches.
2010-12-17 13:17:52 +01:00
Kenneth Graunke
d0f8eea9a0 Remove OES_compressed_paletted_texture from the ES2 extension list.
We don't support it.
2010-12-16 17:40:50 -08:00
Brian Paul
42a0967a36 softpipe: remove sp_tex_tile_cache_border_color()
With swizzling done at the end of texture sampling, we can greatly
simplify swizzling of the border color.

Fixes http://bugs.freedesktop.org/show_bug.cgi?id=32460
2010-12-16 18:18:57 -07:00
Brian Paul
9d9f8aba0a softpipe: fix depth texture sampling regression
We need to keep using the pipe_get_tile_swizzle() even though there's
no swizzling because we need to explicitly pass in the surface format.

Fixes http://bugs.freedesktop.org/show_bug.cgi?id=32459
2010-12-16 17:40:09 -07:00
Brian Paul
3ecf47af12 gallivm: fix copy&paste error from previous commit
Fixes piglit regression, http://bugs.freedesktop.org/show_bug.cgi?id=32452

NOTE: This is a candidate for the 7.10 branch
2010-12-16 14:30:39 -07:00
richard
fcc7024afe r600c : inline vertex format is not updated in an app, switch to use vfetch constants. For the 7.9 and 7.10 branches as well. 2010-12-16 15:52:55 -05:00
Eric Anholt
290a1141bc intel: Support glCopyTexImage() from XRGB8888 to ARGB8888.
The only mismatch between the two is that we have to clear the
destination's alpha to 1.0.  Fixes WOW performance on my Ironlake,
from a few frames a second to almost playable.
2010-12-16 10:48:19 -08:00
Eric Anholt
ec03b316b4 intel: Try to sanely check that formats match for CopyTexImage.
Before, we were going off of a couple of known (hopeful) matches
between internalFormats and the cpp of the read buffer.  Instead, we
can now just look at the gl_format of the two to see if they match.
We should avoid bad blits that might have been possible before, but
also allow different internalFormats to work without having to
enumerate each one.
2010-12-16 10:48:19 -08:00
Eric Anholt
e65c643792 intel: Drop commented intel_flush from copy_teximage.
The blit that follows appears in the command stream so it's serialized
with previous rendering.  Any queued vertices in the tnl layer were
already flushed up in mesa/main/.
2010-12-16 10:48:19 -08:00
Eric Anholt
99c7840b0c intel: Update renderbuffers before looking up CopyTexImage's read buffer.
Not fixing a particular bug, just noticed by code inspection.
2010-12-16 10:48:19 -08:00
Brian Paul
ee16e97ed1 gallivm: work around LLVM 2.6 bug when calling C functions
Create a constant int pointer to the C function, then cast it to the
function's type.  This avoids using trampoline code which seem to be
inadvertantly freed by LLVM in some situations (which leads to segfaults).
The root issue and work-around were found by José.

NOTE: This is a candidate for the 7.10 branch
2010-12-16 10:19:16 -07:00
Brian Paul
b7e150605d draw: s/varient/variant/ 2010-12-16 10:18:24 -07:00
Brian Paul
2bd9b386e6 svga: s/varient/variant/ 2010-12-16 10:18:24 -07:00
Brian Paul
bd75e4b8be i965g: s/varient/variant/ 2010-12-16 10:18:24 -07:00
Brian Paul
a185d439bd i915g: s/varient/variant/ 2010-12-16 10:18:24 -07:00
Brian Paul
f3955f6fcd softpipe: s/varient/variant 2010-12-16 10:18:23 -07:00
Brian Paul
aa5ba96d29 st/mesa: s/varient/variant 2010-12-16 10:18:23 -07:00
Eric Anholt
c52adfc2e1 i965: Set the alternative floating point mode on gen6 VS and WM.
This matches how we did the math instructions pre-gen6, though it
applies to non-math as well.

Fixes vp1-LIT test 2 (degenerate case: 0 ^ 0 -> 1)
2010-12-16 09:01:14 -08:00
Shuang He
2bd11ea119 i915: Fix INTEL_DEBUG=wm segmentation fault
The program should be disassembled after it's uploaded
2010-12-16 09:01:14 -08:00
Jakob Bornecrantz
23aa3c552c svga, glhd: Remove incorrect assert and add note
Stride can be lower then the size of the attribute.
But should probably be aligned to component size atleast for floats.
2010-12-16 09:44:02 +01:00
Jakob Bornecrantz
1138775d79 svga: Minor debug text fix 2010-12-16 09:44:02 +01:00
Jakob Bornecrantz
c28debbf6f svga: Remove debug print in winsys 2010-12-16 09:44:02 +01:00
Jakob Bornecrantz
486da2cfc0 svga: Correct spelling in swtnl backend 2010-12-16 09:44:01 +01:00
Jakob Bornecrantz
d7ff6dd09c svga: Fix newline at EOF 2010-12-16 09:36:51 +01:00
Jakob Bornecrantz
f75549a9d8 svga: Add Galahad and Softpipe to scons build 2010-12-16 08:53:26 +01:00
Jakob Bornecrantz
0967d77a9a wrapper: Flush pipe on unmap
For drivers that does DMA transfers instead of mapping directly
2010-12-16 08:53:26 +01:00
Jakob Bornecrantz
8b60bf4e9f wrapper: Fix width and height given to map and remove uneeded fields 2010-12-16 08:53:26 +01:00
Jakob Bornecrantz
b7a73c72a6 i915g: Ignore color0 writes all cbufs tgsi property 2010-12-27 00:18:55 +01:00
Chia-I Wu
9f2062fb12 st/egl: Fix eglChooseConfig when configs is NULL.
When configs is NULL, the app wants to know the number of matching
configs.
2010-12-26 23:35:50 +08:00
Vinson Lee
aa68dd9a49 swrast: Clean up header file inclusion in ss_vb.h. 2010-12-25 20:53:27 -08:00
Vinson Lee
da0bdc7cd5 swrast: Clean up header file inclusion in ss_triangle.h. 2010-12-25 20:48:29 -08:00
Vinson Lee
77d1d35163 swrast: Clean up header file inclusion in s_texfilter.h. 2010-12-25 20:28:17 -08:00
Vinson Lee
06fa986112 swrast: Clean up header file inclusion in s_texcombine.h. 2010-12-25 20:12:06 -08:00
Vinson Lee
77aaaf5fd5 swrast: Clean up header file inclusion in s_masking.h. 2010-12-25 20:03:33 -08:00
Vinson Lee
8ca0aca8dd nvfx: Remove unused variable.
Fixes this GCC warning.
nvfx_vbo.c: In function 'nvfx_idxbuf_emit':
nvfx_vbo.c:410: warning: unused variable 'eng3d'
2010-12-25 19:09:54 -08:00
Xavier Chantry
5f0f9f0486 nvfx: restore BEGIN_RING usage
Michel Hermier reported libdrm segfault (and kernel crash) on nv40 using
gallium :
http://www.mail-archive.com/nouveau@lists.freedesktop.org/msg06563.html

It turns out these were caused by some missing WAIT_RING (or wrong
computation of the WAIT_RING sizes). Unlike all other libdrm_nouveau users,
nvfx gallium tried to use a mininum calls of WAIT_RING, one WAIT_RING could
apply to many methods for different code paths and spread across several
functions. This made it too tricky to find out what the missing or wrong
WAIT_RING was.

By restoring BEGIN_RING, we force one WAIT_RING per method, and it's much
easier to check if the free size required in the pushbuffer is correct.  As
curro said, "let's keep it simple for the maintainers until the big
bottlenecks are gone"

Benchmarked on nv35 with openarena, nexuiz and ut2004 and no performance
regression.

The core of this patch was made with Coccinelle, with minor manual fixes
made on top.

Tested-by: Michel Hermier <hermier@frugalware.org>
Signed-off-by: Francisco Jerez <currojerez@riseup.net>
2010-12-25 20:37:39 +01:00
Eric Anholt
b01b73c482 intel: Only do frame throttling at glFlush time when using frontbuffer.
This is the hack for input interactivity of frontbuffer rendering
(like we do for backbuffer at intelDRI2Flush()) by waiting for the n-2
frame to complete before starting a new one.  However, for an
application doing multiple contexts or regular rebinding of a single
context, this would end up lockstepping the CPU to the GPU because
every unbind was considered the end of a frame.

Improves WOW performance on my Ironlake by 48.8% (+/- 2.3%, n=5)
2010-12-25 09:06:52 -08:00
Marek Olšák
b606c8a015 r300g: simplify buffer_transfer_inline_write 2010-12-25 16:07:13 +01:00
Marek Olšák
7e752760d4 r300g: simplify the code for buffer uploads 2010-12-25 16:07:13 +01:00
Marek Olšák
9c448817f7 r300g: user index buffers are always aligned 2010-12-25 16:07:13 +01:00
Marek Olšák
b10bff1135 r300g: increase the size of upload buffers 2010-12-25 16:07:13 +01:00
Vinson Lee
ecc6b7c002 swrast: Clean up header file inclusion in s_logic.h. 2010-12-24 20:43:35 -08:00
Vinson Lee
8dfeb98eb1 swrast: Clean up header file inclusion in s_fragprog.h. 2010-12-24 20:34:53 -08:00
Vinson Lee
3e2ea145b1 swrast: Clean up header file inclusion in s_span.h. 2010-12-24 20:17:18 -08:00
Vinson Lee
7d5f5d3843 swrast: Clean up header file inclusion in s_fog.h. 2010-12-24 20:11:44 -08:00
Vinson Lee
ec891d78a0 swrast: Clean up header file inclusion in s_depth.h. 2010-12-24 20:06:11 -08:00
Vinson Lee
b3c59acca6 swrast: Clean up header file inclusion in s_blend.h. 2010-12-24 19:55:42 -08:00
Vinson Lee
c9a0e25919 swrast: Clean up header file inclusion in s_atifragshader.h. 2010-12-24 19:47:54 -08:00
Vinson Lee
eadb90f045 swrast: Clean up header file inclusion in s_alpha.h. 2010-12-24 19:30:38 -08:00
Vinson Lee
ebe95d3796 swrast: Clean up header file inclusion in s_accum.h. 2010-12-24 19:25:30 -08:00
Vinson Lee
775e373dd9 swrast: Clean up header file inclusion in s_aatriangle.h. 2010-12-24 18:48:00 -08:00
Vinson Lee
d59075303a swrast: Clean up header file inclusion in s_aaline.h. 2010-12-24 18:35:10 -08:00
Vinson Lee
499c77edf1 st/mesa: Clean up header file inclusion in st_mesa_to_tgsi.h. 2010-12-24 18:27:55 -08:00
Vinson Lee
b20dac4e2d st/mesa: Clean up header file inclusion in st_gen_mipmap.h. 2010-12-24 18:06:20 -08:00
Chia-I Wu
65e8f81110 docs/egl: Update egl.html.
Various updates and a new section about packaging.
2010-12-25 02:53:49 +08:00
Marek Olšák
88550083b3 r300g/swtcl: re-enable LLVM
Based on a patch from Drill <drill87@gmail.com>.

NOTE: This is a candidate for the 7.10 branch.
2010-12-24 18:38:03 +01:00
Henri Verbeet
8fc6c5fb36 r600g: r600_blit_uncompress_depth() can't fail. 2010-12-24 11:41:26 +01:00
Henri Verbeet
878519b73e r600g: Get rid of r600_blit_uncompress_depth_ptr. 2010-12-24 11:41:25 +01:00
Chia-I Wu
a91a337a7d mapi: Move mapi_func typedef to entry.h.
Make it clear that entry.h does not depend on stub.h.
2010-12-24 17:33:50 +08:00
Chia-I Wu
a33e9f049d mapi: Define MAPI_TMP_DEFINES only when needed.
Since struct mapi_table is opaque, MAPI_TMP_DEFINES is not needed in
table.h.
2010-12-24 17:33:49 +08:00
Chia-I Wu
e6a7ef3ca6 mapi: Add and use entry_get_public.
Given a dispatch slot, entry_get_public returns the address of the
corresponding public entry point.  There may be more than one of them.
But since they are all equivalent, it is fine to return any one of them.

With entry_get_public, the address of any public entry point can be
calculated at runtime when an assembly dispatcher is used.  There is no
need to have a mapping table in such case.  This omits the unnecessary
relocations from the binary.
2010-12-24 17:33:49 +08:00
Chia-I Wu
897bff6773 mapi: Make struct mapi_stub opaque.
Add accessors for struct mapi_stub and make it opaque.
2010-12-24 17:28:52 +08:00
Chia-I Wu
0c205484bf mapi: Allow blocks to be disabled from the output.
For example, a printer may ask not to output noop dispatch table.
2010-12-24 17:28:52 +08:00
Chia-I Wu
b765b1269f mapi: Fix hidden entries.
Hidden entries are just like normal entries except that they are not
exported.  Since it is not always possible to hide them, and two hidden
aliases can share the same entry, the name of hidden aliases are mangled
to '_dispatch_stub_<slot>'.
2010-12-24 17:28:52 +08:00
Chia-I Wu
52ca153349 mapi: Add "handcode" attribute to the script.
Entries with handcode attribute will be handled normally, except no
entry point will be generated for them.
2010-12-24 17:28:52 +08:00
Chia-I Wu
8eee1d522e mapi: Minor ABIPrinter refactoring.
Split out function name generation from _c_decl to _c_function, and use
it everywhere.  Add an optional 'export' argument to _cdecl.  It is
prepended to the returned string.
2010-12-24 17:28:51 +08:00
Chia-I Wu
86d29eab48 mapi: Store alias entry instead of alias name.
An entry can hold more info than plain name.
2010-12-24 17:28:51 +08:00
Dave Airlie
876effb0e7 r600g: hack around property unknown issues.
should fix https://bugs.freedesktop.org/show_bug.cgi?id=32619

Need to add proper support for properties later.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-12-24 17:34:40 +10:00
Dave Airlie
ac38ad6156 r300g: turn back on rv530 hiz.
still needs RADEON_HYPERZ=y env var.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-12-24 15:46:12 +10:00
Dave Airlie
7a5fac56b2 r300g: hyperz fixing typo.
Really no idea why I didn't see this before, but these values were opposite
the register spec.

this seems to fix rv530 HiZ on my laptop, will reenable in next commit.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-12-24 15:46:11 +10:00
Vinson Lee
a57e2c436b mesa: Assert format is not MESA_FORMAT_COUNT in _mesa_format_to_type_and_comps.
The case of format being MESA_FORMAT_COUNT should never occur.
2010-12-23 18:19:42 -08:00
Xiang, Haihao
dc987adc9f i965: use align1 access mode for instructions with execSize=1 in VS
All operands must be 16-bytes aligned in aligh16 mode. This fixes l_xxx.c
in oglconform.
2010-12-24 09:51:44 +08:00
Xiang, Haihao
8249321604 i965: fix register region description
This fixes
 brw_eu_emit.c:179: validate_reg: Assertion `width == 1' failed.
2010-12-24 09:51:22 +08:00
Vinson Lee
1039f36c47 r600g: Rearrange print order of outputs of R600_ERR. 2010-12-23 17:26:36 -08:00
Vinson Lee
38eff56f7e mesa: Assert _mesa_DeleteFragmentShaderATI doesn't ever free static DummyShader. 2010-12-23 16:44:42 -08:00
Vinson Lee
7f178ffbf1 st/egl: Remove unnecessary header. 2010-12-23 16:23:53 -08:00
Vinson Lee
070f5da96d libgl-xlib: Remove unnecessary header. 2010-12-23 16:19:11 -08:00
Vinson Lee
075a807f43 r300g: Remove unnecessary header. 2010-12-23 16:05:28 -08:00
Dave Airlie
aaccb73276 tgsi_text: just parse as an integer (value is a boolean).
fixes warning reported by vlee on irc.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-12-24 09:29:19 +10:00
Vinson Lee
0b76255714 mapi: Remove unnecessary header. 2010-12-23 15:25:38 -08:00
Vinson Lee
bf4dffb8ef intel: Remove unnecessary headers. 2010-12-23 15:08:53 -08:00
Dave Airlie
4e52e8f746 r300g: add support for color0 writes to all bound color buffers.
Thanks to Marek Olšák for making my initial attempt actually work.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-12-24 07:19:58 +10:00
Dave Airlie
07498075b5 mesa/st: set the color write cbuf property for fragColor writes 2010-12-24 07:19:58 +10:00
Dave Airlie
2f4860f2ab softpipe: add support for color writes all color bufs property 2010-12-24 07:19:57 +10:00
Dave Airlie
c9c8a5ed02 gallium: add fragment shader property for color writes to all buffers. (v2)
For GL fragColor semantics we need to tell the pipe drivers that the fragment
shader color result is to be replicated to all bound color buffers, this
adds the basic TGSI + documentation.

v2: fix missing comma pointed out by Tilman on mesa-dev.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-12-24 07:19:57 +10:00
Vinson Lee
eccffe2328 i965: Remove unnecessary headers. 2010-12-23 11:54:29 -08:00
Vinson Lee
280750c5ca mesa: Fix #ifdef typo in _mesa_format_to_type_and_comps.
According to the comment, the warning should be for debug builds.
2010-12-23 11:32:16 -08:00
Marek Olšák
aedbf05d31 r300g: use a simpler fallback for misaligned ushort indices with triangles
If 'start' is odd, render the first triangle with indices embedded
in the command stream, which adds 3 to 'start' and makes it even.
Then continue with the fast path.
2010-12-23 16:54:59 +01:00
Marek Olšák
c420c0e7d6 r300g: add support for B2G3R3 texturing 2010-12-23 16:54:59 +01:00
Marek Olšák
bf7b6f60ae mesa: fix texel store functions for some float formats
These are copy-paste errors obviously.
2010-12-23 16:54:58 +01:00
Marek Olšák
4a710469e0 st/mesa: do not require all texture formats to be renderable
This is a bandaid on the problem that if some formats were not renderable
(like luminance_alpha), st/mesa fell back to some RGBA format, so basically
some non-renderable formats were actually not used at all. This is only
a problem with hardware drivers, softpipe can render to anything.

Instead, require only RGB8/RGBA8 to be renderable.
2010-12-23 16:54:58 +01:00
Marek Olšák
998657112b st/mesa: use the formats RGB233, ARGB2101010, AL44, AL1616, A16, L16, I16 2010-12-23 16:54:58 +01:00
Marek Olšák
a780490374 gallium: add new formats L16A16_UNORM, A16_UNORM, I16_UNORM, B2G3R3_UNORM 2010-12-23 16:54:58 +01:00
Marek Olšák
fd8aa7ac71 mesa: implement new texture format I16 2010-12-23 16:54:58 +01:00
Marek Olšák
bb5ace68ce mesa: implement new texture format L16 2010-12-23 16:54:58 +01:00
Marek Olšák
eb31837a0d mesa: implement new texture format A16 2010-12-23 16:54:58 +01:00
Marek Olšák
bae9d511f3 mesa: implement new texture format AL44
Radeon GPUs can do this. R600 can even do render-to-texture.
Packing and extracting aren't implemented, but we shouldn't hit them (I think).
Tested with swrast, softpipe, and r300g.
2010-12-23 16:54:58 +01:00
Marek Olšák
621e5254ef mesa: implement new texture format ARGB2101010
Radeon GPUs do support GL_RGB10_A2.
2010-12-23 16:54:58 +01:00
Marek Olšák
0a7b60f7ed st/mesa: if Z32 is unsupported, prefer Z24 to Z16 2010-12-23 16:54:58 +01:00
Marek Olšák
888e59fce8 st/mesa: use RGBA16 for RGB12 and RGB16
To provide enough precision if a user wants it.
2010-12-23 16:54:58 +01:00
Marek Olšák
3f9e78ac39 st/mesa: use DXT SRGB formats for COMPRESSED_SRGB
And also check if the formats are supported to return something meaningful
if compression cannot be used.
2010-12-23 16:54:57 +01:00
Eric Anholt
bf15ad3782 i965: Keep around a copy of the VS constant surface dumping code.
Just like everywhere else, I never trust my constant uploads to
correctly put constants in the right places, even though that's so
rarely where the issue is.
2010-12-23 01:32:44 -08:00
Eric Anholt
5dc53444c8 i965: Correct the dp_read message descriptor setup on g4x.
It's mostly like gen4 message descriptor setup, except that the sizes
of type/control changed to be like gen5.  Fixes 21 piglit cases on
gm45, including the regressions in bug #32311 from increased VS
constant buffer usage.
2010-12-23 01:32:43 -08:00
Zhenyu Wang
de6fd527a5 i965: upload multisample state for fragment program change
This makes conformance tests stable on sandybridge D0 to track
multisample state before SF/WM state.
2010-12-23 17:30:03 +08:00
Zhenyu Wang
845d651cf6 i965: Use MI_FLUSH_DW for blt ring flush on sandybridge
Old MI_FLUSH command is deprecated on sandybridge blt.
2010-12-23 17:29:46 +08:00
Vinson Lee
1e7bfcc707 st/mesa: Remove unnecessary header. 2010-12-23 01:03:32 -08:00
Vinson Lee
492afbce18 gallivm: Disable MMX-disabling code on llvm-2.9.
The disable-mmx option was removed in llvm-2.9svn by revisions 122188
and 122189.

Fixes FDO bug 32564.
2010-12-22 19:56:10 -08:00
Vinson Lee
adaa310e39 gallivm: Fix 'cast from pointer to integer of different size' warning.
Fixes this GCC warning.
lp_bld_const.h: In function 'lp_build_const_int_pointer':
lp_bld_const.h:137: warning: cast from pointer to integer of different size
2010-12-22 16:48:19 -08:00
Vinson Lee
38c8b034e2 i915g: Remove unnecessary header. 2010-12-22 00:57:52 -08:00
Vinson Lee
442fcd0620 llvmpipe: Remove unnecessary headers. 2010-12-22 00:55:41 -08:00
Vinson Lee
013fc33462 r300g: Remove unnecessary headers. 2010-12-22 00:52:05 -08:00
Vinson Lee
f39d0c791a svga: Remove unnecessary header. 2010-12-22 00:42:23 -08:00
Vinson Lee
a91128030e st/vega: Remove unnecessary headers. 2010-12-22 00:38:42 -08:00
Henri Verbeet
ca8b4ca478 r600g: Remove the unused "pframebuffer" field from r600_pipe_context. 2010-12-22 09:19:48 +01:00
Henri Verbeet
2fd718d560 r600g: r600_new() and r600_delete() are unused. 2010-12-22 09:19:48 +01:00
Zhenyu Wang
4374703a9b i965: explicit tell header present for fb write on sandybridge
Determine header present for fb write by msg length is not right
for SIMD16 dispatch, and if there're more output attributes, header
present is not easy to tell from msg length. This explicitly adds
new param for fb write to say header present or not.

Fixes many cases' hang and failure in GL conformance test.
2010-12-22 11:08:51 -05:00
Chia-I Wu
445cb9e53b st/egl: Assorted fixes for dri2_display_get_configs.
Set window_bit only when the visual id is greater than zero.  Correct
visual types.  Skip slow configs as they are not relevant.  Finally, do
not return duplicated configs.
2010-12-22 16:05:27 +08:00
Alex Deucher
341d048e45 r600g: remove useless switch statements
Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2010-12-22 01:30:41 -05:00
Chia-I Wu
a31e2e3312 st/egl: Fix eglCopyBuffers.
Flush before presenting.
2010-12-22 14:21:47 +08:00
Chia-I Wu
18bc427ade st/egl: Plug pbuffer leaks.
Unreference validated resources or remove unnecessary validations.
2010-12-22 14:12:33 +08:00
Chia-I Wu
0fb2dcc98f st/egl: Allow single-buffered pixmaps.
All single-buffered configs were ignored before to make sure
EGL_RENDER_BUFFER is settable for window surfaces.  It is better to
allow single-buffered configs and set EGL_WINDOW_BIT only for
double-buffered ones.  This way there can be single-buffered pixmaps.
2010-12-22 14:12:33 +08:00
Dave Airlie
f431e0452b r600g: drop unused code in evergreen.
this code was pretty much duplicated, thanks to Henri Verbeet on irc for
pointing it out.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-12-22 15:58:29 +10:00
Chia-I Wu
975b7ef92a st/egl: Remove native_config::samples.
Multisample buffers are never requested.
2010-12-22 13:22:36 +08:00
Chia-I Wu
3a93c34828 st/egl: Remove native_config::slow_config.
In direct rendering scenario, it is not needed until an EGLDisplay can
support both HW and SW pipe screens.
2010-12-22 13:22:36 +08:00
Chia-I Wu
0364c08d7f st/egl: Remove unnecessary egl_g3d_find_pixmap_config.
It was used to find a compatible config for a given pixmap.  Now that a
config is optional for pixmap surface creation, the function is not
needed.
2010-12-22 13:22:36 +08:00
Chia-I Wu
af767ee113 st/egl: Make config optional for create_pixmap_surface.
eglCopyBuffers or EGL_KHR_image_pixmap require creating a pixmap surface
without a config.  Make it just work without relying on
is_pixmap_supported.
2010-12-22 13:22:36 +08:00
Dave Airlie
2dd189a824 r600g: fix evergreen segfaults.
evergreen was crashing running even gears here.

This is a 7.10 candidate if its broken the same.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-12-22 14:54:17 +10:00
Marek Olšák
cb4f367b26 r300g: fix precision issues with B10G10R10A2 2010-12-22 03:39:37 +01:00
Marek Olšák
2a95542088 r300g: support B10G10R10A2 render targets only with DRM 2.8.0 or later versions 2010-12-22 03:39:37 +01:00
Eric Anholt
4fe78d3e12 i965: Avoid using float type for raw moves, to work around SNB issue.
The SNB alt-mode math does the denorm and inf reduction even for a
"raw MOV" like we do for g0 message header setup, where we are moving
values that aren't actually floats.  Just use UD type, where raw MOVs
really are raw MOVs.

Fixes glxgears since c52adfc2e1, but no
piglit tests had regressed(!)
2010-12-21 13:06:15 -08:00
Jerome Glisse
fa62cf7450 r600g: avoid segfault
Candidates 7.10

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-21 10:51:32 -05:00
Chris Wilson
8b9570e685 intel: Check for unsupported texture when finishing using as a render target
Bugzilla: https://bugs.freedesktop.org/show_bug.cgi?id=32541
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
2010-12-21 11:58:35 +00:00
Vinson Lee
c1f0f90a97 st/mesa: Clean up header file inclusion in st_format.h. 2010-12-21 01:25:04 -08:00
Vinson Lee
3d03b4d839 st/mesa: Clean up header file inclusion in st_draw.h. 2010-12-21 01:17:37 -08:00
Ben Skeggs
57dcd800ca nvfx: fix fragprog word swapping on big-endian machines
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2010-12-16 11:13:21 +10:00
Jerome Glisse
dbb679e51d gallium: properly check for src->dst blit compatibilities
Spotted by Christoph Bumiller & Jose Fonseca

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-15 15:29:31 -05:00
Fredrik Höglund
66f55de31e r600g: fix pow(0, 0) evaluating to NaN
We have to use the non-IEEE compliant version of MUL here, since
log2(0) is -inf, and 0 * -inf is NaN in IEEE arithmetic.

candidates for 7.10 branch
2010-12-15 14:07:00 -05:00
Jerome Glisse
3861a1001c r600g: need to reference upload buffer as the might still live accross flush
Can't get away from referencing upload buffer as after flush a vertex buffer
using the upload buffer might still be active. Likely need to simplify the
pipe_refence a bit so we don't waste so much cpu time in it.

candidates for 7.10 branch

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-15 12:07:09 -05:00
Brian Paul
a8ca30bc58 st/mesa: fix incorrect prev pointer in destroy_program_variants() 2010-12-14 14:15:22 -07:00
Brian Paul
c62bb90d6a softpipe: do texture swizzle during texture sampling
Instead of when we read texture tiles.  Now swizzling happens after
the shadow depth compare step.  This fixes the piglit glsl-fs-shadow2d*
tests (except for proj+bias because of a GLSL bug).
2010-12-14 13:01:03 -07:00
Brian Paul
be2aa81f5f mesa: more program debug code 2010-12-14 12:46:01 -07:00
Brian Paul
2a77c3cc0b tgsi: document texture opcodes 2010-12-14 12:45:36 -07:00
Brian Paul
bb10e081c8 glsl: new glsl_strtod() wrapper to fix decimal point interpretation
We always want to use '.' as the decimal point.

See http://bugs.freedesktop.org/show_bug.cgi?id=24531

NOTE: this is a candidate for the 7.10 branch.
2010-12-14 12:38:38 -07:00
Brian Paul
dfbc20593e gallivm: do texture swizzle after shadow compare
We need to swizzle after the shadow comparison so that the GL_DEPTH_MODE
functionality is handled properly.

This fixes all the piglit glsl-fs-shadow2d*.shader_test cases, except
for glsl-fs-shadow2dproj-bias.shader_test which fails because of a
bug in the GLSL compiler (fd.o 32395).
2010-12-14 12:17:10 -07:00
Brian Paul
68c41a25b4 st/mesa: rename the varient release functions 2010-12-14 12:17:10 -07:00
Jerome Glisse
54773415f4 r600g: fix segfault when translating vertex buffer
Note the support for non float vertex draw likely regressed need to
find what we want to do there.

candidates for 7.10 branches

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-14 13:50:46 -05:00
Vinson Lee
4d1b2df6c0 mesa: Clean up header file inclusion in prog_optimize.h. 2010-12-14 00:39:57 -08:00
Vinson Lee
2c582dd25f mesa: Clean up header file inclusion in prog_cache.h. 2010-12-14 00:30:24 -08:00
Vinson Lee
71af07bf40 mesa: Clean up header file inclusion in nvvertparse.h. 2010-12-14 00:22:27 -08:00
Eric Anholt
c27285610c i965: Add support for using the BLT ring on gen6. 2010-12-13 19:41:58 -08:00
Eric Anholt
d88aa6fe3e i965: Improve the hacks for ARB_fp scalar^scalar POW on gen6.
This is still awful, but my ability to care about reworking the old
backend so we can just get a temporary value into a POW is awfully low
since the new backend does this all sensibly.

Fixes:
fp1-LIT test 1
fp1-LIT test 3 (case x < 0)
fp1-POW test (exponentiation)
fp-lit-mask
2010-12-13 16:47:57 -08:00
Brian Paul
43b7b9d02a st/mesa: 80-columns wrapping, whitespace fixes in st_cb_bitmap.c 2010-12-13 17:34:07 -07:00
Brian Paul
c21807d2f7 st/mesa: add geom program code in destroy_program_variants() 2010-12-13 17:29:56 -07:00
Brian Paul
b830b62a47 st/mesa: program struct comments 2010-12-13 17:28:02 -07:00
Brian Paul
4312569410 st/mesa: use st_fragment_program() instead of cast 2010-12-13 17:25:29 -07:00
Brian Paul
6c669d0c07 st/mesa: rename variable 2010-12-13 17:25:10 -07:00
Brian Paul
83d50c3ee1 st/mesa: minor re-indenting 2010-12-13 17:20:56 -07:00
Brian Paul
8d8e9491df st/mesa: make st_delete_program() static 2010-12-13 17:20:56 -07:00
Brian Paul
9b4433fe58 st/mesa: add comments, fix formatting in st_cb_program.c 2010-12-13 17:20:56 -07:00
Brian Paul
3d203b6100 Squashed commit of the following (st-mesa-per-context-shaders branch):
commit 4f106f44a32eaddb6cf3fea6ba5ee9787bff609a
Author: Brian Paul <brianp@vmware.com>
Date:   Mon Dec 13 14:06:08 2010 -0700

    st/mesa: reorganize vertex program translation code

    Now it looks like the fragment and geometry program code.
    Also remove the serial number fields from programs.  It was used to
    determine when new translations were needed.  Now the variant key is
    used for that.  And the st_program_string_notify() callback removes all
    variants when the program's code is changed.

commit e12d6791c5e4bff60bb2e6c04414b1b4d1325f3e
Author: Brian Paul <brianp@vmware.com>
Date:   Mon Dec 13 13:38:12 2010 -0700

    st/mesa: implement geometry shader varients

    Only needed in order to support per-context gallium shaders.

commit c5751c673644808ab069259a852f24c4c0e92b9d
Author: Brian Paul <brianp@vmware.com>
Date:   Sun Dec 12 15:28:57 2010 -0700

    st/mesa: restore glDraw/CopyPixels using new fragment program variants

    Clean up the logic for fragment programs for glDraw/CopyPixels.  We now
    generate fragment program variants for glDraw/CopyPixels as needed which
    do texture sampling, pixel scale/bias, pixelmap lookups, etc.

commit 7b0bb99bab6547f503a0176b5c0aef1482b02c97
Author: Brian Paul <brianp@vmware.com>
Date:   Fri Dec 10 17:03:23 2010 -0700

    st/mesa: checkpoint: implement fragment program variants

    The fragment programs variants are per-context, as the vertex programs.

    NOTE: glDrawPixels is totally broken at this point.

commit 2cc926183f957f8abac18d71276dd5bbd1f27be2
Author: Brian Paul <brianp@vmware.com>
Date:   Fri Dec 10 14:59:32 2010 -0700

    st/mesa: make vertex shader variants per-context

    Gallium shaders are per-context but OpenGL shaders aren't.  So we need
    to make a different variant for each context.

    During context tear-down we need to walk over all shaders/programs and
    free all variants for the context being destroyed.
2010-12-13 17:20:53 -07:00
Brian Paul
bb7c2691d2 mesa, st/mesa: disable GL_ARB_geometry_shader4
The new GLSL compiler doesn't support geom shaders yet so disable the
GL_ARB_geometry_shader4 extension.  Undo this when geom shaders work again.

NOTE: This is a candidate for the 7.10 branch.
2010-12-13 17:02:48 -07:00
Ian Romanick
2d577ee730 ir_to_mesa: Don't generate swizzles for record derefs of non-scalar/vectors
This is the same as what the array dereference handler does.

Fixes piglit test glsl-link-struct-array (bugzilla #31648).

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2010-12-13 15:47:56 -08:00
Ian Romanick
cb2b547a47 linker: Allow built-in arrays to have different sizes between shader stages
Fixes pitlit test glsl-link-varying-TexCoord (bugzilla #31650).
2010-12-13 15:16:39 -08:00
Eric Anholt
036c817f77 i965: Fix gl_FragCoord.z setup on gen6.
Fixes glsl-bug-22603.
2010-12-13 14:02:34 -08:00
Eric Anholt
5fbd8da8df i956: Fix the old FP path fragment position setup on gen6.
Fixes fp-arb-fragment-coord-conventions-none
2010-12-13 14:02:34 -08:00
Eric Anholt
7cec7bf56c i965: Fix ARL to work on gen6.
RNDD isn't one of the instructions that can do conversion from
execution type to destination type.

Fixes glsl-vs-arrays-3.
2010-12-13 14:02:34 -08:00
Eric Anholt
df9f891544 intel: Include stdbool so we can stop using GLboolean when we want to.
This requires shuffling the driconf XML macros around, since they use
true and false tokens expecting them to not get expanded to anything.
2010-12-13 14:02:34 -08:00
Brian Paul
b363dd43d6 gallivm: store callbacks in a linked list rather than fixed size array
Should fix http://bugs.freedesktop.org/show_bug.cgi?id=32308
2010-12-13 11:47:28 -07:00
Brian Paul
6577f753b2 tnl: a better way to initialize the gl_program_machine memory
This improves commit ef3f7e61b3

NOTE: This is a candidate for the 7.9 and 7.10 branches.
2010-12-13 08:11:58 -07:00
Alex Deucher
4523285e51 r600g: fix rendering with a vertex attrib having a zero stride
The hardware supports zero stride just fine.  This is a port
of 2af8a19831 from r300g.

NOTE: This is a candidate for both the 7.9 and 7.10 branches.

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2010-12-12 23:35:37 -05:00
Dave Airlie
d19b5cbd31 r300g: fixup rs690 tiling stride alignment calculations.
The RS690 memory controller prefers things to be on a different
boundary than the discrete GPUs, we had an attempt to fix this,
but it still failed, this consolidates the stride calculation
into one place and removes the really special case check.

This fixes gnome-shell and 16 piglit tests on my rs690 system.

NOTE: This is a candidate for both the 7.9 and 7.10 branches.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-12-13 11:29:21 +10:00
Chia-I Wu
d6b1478ff0 egl: Do not unload drivers.
When the driver is the last reference to libEGL.so, unloading it will
cause libEGL.so to be unmapped and give problems.  Disable the unloading
for now.  Still have to figure out the right timing to unload drivers.
2010-12-12 18:31:48 +08:00
Chia-I Wu
1c01bedb02 mapi: Fix a warning in !THREADS build.
It should be u_thread_self, not _glthread_GetID.
2010-12-12 17:59:47 +08:00
Vinson Lee
bf8242684a mesa: Clean up header file inclusion in nvfragparse.h. 2010-12-11 14:37:18 -08:00
Vinson Lee
7d8c067460 mesa: Clean up header file inclusion in ir_to_mesa.h. 2010-12-11 13:30:13 -08:00
Christoph Bumiller
5138ac033a nvc0: support user clip planes 2010-12-11 16:24:27 +01:00
Christoph Bumiller
67d0c3dd79 nvc0: enable vertex color clamping 2010-12-11 16:24:21 +01:00
Marek Olšák
2af8a19831 r300g: fix rendering with a vertex attrib having a zero stride
The hardware apparently does support a zero stride, so let's use it.

This fixes missing objects in ETQW, but might also fix a ton of other
similar-looking bugs.

NOTE: This is a candidate for both the 7.9 and 7.10 branches.
2010-12-11 14:49:28 +01:00
Chia-I Wu
f7a0636329 i965: Add support for GL_FIXED. 2010-12-11 21:47:18 +08:00
Marek Olšák
c398f1544e tgsi: fix rbug compile error
../mesa/src/gallium/auxiliary/tgsi/tgsi_parse.h:139:
error: dereferencing pointer ‘tokens.25’ does break strict-aliasing rules

Signed-off-by: Marek Olšák <maraeo@gmail.com>
2010-12-11 13:37:57 +01:00
Marek Olšák
d0990db6bd r300/compiler: fix swizzle lowering with a presubtract source operand
If a source operand has a non-native swizzle (e.g. the KIL instruction
cannot have a swizzle other than .xyzw), the lowering pass uses one or more
MOV instructions to move the operand to an intermediate temporary with
native swizzles.

This commit fixes that the presubtract information was lost during
the lowering.

NOTE: This is a candidate for both the 7.9 and 7.10 branches.
2010-12-11 13:37:57 +01:00
Marek Olšák
9e1fbd3d6e r300/compiler: fix LIT in VS
This fixes broken rendering of trees in ETQW. The trees still disappear
for an unknown reason when they are close.

Broken since:
2ff9d4474b
r300/compiler: make lowering passes possibly use up to two less temps

NOTE: This is a candidate for the 7.10 branch.
2010-12-11 07:32:24 +01:00
Ian Romanick
d7f27e2e76 glsl: Inherrit type of declared variable from initializer after processing assignment
do_assignment may apply implicit conversions to coerce the base type
of initializer to the base type of the variable being declared.  Fixes
piglit test glsl-implicit-conversion-02 (bugzilla #32287).  This
probably also fixes bugzilla #32273.

NOTE: This is a candidate for the 7.9 branch and the 7.10 branch.
2010-12-10 17:52:35 -08:00
Ian Romanick
ec53010c4d glsl: Minor clean-up in validate_assignment
This code has been changed around a lot, and there were some temporary
variables left around from previous versions.
2010-12-10 17:52:35 -08:00
Eric Anholt
783e7caadf i965: Put common info on converting MESA_FORMAT to BRW_FORMAT in a table.
There are exceptions to the table for depth texturing or rendering to
not-quite-supported formats thanks to the non-orthogonal component
selection for surface formats, but it's still a lot simpler.
2010-12-10 16:17:01 -08:00
Eric Anholt
be72efb4f2 intel: Just use ChooseTextureFormat for renderbuffer format choice.
One less place to forget to put your new MESA_FORMAT support in.
2010-12-10 16:16:13 -08:00
Eric Anholt
e339b669a1 intel: Add a couple of helper functions to reduce rb code duplication. 2010-12-10 15:37:16 -08:00
Eric Anholt
28bab24e16 intel: Add spans code for the ARB_texture_rg support.
This starts spantmp2.h down the path of using MESA_FORMAT_* for
specifying the format instead of the crazy GL format/type combo.
2010-12-10 15:37:10 -08:00
Eric Anholt
a7e2d64971 mesa: Don't assertion fail for _mesa_get_format_name(MESA_FORMAT_NONE) 2010-12-10 15:29:52 -08:00
Vinson Lee
ef3f7e61b3 tnl: Initialize gl_program_machine memory in run_vp.
Fixes piglit valgrind glsl-array-bounds-04 failure (FDO bug 29946).

NOTE:
This is a candidate for the 7.10 branch.
This is a candidate for the 7.9 branch.
2010-12-10 14:24:05 -08:00
Christoph Bumiller
dea9d60400 nvc0: fix FACE state and and handle FACE sysval/varying offset 2010-12-10 20:20:37 +01:00
Christoph Bumiller
51f22689a4 nvc0: fix branching ops
- bra is PC relative
- jump to else condition was inverted
- handle integer comparisons
2010-12-10 20:20:34 +01:00
Mathias Fröhlich
b3d2ec9942 vbo: Avoid the copy to current in dlists if not required.
The current state is allowed to be undefined past DrawElements et al.
Consequently omit that copying at least in the display list code.
This pays us some percents performance.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-12-10 10:17:48 -07:00
Brian Paul
2a4df8933e mesa/meta: fix broken assertion, rename stack depth var
assert(current_save_state < MAX_META_OPS_DEPTH) did not compile.

Rename current_save_state to SaveStackDepth to be more consistent with
the style of the other fields.
2010-12-10 10:02:37 -07:00
Brian Paul
b7c38734c9 mesa: enable GL_ARB_draw_instanced for software drivers 2010-12-10 09:29:41 -07:00
Brian Paul
a63486ac68 tnl: implement instanced drawing 2010-12-10 09:29:13 -07:00
Brian Paul
6a0d3b7696 mesa: implement system values in program interpreter 2010-12-10 09:29:00 -07:00
Jerome Glisse
b22c8e8bbc r600g: fix bo size when creating bo from handle
Spoted by Alex Diomin

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-10 11:17:27 -05:00
Vinson Lee
d5810efca6 mesa: Clean up header file inclusion in arbprogparse.h. 2010-12-09 23:52:28 -08:00
Xiang, Haihao
e47eacdc53 i965: support for two-sided lighting on Sandybridge
VS places color attributes together so that SF unit can fetch the right
attribute according to object orientation. This fixes light issue in
mesa demo geartrain, projtex.
2010-12-10 13:25:22 +08:00
Xiang, Haihao
d1196bbc19 meta: allow nested meta operations
_mesa_meta_CopyPixels results in nested meta operations on Sandybridge.
Previoulsy the second meta operation overrides all states saved by the
first meta function.
2010-12-10 13:25:17 +08:00
Eric Anholt
3a3b1bd722 i965: Add support for gen6 reladdr VS constant loading. 2010-12-09 20:25:34 -08:00
Eric Anholt
15566183a6 i965: Add support for gen6 constant-index constant loading. 2010-12-09 20:25:34 -08:00
Chia-I Wu
83bdd402aa targets/egl: Improve st_GL.so loading.
When the application is not linked to any libGL*.so, loading st_GL.so
would give

  /usr/local/lib/egl/st_GL.so: undefined symbol: _glapi_tls_Context

In that case, load libGL.so and try again.  This works because
util_dl_open loads with RTLD_GLOBAL.

Fix "clear" OpenGL ES 1.1 demo.
2010-12-10 11:01:05 +08:00
Chia-I Wu
6efd963a23 target/egl: Fix misleading debug message.
When the name of the module is NULL, the process itself is dlopen()ed.
Do not print

  libEGL debug: searching for st module (null)
2010-12-10 11:00:31 +08:00
Brian Paul
becc4bb90c draw/llvm: don't flush in vs_llvm_delete()
Fixes piglit glx-shader-sharing crash.

When shaders are shared by multiple contexts, the shader's draw context
pointer may point to a previously destroyed context.  Dereferencing the
context pointer will lead to a crash.

In this case, simply removing the flushing code avoids the crash (the
exec and sse shader paths don't flush here either).

There's a deeper issue here, however, that needs examination.  Shaders
should not keep pointers to contexts since contexts might get destroyed
at any time.

NOTE: This is a candidate for the 7.10 branch (after this has been
tested for a while).
2010-12-09 18:41:22 -07:00
Brian Paul
70ca064454 draw/llvm: remove redundant comment 2010-12-09 18:40:48 -07:00
Brian Paul
bd995cf6c0 draw/llvm: remove extraneous conditional 2010-12-09 18:40:48 -07:00
Chih-Wei Huang
6269411b81 android: enable support of i965c 2010-12-09 20:01:35 -05:00
Chia-I Wu
88721c8555 android: Add Android.mk's. 2010-12-09 20:01:35 -05:00
Chia-I Wu
4128957d30 android: Add pre-generated files. 2010-12-09 20:01:35 -05:00
Chia-I Wu
07a8209c3f android: Add __DRI_IMAGE_FORMAT_RGBA8888_REV. 2010-12-09 20:01:35 -05:00
Chia-I Wu
b0a79b3512 android: Add DRM-based gralloc. 2010-12-09 20:01:35 -05:00
Chia-I Wu
121fc671f4 android: Add new classic EGL driver for Android. 2010-12-09 20:01:35 -05:00
Chia-I Wu
8148db591a android: Add android backend for st/egl. 2010-12-09 20:01:35 -05:00
Chia-I Wu
0d4dcb2584 android: Add Android EGL extensions. 2010-12-09 20:01:35 -05:00
Chia-I Wu
1337551451 android: Add _EGL_PLATFORM_ANDROID. 2010-12-09 20:01:35 -05:00
Chia-I Wu
6719d59a85 android: Enable extensions required by ES1 for i915c. 2010-12-09 20:01:35 -05:00
Chia-I Wu
3fe7753b70 android: Fix depth/stencil with i915c. 2010-12-09 20:01:34 -05:00
Chia-I Wu
017c563cff android: Fix GL_OES_EGL_image with SurfaceFlinger. 2010-12-09 20:01:34 -05:00
Chia-I Wu
bf21df37c6 android: Use __mmap2 in winsys/svga. 2010-12-09 20:01:34 -05:00
Chia-I Wu
17935c0191 android: Fix build with bionic. 2010-12-09 20:01:34 -05:00
Chia-I Wu
7aceb74db7 i915c: Add GL_OES_draw_texture support. 2010-12-09 20:01:34 -05:00
Chia-I Wu
88e9712a68 tnl: Add support for GL_FIXED. 2010-12-09 20:01:34 -05:00
Luca Barbieri
0e50c21e24 glsl: Unroll loops with conditional breaks anywhere (not just the end)
Currently we only unroll loops with conditional breaks at the end, which is
the form that lower_jumps generates.

However, if breaks are not lowered, they tend to appear at the beginning, so
add support for a conditional break anywhere.

Signed-off-by: Luca Barbieri <luca@luca-barbieri.com>
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
2010-12-09 16:42:05 -08:00
Kenneth Graunke
13c45c590b glsl: Consider the "else" branch when looking for loop breaks.
Found this bug by code inspection.  Based off the comments just before
this code, the intent is to find whether the break exists in the "then"
branch or the "else" branch.  However, the code actually looked at the
last instruction in the "then" branch twice.
2010-12-09 16:42:05 -08:00
Kenneth Graunke
528fa8ce32 glsl: Clean up code by adding a new is_break() function. 2010-12-09 16:42:05 -08:00
Chia-I Wu
2e9e27c0f7 i915: Free with FREE. 2010-12-09 19:39:22 -05:00
Chia-I Wu
455a7585de targets/egl-gdi: Optional support for DRM screen. 2010-12-09 19:39:22 -05:00
Chia-I Wu
25ed79d830 Revert "egl: Drop broken _EGL_PLATFORM_NO_OS code"
This reverts commit 021a68b7e8.
2010-12-09 19:39:22 -05:00
Eric Anholt
b13a2e640f glsl: Correct the marking of InputsRead/OutputsWritten on in/out matrices.
If you used a constant array index to access the matrix, we'd flag a
bunch of wrong inputs/outputs as being used because the index was
multiplied by matrix columns and the actual used index was left out.

Fixes glsl-mat-attribute.
2010-12-09 14:41:50 -08:00
Eric Anholt
3fb18d6775 intel: Set the swizzling for depth textures using the GL_RED depth mode.
Fixes depth-tex-modes-rg.
2010-12-09 14:41:50 -08:00
Eric Anholt
b4e8ec3a57 intel: Use plain R8 and RG8 for COMPRESSED_RED and COMPRESSED_RG.
Fixes texture-rg.
2010-12-09 14:41:50 -08:00
Vinson Lee
c3ca384e71 i965: Silence uninitialized variable warning.
Fixes this GCC warning.
brw_fs.cpp: In function 'brw_reg brw_reg_from_fs_reg(fs_reg*)':
brw_fs.cpp:3255: warning: 'brw_reg' may be used uninitialized in this function
2010-12-09 14:17:17 -08:00
Vinson Lee
af5f7b3260 r600g: Fix SCons build. 2010-12-09 14:03:58 -08:00
Jerome Glisse
121079bd67 r600g: indentation cleanup
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-09 16:16:22 -05:00
Jerome Glisse
7055068eea r600g: specialized upload manager
Allow important performance increase by doing hw specific implementation
of the upload manager helper. Drop the range flushing that is not hit with
this code (and wasn't with previous neither). Performance improvement are
mostly visible on slow CPU.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-09 16:07:05 -05:00
Jerome Glisse
15753cf54d r600g: avoid using pb* helper we are loosing previous cpu cycle with it
r600g is up to a point where all small CPU cycle matter and pb* turn
high on profile. It's mostly because pb try to be generic and thus
trigger unecessary check for r600g driver. To avoid having too much
abstraction & too much depth in the call embedded everythings into
r600_bo. Make code simpler & faster. The performance win highly depend
on the CPU & application considered being more important on slower CPU
and marginal/unoticeable on faster one.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-09 16:07:01 -05:00
Fabian Bieler
ef534f3838 glsl: fix lowering conditional returns in subroutines
this fix applies to the lower_sub_return 'branch' of the lower_jumps pass

Fixes piglit tests glsl-functions-5 and glsl-functions-6.
2010-12-09 11:28:06 -08:00
Eric Anholt
834cc8e501 i965: remove unused variable since brw_wm_glsl.c removal. 2010-12-09 11:11:04 -08:00
Eric Anholt
cfcc2ef587 i965: Set render_cache_read_write surface state bit on gen6 constant surfs.
This is said to be required in the spec, even when you aren't doing writes.
2010-12-09 11:11:04 -08:00
Eric Anholt
30f25a1019 i965: Set up the correct texture border color state struct for Ironlake.
This doesn't actually fix border color on Ironlake, but it appears to
be a requirement, and gen6 needs it too.
2010-12-09 10:51:00 -08:00
Eric Anholt
14a9153a32 i965: Clean up VS constant buffer location setup. 2010-12-09 10:51:00 -08:00
Eric Anholt
8fab1c0e2e i965: Fix VS constants regression pre-gen6.
Last minute change for gen6 with 0 used params dropped the multiply.
2010-12-09 10:50:59 -08:00
José Fonseca
cdd4f04f80 llvmpipe: Plug fence leaks. 2010-12-09 16:48:26 +00:00
Christoph Bumiller
e32ec11278 nvc0: call grobj_alloc for all used classes
Only doing this to notify the DRM that we need a PGRAPH context,
nvc0 hardware doesn't use actual grobjs anymore.
2010-12-09 17:41:13 +01:00
Shuang He
9946f15d30 mesa: allow GLfixed arrays for OpenGL ES 2.0
Signed-off-by: Brian Paul <brianp@vmware.com>
2010-12-09 08:23:54 -07:00
Christoph Bumiller
92f3642a4f nvc0: write texture address to TIC with a RELOC
Direct access to the bo address requires an API change.
2010-12-09 15:22:17 +01:00
Christoph Bumiller
6e753e3c29 nvc0: use tile flags in a way compatible with nouveau 2010-12-09 15:08:29 +01:00
Christoph Bumiller
3ef1616b63 nvc0: buffer suballocation with a primitive slab allocator 2010-12-09 15:01:37 +01:00
Christoph Bumiller
0d1a2bd0fb nvc0: generate shader header for geometry programs 2010-12-09 14:44:21 +01:00
Christoph Bumiller
14a09095d3 nvc0: fix immediate arg for SHL/SHR 2010-12-09 14:43:11 +01:00
Christoph Bumiller
2bb377ee02 nvc0: index buffers are back
Probably because long methods are gone index buffers must be
explicit again.
2010-12-09 14:41:33 +01:00
Christoph Bumiller
7fa7229560 nvc0: upload constants with m2mf for the time being
I get mysterious lockups with the dedicated CB upload ...
2010-12-09 14:35:26 +01:00
Chia-I Wu
0c0eda393a mesa: Fix glTexCoordPointer with type GL_FIXED.
GL_FIXED is also a legal type for glTexCoordPointer.
2010-12-09 19:37:56 +08:00
Chia-I Wu
2d270ac090 mesa: Fix GL_FIXED arrays.
It is broken since 433e5e6def.
2010-12-09 19:25:05 +08:00
Christoph Bumiller
5655f8d42d nvc0: support primitive restart 2010-12-09 12:08:25 +01:00
Christoph Bumiller
548967f9fa nvc0: rcp f32 also supports neg and abs modifiers 2010-12-09 12:05:03 +01:00
Eric Anholt
05e534e6c4 i965: Drop push-mode reladdr constant loading and always use constant_map.
This eases the gen6 implementation, which can only handle up to 32
registers of constants, while likely not penalizing real apps using
reladdr since all of those I've seen also end up hitting the pull
constant buffer.  On gen6, the constant map means that simple NV VPs
fit under the 32-reg limit and now succeed.  Fixes around 10 testcases.
2010-12-08 22:26:18 -08:00
Alex Deucher
fd543e1f95 radeon: bump mip tree levels to 15
I forgot to bump this when I bumped the tex levels.
2010-12-09 00:16:02 -05:00
Brian Paul
09a5e028a6 mesa: simplify target checking for TexImage functions 2010-12-08 21:38:35 -07:00
Brian Paul
7404fa3f07 mesa: revamp error checking for compressed texture images
Simplify some code, remove unneeded checks, etc.
2010-12-08 21:38:35 -07:00
Chad Versace
f0f2ec4d8a glsl: In ast_to_hir, check sampler array indexing
Raise error if a sampler array is indexed with a non-constant expression.

From section 4.1.7 of the GLSL 1.30 spec:
  "Samplers aggregated into arrays within a shader (using square
  brackets [ ]) can only be indexed with integral constant
  expressions [...]."
2010-12-08 18:53:53 -08:00
Brian Paul
dcb48e7eb4 llvmpipe: enable instanced drawing cap 2010-12-08 19:06:22 -07:00
Brian Paul
cf2184f057 softpipe: enable instanced drawing cap 2010-12-08 19:04:16 -07:00
Brian Paul
1d6f3543a0 gallivm/llvmpipe: implement system values and instanceID 2010-12-08 19:04:11 -07:00
Brian Paul
2b5e1e5287 st/mesa: translate shader system inputs 2010-12-08 19:01:15 -07:00
Brian Paul
2d62fb6c3f draw: setup instance ID for SSE generator 2010-12-08 19:00:44 -07:00
Brian Paul
0be042cb4d draw: setup instance ID for VS interpreter 2010-12-08 19:00:32 -07:00
Brian Paul
691048a22a mesa: ir_to_mesa support for system values 2010-12-08 18:25:58 -07:00
Brian Paul
7ce186358e glsl: add support for system values and GL_ARB_draw_instanced 2010-12-08 18:25:38 -07:00
Brian Paul
379332f629 mesa: program printing for PROGRAM_SYSTEM_VALUE 2010-12-08 18:24:48 -07:00
Brian Paul
c6d74bcbfc mesa: add PROGRAM_SYSTEM_VALUE and related tokens
System values are shader inputs which don't necessarily change from
vertex to vertex or fragment to fragment.  gl_InstanceID and
gl_FrontFacing are examples.
2010-12-08 18:21:20 -07:00
Brian Paul
975418a654 tgsi/ppc: add case for system values and assert 2010-12-08 18:20:44 -07:00
Brian Paul
e8154eeae5 tgsi/sse: add support for system values 2010-12-08 18:20:05 -07:00
Brian Paul
b550d8d76b tgsi: new tgsi_shader_info fields for system values 2010-12-08 18:19:47 -07:00
Brian Paul
859f45a921 tgsi: add support for system values to TGSI interpreter 2010-12-08 18:19:14 -07:00
Eric Anholt
d547ab150a i965: Drop KIL_NV from the ff/ARB_fp path since it was only used for GLSL. 2010-12-08 11:14:52 -08:00
Eric Anholt
dba6fde08c i965: Use the new pixel mask location for gen6 ARB_fp KIL instructions.
Fixes:
fp-kil
fp-generic/kil-swizzle.
2010-12-08 11:14:35 -08:00
Eric Anholt
39eaacff14 i965: Set the render target index in gen6 fixed-function/ARB_fp path.
Fixes:
fbo-drawbuffers2-blend
fbo-drawbuffers2-colormask
2010-12-08 10:51:04 -08:00
Eric Anholt
4b4dc778b6 i965: Set up the per-render-target blend state on gen6.
This will let us get EXT_draw_buffers2 blending and colormasking working.
2010-12-08 10:50:57 -08:00
Eric Anholt
0d3b8a5cc2 i965: Set up the color masking for the first drawbuffer on gen6.
Fixes glean/maskedClear
2010-12-08 09:53:16 -08:00
Chia-I Wu
d2028ba339 mesa: Do not advertise GL_OES_texture_3D.
GL_OES_texture_3D has a GLSL counterpart.  Since it is not implemented,
GL_OES_texture_3D should not be advertised.
2010-12-08 22:35:40 +08:00
Chia-I Wu
98ee6739d9 vbo: Fix GLES2 glVertexAttrib.
Attribute 0 has no special meaning in GLES2.  Add VertexAttrib4f_nopos
for that purpose and make _es_VertexAttrib* call the new function.

Rename _vbo_* to _es_* to avoid confusion.  These functions are only
used by GLES, and now some of them (_es_VertexAttrib*) even behave
differently than vbo_VertexAttrib*.
2010-12-08 22:19:19 +08:00
Chia-I Wu
9f0d7dd259 vbo: Drop second ATTR macro.
There is no need to have a special version of ATTR for
!FEATURE_beginend, since 81ccb3e2ce.
2010-12-08 22:18:37 +08:00
Brian Paul
7da704ee72 configure: use llvm-config --cppflags instead of --cflags 2010-12-08 06:45:00 -07:00
Brian Paul
c64447f47d mesa: make _mesa_test_proxy_teximage() easier to read 2010-12-07 21:37:20 -07:00
Brian Paul
4ff70b7a8f mesa: consolidate glCompressedTexImage1/2/3D() functions 2010-12-07 21:37:20 -07:00
Brian Paul
1c23b860ce mesa: consolidate glCopyTexSubImage1/2/3D() functions 2010-12-07 21:37:20 -07:00
Brian Paul
11f386fb50 mesa: consolidate glCopyTexImage1/2D() code 2010-12-07 21:37:19 -07:00
Brian Paul
45124e043d mesa: consolidate the glTexSubImage1/2/3D() functions 2010-12-07 21:37:19 -07:00
Brian Paul
35f620d55c mesa: simplify proxy texture code in texture_error_check() 2010-12-07 21:37:19 -07:00
Marek Olšák
c4f9e55d61 r300/compiler: remove at least unused immediates if externals cannot be removed 2010-12-08 04:39:51 +01:00
Marek Olšák
2ff9d4474b r300/compiler: make lowering passes possibly use up to two less temps
CMP may now use two less temps, other non-native instructions may end up
using one less temp, except for SIN/COS/SCS, which I am leaving unchanged
for now.

This may reduce register pressure inside loops, because the register
allocator doesn't do a very good job there.
2010-12-08 04:39:51 +01:00
Marek Olšák
93f2df0760 r300/compiler: handle DPH and XPD in rc_compute_sources_for_writemask
This bug can only be triggered if you put deadcode before native rewrite.
2010-12-08 04:39:50 +01:00
Marek Olšák
95080fb50f r300/compiler: do not print pair/tex/presub program stats for vertex shaders 2010-12-08 04:39:50 +01:00
Marek Olšák
8fac29d49e r300/compiler: cleanup rc_run_compiler 2010-12-08 04:39:50 +01:00
Marek Olšák
2592a8f506 r300/compiler: add a function to query program stats (alu, tex, temps..) 2010-12-08 04:39:50 +01:00
Marek Olšák
431b4c0c84 r300/compiler: don't terminate regalloc if we surpass max temps limit
The same check is already in a later pass (translate_vertex_program).
2010-12-08 04:39:50 +01:00
Eric Anholt
2f07a744f1 i965: Don't try to store gen6 (float) blend constant color in bytes.
Fixes glean/blendFunc
2010-12-07 19:33:47 -08:00
Ian Romanick
002cd2c8d4 linker: Fix regressions caused by previous commit
That's what I get for not running piglit before pushing.

Don't try to patch types of unsized arrays when linking fails.

Don't try to patch types of unsized arrays that are shared between
shader stages.
2010-12-07 19:00:44 -08:00
Ian Romanick
6f53921c4b linker: Ensure that unsized arrays have a size after linking
Fixes piglit test case glsl-vec-array (bugzilla #31908).

NOTE: This bug does not affect 7.9, but I think this patch is a
candiate for the 7.9 branch anyway.
2010-12-07 18:32:16 -08:00
Eric Anholt
b2167a6c01 i965: Fix flipped value of the not-embedded-in-if on gen6.
Fixes:
glean/glsl1-! (not) operator (1, fail)
glean/glsl1-! (not) operator (1, pass)
2010-12-07 17:46:47 -08:00
Ian Romanick
b0fc5103cb glsl: Inherrit type of declared variable from initializer
Types of declared variables and their initializer must match excatly
except for unsized arrays.  Previously the type inherritance for
unsized arrays happened implicitly in the emitted assignment.
However, this assignment is never emitted for uniforms.  Now that type
is explicitly copied unconditionally.

Fixes piglit test array-compare-04.vert (bugzilla #32035) and
glsl-array-uniform-length (bugzilla #31985).

NOTE: This is a candidate for the 7.9 branch.
2010-12-07 16:36:44 -08:00
Eric Anholt
7ca7e9b626 i965: Work around gen6 ignoring source modifiers on math instructions.
With the change of extended math from having the arguments moved into
mrfs and handed off through message passing to being directly hooked
up to the EU, it looks like the piece for doing source modifiers
(negate and abs) was left out.

Fixes:
fog-modes
glean/fp1-ARB_fog_exp test
glean/fp1-ARB_fog_exp2 test
glean/fp1-Computed fog exp test
glean/fp1-Computed fog exp2 test
ext_fog_coord-modes
2010-12-07 15:11:27 -08:00
Eric Anholt
2d7dfb8446 i965: Add disabled debug code for dumping out the WM constant payload.
This can significantly ease thinking about the asm.
2010-12-07 15:11:27 -08:00
Ian Romanick
6848e27e14 i965: Correctly emit constants for aggregate types (array, matrix, struct)
Previously the code only handled scalars and vectors.  This new code
is modeled somewhat after similar code in ir_to_mesa.

Reviewed-by: Eric Anholt <eric@anholt.net>
2010-12-07 15:03:14 -08:00
Jerome Glisse
b7617346dc r600g: fix userspace fence against lastest kernel
R6XX GPU doesn't like to have two partial flush writting
back to memory in row without a prior flush of the pipeline.
Add PS_PARTIAL_FLUSH to flush all work between the CP and
the ES, GS, VS, PS shaders.

Thanks a lot to Alban Browaeys (prahal on irc) for investigating
this issue.

Signed-off-by: Alban Browaeys <prahal@yahoo.com>
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-07 17:54:56 -05:00
Jerome Glisse
69251fc4cd r600g: remove dead code
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-07 16:14:18 -05:00
Eric Anholt
fa0d5a2c5b i965: Always hand the absolute value to RSQ.
gen6 builtin RSQ apparently clamps negative values to 0 instead of
returning the RSQ of the absolute value like ARB_fragment_program
desires and pre-gen6 apparently does.

Fixes:
glean/fp1-RSQ test 2 (reciprocal square root of negative value)
glean/vp1-RSQ test 2 (reciprocal square root of negative value)
2010-12-07 13:13:27 -08:00
Ian Romanick
6d36be508f glsl: Ensure that equality comparisons don't return a NULL IR tree
This fixes bugzilla #32035 and piglit test case array-compare-01 and
array-compare-02.

NOTE: This is a candidate for the 7.9 branch.
2010-12-07 12:50:38 -08:00
Eric Anholt
72845d206e i965: Handle saturates on gen6 math instructions.
We get saturate as an argument to brw_math() instead of as compile
state, since that's how the pre-gen6 send instructions work.  Fixes
fp-ex2-sat.
2010-12-07 12:21:08 -08:00
Eric Anholt
ed492e9544 i965: Fix comment about gen6_wm_constants.
This is the push constant buffer, not the pull constants.
2010-12-07 12:21:08 -08:00
Kenneth Graunke
bd74101aeb Refresh autogenerated glcpp parser. 2010-12-07 10:52:59 -08:00
Kenneth Graunke
800eed6765 glcpp: Don't emit SPACE tokens in conditional_tokens production.
Fixes glslparsertest defined-01.vert.

Reported-by: José Fonseca <jfonseca@vmware.com>
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
Acked-by: Carl Worth <cworth@cworth.org>
2010-12-07 10:52:36 -08:00
Marek Olšák
d8b861987d r300g: also revalidate the SWTCL vertex buffer after its reallocation 2010-12-07 19:26:28 +01:00
Zhenyu Wang
27609a8267 i965: upload WM state for _NEW_POLYGON on sandybridge
Be sure polygon stipple mode is updated. This fixes 'gamma' demo.
2010-12-07 17:05:02 +08:00
Vinson Lee
6ee415cc6d r200: Silence uninitialized variable warning.
Fixes this GCC warning.
r200_maos_arrays.c: In function 'r200EmitArrays':
r200_maos_arrays.c:113: warning: 'emitsize' may be used uninitialized in this function
2010-12-07 00:58:54 -08:00
Xiang, Haihao
5ff6ed2b97 i965: set minimum/maximum Point Width on Sandybridge
It is used for point width on vertex. This fixes mesa demo spriteblast and pointblast.
2010-12-07 16:43:24 +08:00
Vinson Lee
dda3ccba8c mesa: Clean up header file inclusion in viewport.h. 2010-12-07 00:37:48 -08:00
Vinson Lee
dbd3f72662 mesa: Clean up header file inclusion in varray.h. 2010-12-07 00:33:36 -08:00
Vinson Lee
2aa36f78dc mesa: Clean up header file inclusion in transformfeedback.h. 2010-12-07 00:28:57 -08:00
Vinson Lee
8cc3d411ed mesa: Clean up header file inclusion in texrender.h. 2010-12-07 00:19:06 -08:00
Marek Olšák
4953ba6a71 r300g: validate buffers only if any of bound buffers is changed
This prevents needless buffer validation (CS space checking).
2010-12-07 08:46:18 +01:00
Marek Olšák
78068a5fbf r300g: cache packet dwords of 3D_LOAD_VBPNTR in a command buffer if possible
It's not always possible to preprocess the content of 3D_LOAD_VBPNTR
in a command buffer, because the offset to all vertex buffers (which
the packet depends on) is derived from the "start" parameter of draw_arrays
and the "indexBias" parameter of draw_elements, but we can at least lazily
make a command buffer for the case when offset == 0, which should occur
most of the time.
2010-12-07 06:42:05 +01:00
Marek Olšák
857d107bfe u_blitter: use util_is_format_compatible in the assert 2010-12-07 06:22:38 +01:00
Brian Paul
d0b2b8da7d mesa: consolidate glTexImage1/2/3D() code
Something similar could be done for glCopyTex[Sub]Image() and the
compressed texture image functions as well.
2010-12-06 17:10:05 -07:00
Brian Paul
6dca66b620 mesa: set gl_texture_object::_Complete=FALSE in incomplete() 2010-12-06 17:10:05 -07:00
Brian Paul
ecb7cc3319 mesa: test for cube map completeness in glGenerateMipmap()
The texture is not cube complete if the base level images aren't of
the same size and format.

NOTE: This is a candidate for the 7.9 branch.
2010-12-06 17:10:05 -07:00
Kenneth Graunke
c17c790387 glsl: Properly add functions during lazy built-in prototype importing.
The original lazy built-in importing patch did not add the newly created
function to the symbol table, nor actually emit it into the IR stream.

Adding it to the symbol table is non-trivial since importing occurs when
generating some ir_call in a nested scope.  A new add_global_function
method, backed by new symbol_table code in the previous patch, handles
this.

Fixes bug #32030.
2010-12-06 13:43:22 -08:00
Kenneth Graunke
a8f52647b0 symbol_table: Add support for adding a symbol at top-level/global scope. 2010-12-06 13:43:22 -08:00
Kenneth Graunke
6fae1e4c4d glsl: Factor out code which emits a new function into the IR stream.
A future commit will use the newly created function in a second place.
2010-12-06 13:43:22 -08:00
Jakob Bornecrantz
d72cb9c94d st/mesa: Unbind all constant buffers 2010-12-06 22:10:49 +01:00
Jerome Glisse
e0d554ab78 r600g: remove useless flush map
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-06 15:50:50 -05:00
Jerome Glisse
afc56b1861 r600g: avoid useless shader rebuild at draw call
Avoid rebuilding constant shader state at each draw call,
factor out spi update that might change at each draw call.
Best would be to update spi only when revealent states
change (likely only flat shading & sprite point).

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-06 15:50:50 -05:00
Jerome Glisse
fa86fc564a r600g: build fetch shader from vertex elements
Vertex elements change are less frequent than draw call, those to
avoid rebuilding fetch shader to often build the fetch shader along
vertex elements. This also allow to move vertex buffer setup out
of draw path and make update to it less frequent.

Shader update can still be improved to only update SPI regs (based
on some rasterizer state like flat shading or point sprite ...).

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-06 15:50:50 -05:00
José Fonseca
a9fa0f3a2f mesa: Bump the number of bits in the register index.
More than 1023 temporaries were being used for a Cinebench shader before
doing temporary optimization, causing the index value to wrap around to
-1024.
2010-12-06 20:03:51 +00:00
Brian Paul
cae2bb76c1 st/mesa: fix mipmap generation bug
In st_finalize_texture() we were looking at the st_texture_object::
lastLevel field instead of the pipe_resource::last_level field to
determine which resource to store the mipmap in.

Then, in st_generate_mipmap() we need to call st_finalize_texture() to
make sure the destination resource is properly allocated.

These changes fix the broken piglit fbo-generatemipmap-formats test.
2010-12-06 11:01:21 -07:00
Brian Paul
c1095f0b0c mesa/llvm: use llvm-config --cppflags
Use --cppflags instead of --cflags so that we get the -I and -D flags
we want, but not compiler options like -O3.

A similar change should probably be made for autoconf.
2010-12-06 10:11:00 -07:00
Brian Paul
4fc62a074c gallium/util: minor formatting fixes 2010-12-06 09:46:45 -07:00
Brian Paul
b89a731ff2 mesa: add error margin to clip mask debug/check code
When X or Y or Z is close to W the outcome of the floating point clip
test comparision may be different between the C and x86 asm paths.
That's OK; don't report an error.

See fd.o bug 32093
2010-12-06 09:46:01 -07:00
Eric Anholt
4538ce915b i965: Remove INTEL_DEBUG=glsl_force now that there's no brw_wm_glsl.c 2010-12-06 00:14:23 -08:00
Eric Anholt
5ba517baa2 i965: Nuke brw_wm_glsl.c.
It was only used for gen6 fragment programs (not GLSL shaders) at this
point, and it was clearly unsuited to the task -- missing opcodes,
corrupted texturing, and assertion failures hit various applications
of all sorts.  It was easier to patch up the non-glsl for remaining
gen6 changes than to make brw_wm_glsl.c complete.

Bug #30530
2010-12-06 00:14:23 -08:00
Eric Anholt
245662f308 i965: Add support for the instruction compression bits on gen6.
Since the 8-wide first-quarter and 16-wide first-half have the same
bit encoding, we now need to track "do you want instruction
compression" in the compile state.
2010-12-06 00:14:23 -08:00
Eric Anholt
3f8bcb0d99 i965: Align gen6 push constant size to dispatch width.
The FS backend is fine with register level granularity.  But for the
brw_wm_emit.c backend, it expects pairs of regs to be used for the
constants, because the whole world is pairs of regs.  If an odd number
got used, we went looking for interpolation in the wrong place.
2010-12-06 00:14:23 -08:00
Eric Anholt
237aa33c67 i965: Make the sampler's implied move on gen6 be a raw move.
We were accidentally doing a float-to-uint conversion.
2010-12-06 00:14:23 -08:00
Eric Anholt
5340dd8cca i965: Fix up gen6 samplers for their usage by brw_wm_emit.c
We were trying to do the implied move even when we'd already manually
moved the real header in place.
2010-12-06 00:14:22 -08:00
Eric Anholt
ad29e79850 i965: Fix gen6 interpolation setup for 16-wide.
In the SF and brw_fs.cpp fixes to set up interpolation sanely on gen6,
the setup for 16-wide interpolation was left behind.  This brings
relative sanity to that path too.
2010-12-06 00:14:22 -08:00
Eric Anholt
ae0df25ab4 i965: Don't smash a group of coordinates doing gen6 16-wide sampler headers. 2010-12-06 00:14:22 -08:00
Eric Anholt
d1ead22d1b i965: Fix up 16-wide gen6 FB writes after various refactoring. 2010-12-06 00:14:22 -08:00
Eric Anholt
ad35528944 i965: Provide delta_xy reg to gen6 non-GLSL path PINTERP.
Fixes many assertion failures in that path.
2010-12-06 00:14:22 -08:00
Eric Anholt
16f8c82389 i965: Move payload reg setup to compile, not lookup time.
Payload reg setup on gen6 depends more on the dispatch width as well
as the uses_depth, computes_depth, and other flags.  That's something
we want to decide at compile time, not at cache lookup.  As a bonus,
the fragment shader program cache lookup should be cheaper now that
there's less to compute for the hash key.
2010-12-06 00:14:22 -08:00
Chia-I Wu
8f2a974cf2 mapi: Rewrite mapi_abi.py to get rid of preprocessor magic.
The preprocessor magic in mapi was nothing but obfuscation.  Rewrite
mapi_abi.py to generate real C code.

This commit removes the hack added in
43121f2086.
2010-12-06 15:40:37 +08:00
Chia-I Wu
5ae4b6693a egl: _eglFilterArray should not allocate.
Otherwise, when it is called from within a driver, the caller cannot
free the returned data (on Windows).
2010-12-06 15:40:37 +08:00
Zhenyu Wang
2b1469340b i965: Fix GS state uploading on Sandybridge
Need to check the required primitive type for GS on Sandybridge,
and when GS is disabled, the new state has to be issued too, instead
of only updating URB state with no GS entry, that caused hang on Sandybridge.

This fixes hang issue during conformance suite testing.
2010-12-06 15:20:48 +08:00
Xiang, Haihao
08be8d6450 i965: fix for flat shading on Sandybridge
use constant interpolation instead of linear interpolation for
attributes COL0,COL1 if GL_FLAT is used. This fixes mesa demo bounce.
2010-12-06 09:42:28 +08:00
Brian Paul
9cd277684d st/mesa: GL_ARB_draw_instanced depends on PIPE_CAP_INSTANCED_DRAWING 2010-12-05 13:34:02 -07:00
Brian Paul
d87bc015dc gallium: added PIPE_CAP_INSTANCED_DRAWING 2010-12-05 13:32:59 -07:00
Henri Verbeet
4409435614 r600g: Cleanup fetch shader resources in r600_pipe_shader_destroy(). 2010-12-05 18:44:44 +01:00
Henri Verbeet
308cfb80f5 r600g: Cleanup block bo references in r600_context_fini(). 2010-12-05 18:44:44 +01:00
Marek Olšák
c0c929cdac st/mesa: initialize key in st_vp_varient
This fixes endless vertex shader recompilations in find_translated_vp
if the shader contains an edge flag output.

NOTE: This is a candidate for the 7.9 branch.

Signed-off-by Brian Paul <brianp@vmware.com>
2010-12-05 17:38:19 +01:00
Xavier Chantry
ccacabe86c gallium/trace: check bind_vertex_sampler_states and set_vertex_sampler_views
Signed-off-by: Xavier Chantry <chantry.xavier@gmail.com>
Reviewed-by: Jakob Bornecrantz <wallbraker at gmail.com>
Signed-off-by: Patrice Mandin <patmandin@gmail.com>
2010-12-05 12:12:25 +01:00
Xavier Chantry
e3256ccb04 init ps->context with util_surfaces_get and do_get
Signed-off-by: Xavier Chantry <chantry.xavier@gmail.com>
Reviewed-by: Jakob Bornecrantz <wallbraker at gmail.com>
Signed-off-by: Patrice Mandin <patmandin@gmail.com>
2010-12-05 12:09:38 +01:00
Xavier Chantry
af5345d937 nvfx: fixes after array textures merge
Signed-off-by: Xavier Chantry <chantry.xavier@gmail.com>
Signed-off-by: Patrice Mandin <patmandin@gmail.com>
2010-12-05 12:08:00 +01:00
Marek Olšák
66d45567b4 r300g: optimize looping over atoms
This also removes DBG_STATS (the stats can be obtained with valgrind instead).
2010-12-05 05:52:25 +01:00
Marek Olšák
6947e52548 r300g: cleanup winsys 2010-12-05 05:47:10 +01:00
Dave Airlie
c1365606c5 r300g: try and use all of vertex constant space
Finished up by Marek Olšák.

We can set the constant space to use a different area per-call to the shader,
we can avoid flushing the PVS as often as we do by spreading out the constants
across the whole constant space.

Signed-off-by: Marek Olšák <maraeo@gmail.com>
2010-12-05 05:47:03 +01:00
Marek Olšák
1774273bde r300g: do not use the index parameter in set_constant_buffer
It appears to be a constant buffer index (in case there are more constant
buffers explicitly used by a shader), i.e. something that Gallium currently
does not use. We treated it incorrectly as the offset to a constant buffer.
2010-12-05 05:46:56 +01:00
Vinson Lee
e72651dc5d gallium/noop: Add prototype for noop_init_state_functions.
Silences this GCC warning.
noop_state.c:247: warning: no previous prototype for
'noop_init_state_functions'
2010-12-04 17:30:08 -08:00
Eric Anholt
afb80c5315 i965: Fix compile warning about missing opcodes. 2010-12-04 16:27:57 -08:00
Eric Anholt
8f23039f00 i965: Update gen6 SF state on fragment program change too.
SF state depends on what inputs there are to the fragment program, not
just the outputs of the VS.
2010-12-04 16:26:55 -08:00
Eric Anholt
65570d0482 i965: Update gen6 WM state on compiled program change, not just FP change. 2010-12-04 16:26:55 -08:00
Eric Anholt
4ac2f09e20 intel: Add an env var override to execute for a different GPU revision.
Sometimes I'm on the train and want to just read what's generated
under INTEL_DEBUG=vs,wm for some code on another generation.  Or, for
the next gen enablement we'll want to dump aub files before we have
the actual hardware.  This will let us do that.
2010-12-04 16:26:55 -08:00
Chia-I Wu
859106f196 st/vega: Fix pipe blend state for various blend modes.
rgb_src_factor and rgb_dst_factor should be PIPE_BLENDFACTOR_ONE for
VG_BLEND_SRC_IN and VG_BLEND_DST_IN respectively.  VG_BLEND_SRC_OVER can
be supported only when the fb has no alpha channel.  VG_BLEND_DST_OVER
and VG_BLEND_ADDITIVE have to be supported with a shader.

Note that Porter-Duff blending rules assume premultiplied alpha.
2010-12-04 23:46:38 +08:00
Chia-I Wu
0ee73edecc st/vega: Add blend shaders for all blend modes. 2010-12-04 23:41:35 +08:00
Chia-I Wu
5d24411140 st/vega: Fix VG_BLEND_MULTIPLY.
TEMP[1].w will be needed for OUT.w just below.  Use TEMP[0] to store the
intermediate value.
2010-12-04 23:41:30 +08:00
Vinson Lee
09fba30fde mesa: Clean up header file inclusion in texobj.h. 2010-12-04 01:29:50 -08:00
Vinson Lee
f657ac951d mesa: Clean up header file inclusion in texgetimage.h. 2010-12-04 01:20:28 -08:00
Vinson Lee
0ed245bd57 mesa: Clean up header file inclusion in texformat.h. 2010-12-04 01:11:33 -08:00
Vinson Lee
f8a9f5458b mesa: Clean up header file inclusion in texenvprogram.h. 2010-12-04 01:03:52 -08:00
Vinson Lee
f618f4549a mesa: Clean up header file inclusion in texcompress_s3tc.h. 2010-12-04 01:00:21 -08:00
Vinson Lee
8aa4cd0e50 st/vega: Silence uninitialized variable warning.
Fixes this GCC warning.
api_filters.c: In function 'execute_filter':
api_filters.c:184: warning: 'tex_wrap' may be used uninitialized in this function
2010-12-04 00:53:44 -08:00
Vinson Lee
3132591a4d mesa: Clean up header file inclusion in texcompress.h. 2010-12-04 00:52:14 -08:00
Chia-I Wu
e87a0cd260 st/vega: Blending should use premultiplied alpha.
Convert color values to and back from premultiplied form for blending.
Finally the rendering result of the blend demo looks much closer to that
of the reference implementation.
2010-12-04 15:44:40 +08:00
Chia-I Wu
e8ff3931f8 st/vega: Add support for per-channel alpha.
Drawing an image in VG_DRAW_IMAGE_STENCIL mode produces per-channel
alpha for use in blending.  Add a new shader stage to produce and save
it in TEMP[1].

For other modes that do not need per-channel alpha, the stage does

  MOV TEMP[1], TEMP[0].wwww
2010-12-04 13:20:38 +08:00
Chia-I Wu
a19eaaa6c1 st/vega: Move masking after blending.
Masking should happen after blending.  The shader is not entirely
correct, but leave it as is for now.
2010-12-04 13:20:38 +08:00
Chia-I Wu
3b4c888653 st/vega: Refactor blend shaders.
Add a helper function, blend_generic, that supports all blend modes and
per-channel alpha.  Make other blend generators a wrapper to it.

Both the old and new code expects premultiplied colors, yet the input is
non-premultiplied.  Per-channel alpha is also not used for stencil
image.  They still need to be fixed.
2010-12-04 13:20:32 +08:00
Chia-I Wu
a09baf1668 st/vega: Add some comments to pipeline shaders. 2010-12-04 13:19:29 +08:00
Brian Paul
6c33e820d5 st/mesa: new comment about updating state vars 2010-12-03 17:07:16 -07:00
Brian Paul
64244dfd39 mesa: update comments, remove dead code 2010-12-03 16:45:44 -07:00
Brian Paul
6f851e6642 mesa: remove unneeded cast 2010-12-03 16:40:36 -07:00
Brian Paul
503983b09e mesa: make glGet*(GL_NONE) generate GL_INVALID_ENUM
In find_value() check if we've hit the 0th/invalid entry before checking
if the pname matches.

Fixes http://bugs.freedesktop.org/show_bug.cgi?id=31987

NOTE: This is a candidate for the 7.9 branch.
2010-12-03 16:04:26 -07:00
Brian Paul
40ee69b4f3 swrast: restructure some glReadPixels() code 2010-12-03 15:26:31 -07:00
Brian Paul
5fc2548fae swrast: accept GL_RG in glReadPixels()
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=32088
2010-12-03 15:26:31 -07:00
Kenneth Graunke
b7acf538af ir_print_visitor: Print out constant structure values.
In the form (constant type ((field1 value) (field2 value) ...))
2010-12-03 13:59:21 -08:00
Brian Paul
8d6a0dc7f3 swrast: fix indentation 2010-12-03 14:49:19 -07:00
Brian Paul
75746e3779 swrast: allow GL_RG format in glDrawPixels()
Restructure the switch statement to avoid having to add additional
color formats in the future.

Fixes http://bugs.freedesktop.org/show_bug.cgi?id=32086
2010-12-03 14:48:03 -07:00
Brian Paul
b87369e863 mesa: consolidate some compiler -D flags
-D__STDC_CONSTANT_MACROS and -D__STDC_LIMIT_MACROS are only needed for
LLVM build.
2010-12-03 13:52:59 -07:00
Marek Olšák
9f7f093090 r300g: one more r500_index_bias_supported leftover 2010-12-03 20:59:55 +01:00
Marek Olšák
536d527020 r300g: add capability bit index_bias_supported
.. instead of calling r500_index_bias_supported(..) every draw call.
2010-12-03 20:34:56 +01:00
Jerome Glisse
edda44e0dc r600g: more indentation fix + warning silencing + dead code removal
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-03 13:06:53 -05:00
Jerome Glisse
119f00659c r600g: indentation fix
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-03 12:56:51 -05:00
Jerome Glisse
0b841b0349 r600g: update polygon offset only when rasterizer or zbuffer change
Aim is to build as little state as possible in draw functions.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-03 12:45:19 -05:00
Brian Paul
dbf996f308 llvmpipe: fix broken stencil writemask
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=32070
2010-12-03 09:44:30 -07:00
Fabian Bieler
cd431a12bf r600g: set address of pop instructions to next instruction 2010-12-03 11:35:44 -05:00
Jerome Glisse
833f3a488a r600g: dump raw shader output for debugging
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-12-03 11:35:36 -05:00
Brian Paul
6d13ec7dc0 mesa: return GL_FRAMEBUFFER_DEFAULT as FBO attachment type
If querying the default/window-system FBO's attachment type, return
GL_FRAMEBUFFER_DEFAULT (per the GL_ARB_framebuffer_object spec).

See http://bugs.freedesktop.org/show_bug.cgi?id=31947

NOTE: This is a candidate for the 7.9 branch.
2010-12-03 08:32:29 -07:00
Brian Paul
20cf1851d8 mesa: fix GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME query
Return 0 instead of generating an error.

See http://bugs.freedesktop.org/show_bug.cgi?id=30993

Note that piglit fbo-getframebufferattachmentparameter-01 still does
not pass.  But Mesa behaves the same as the NVIDIA driver in this case.
Perhaps the test is incorrect.

NOTE: This is a candidate for the 7.9 branch.
2010-12-03 08:24:51 -07:00
Brian Paul
14746b1d4f gallivm: fix null builder pointers 2010-12-03 07:38:02 -07:00
Chia-I Wu
5be631ce83 st/vega: Add a missing break. 2010-12-03 14:55:29 +08:00
Chia-I Wu
a84a1e344f st/vega: Move vertex transformation to shader.
It was done in path-to-polygon conversion.  That meant that the
results were invalidated when the transformation was modified, and CPU
had to recreate the vertex buffer with new vertices.  It could be a
performance hit for apps that animate.
2010-12-03 14:23:04 +08:00
Chia-I Wu
29bea39fde st/vega: Set pipe_resource::array_size to 1. 2010-12-03 14:22:32 +08:00
Chia-I Wu
9028f24b8a st/egl: Set pipe_resource::array_size to 1. 2010-12-03 14:22:32 +08:00
Marek Olšák
a60a5b850b r300g: do not remove unused constants if we are not near the limit 2010-12-03 06:32:10 +01:00
Marek Olšák
b088b255ec r300g: fix pointer arithmetic with void* in transfer_inline_write 2010-12-03 06:08:50 +01:00
Marek Olšák
d531f9c2f5 mesa, st/mesa: fix gl_FragCoord with FBOs in Gallium
gl_FragCoord.y needs to be flipped upside down if a FBO is bound.

This fixes:
- piglit/fbo-fragcoord
- https://bugs.freedesktop.org/show_bug.cgi?id=29420

Here I add a new program state STATE_FB_WPOS_Y_TRANSFORM, which is set based
on whether a FBO is bound. The state contains a pair of transformations.
It can be either (XY=identity, ZW=transformY) if a FBO is bound,
or (XY=transformY, ZW=identity) otherwise, where identity = (1, 0),
transformY = (-1, height-1).

A classic driver (or st/mesa) may, based on some other state, choose whether
to use XY or ZW, thus negate the conditional "if (is a FBO bound) ...".
The reason for this is that a Gallium driver is allowed to only support WPOS
relative to either the lower left or the upper left corner, so we must flip
the Y axis accordingly again. (the "invert" parameter in emit_wpos_inversion)

NOTE: This is a candidate for the 7.9 branch.

Signed-off-by: Marek Olšák <maraeo@gmail.com>
Signed-off-by: Brian Paul <brianp@vmware.com>
2010-12-03 05:56:40 +01:00
Marek Olšák
6a46fce14f r300g: implement simple transfer_inline_write for buffers
r600g might need something like that as well. This speeds up constant buffer
upload a bit.
2010-12-03 05:44:47 +01:00
Marek Olšák
3ba8843307 r300g: use internal BO handle for add_buffer and write_reloc
Small perf improvement in ipers.

radeon_drm_get_cs_handle is exactly what this commit tries to avoid
in every write_reloc.
2010-12-03 04:40:22 +01:00
Brian Paul
6299f241e9 gallivm/llvmpipe: remove lp_build_context::builder
The field was redundant.  Use the gallivm->builder value instead.
2010-12-02 18:11:16 -07:00
Brian Paul
36b09b5ded mesa: replace more MAX_WIDTH stack allocations with heap allocations 2010-12-02 18:07:03 -07:00
Marek Olšák
0c9a63db09 r300g: fix build 2010-12-03 00:54:41 +01:00
nobled
39c436a1a2 r300g: Drop unnecessary cast 2010-12-03 00:50:58 +01:00
nobled
7ed65f462a r300g: Abort if draw_create() fails
The other drivers need to be updated to do this, too.
2010-12-03 00:50:58 +01:00
nobled
d5bf231806 r300g: Abort if atom allocations fail 2010-12-03 00:50:58 +01:00
Ben Skeggs
a25cea19f2 nv50: silence some unknown get_param warnings
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>
2010-12-03 08:23:44 +10:00
Brian Paul
77ea102735 st/mesa: avoid large stack allocations in readpixels code 2010-12-02 14:29:07 -07:00
Brian Paul
aa28efe60d swrast: avoid large stack allocations in tex combine code 2010-12-02 14:29:07 -07:00
Brian Paul
25662f878e swrast: avoid large stack allocations in blend code 2010-12-02 14:29:07 -07:00
Brian Paul
2addcb7b50 mesa: replace large/MAX_WIDTH stack allocations with heap allocations 2010-12-02 14:29:01 -07:00
Brian Paul
896a08bde6 mesa: replace large/MAX_WIDTH stack allocations with heap allocations 2010-12-02 14:26:55 -07:00
Alex Deucher
fae7cb8ed8 r600g: bump texture/cb limits appropriately for evergreen 2010-12-02 16:11:08 -05:00
Alex Deucher
a3dc947057 r600c: bump texture limits to hw limits 2010-12-02 16:11:07 -05:00
Zack Rusin
e737b9294a gallium/util: add states relevant to geometry shaders 2010-12-02 15:50:15 -05:00
José Fonseca
64da9a1a04 mesa: Temporary hack to prevent stack overflow on windows
e.g. st_readpixels is trying to alloca() an huge ammount of memory from
the stack.
2010-12-02 20:30:59 +00:00
José Fonseca
63df5a464e wgl: Fix visual's buffer_mask configuration. 2010-12-02 20:21:39 +00:00
José Fonseca
43121f2086 mapi: Hack to avoid vgCreateFont being generated as vgCreateFontA.
Right fix is probably stop C-preprocessor abuse and stick 100% with
scripted code generation.
2010-12-02 19:39:55 +00:00
Eric Anholt
43491adc44 mesa: Add getters for ARB_copy_buffer's attachment points.
Fixes more complaints by oglconform.
2010-12-02 10:28:55 -08:00
Eric Anholt
7cba339375 mesa: Add getters for the rest of the supported draw buffers.
MAX_DRAW_BUFFERS is 8, so allow all 8 GL_DRAW_BUFFER# to be retrieved.
Fixes complaints by oglconform.
2010-12-02 10:28:52 -08:00
Eric Anholt
b381eff141 glsl: Fix flipped return of has_value() for array constants.
Fixes glsl-array-uniform.
2010-12-02 10:28:51 -08:00
José Fonseca
e3659329e0 WIN32_THREADS -> WIN32
Fixes nasty bug where some parts of the code didn't define WIN32_THREADS
and were using the integer mutex implementation, causing even confusion
to the debuggers.

And there is little interest of other thread implemenation on Win32
besides Win32 threads.
2010-12-02 17:35:03 +00:00
Brian Paul
af4f75c8fe softpipe: increase max texture size to 16K 2010-12-02 10:10:05 -07:00
Brian Paul
4b08f35487 mesa: raise max texture sizes to 16K
This allows 16K x 16K 2D textures, for example, but we don't want to
allow that for 3D textures.  The new gl_constants::MaxTextureMBytes
field is used to prevent allocating too large of texture image.
This allows a 16K x 32 x 32 3D texture, for example, but prevents 16K^3.
Drivers can override this limit.  The default is currently 1GB.

Apps should use the proxy texture mechanism to determine the actual
max texture size.
2010-12-02 10:09:03 -07:00
Marek Olšák
23390e2f5c r300/compiler: disable the swizzle lowering pass in vertex shaders
It was a no-op because all swizzles are native there.
2010-12-02 17:48:08 +01:00
José Fonseca
14e2dc9c66 wgl: Unreference the current framebuffer after the make_current call.
To prevent a dangling pointer dereference.
2010-12-02 16:28:36 +00:00
José Fonseca
63c05c96e7 util: Don't try to use imagehlp on mingw. 2010-12-02 15:14:58 +00:00
José Fonseca
50a52ba67e util: __builtin_frame_address() doesn't work on mingw. 2010-12-02 15:14:58 +00:00
José Fonseca
744ef8721b util: Plug leaks in util_destroy_gen_mipmap. 2010-12-02 15:14:58 +00:00
José Fonseca
e5ffa9aa47 wgl: Fix double free. Remove dead code. 2010-12-02 15:14:58 +00:00
Marek Olšák
f3021c688f r300g: fix up cubemap texture offset computation
Broken since 4c70014626.
2010-12-02 14:44:28 +01:00
José Fonseca
431c478df9 util: C++ safe. 2010-12-02 12:26:55 +00:00
José Fonseca
27ba2eb33b retrace: Some fixes. 2010-12-02 12:17:07 +00:00
Chia-I Wu
cb2791213a st/vega: polygon_array requires a deep free.
A polygon array is an array of pointers to polygons.  The polygons
should be freed with the array.
2010-12-02 17:54:23 +08:00
Chia-I Wu
b950d6fa5d st/vega: Destroy the pipe context with vg_context. 2010-12-02 17:27:38 +08:00
Chad Versace
7528f143df glsl: Fix linker bug in cross_validate_globals()
Cause linking to fail if a global has mismatching invariant qualifiers.

See https://bugs.freedesktop.org/show_bug.cgi?id=30261
2010-12-01 20:40:07 -08:00
Roland Scheidegger
4c70014626 gallium: support for array textures and related changes
resources have a array_size parameter now.
get_tex_surface and tex_surface_destroy have been renamed to create_surface
and surface_destroy and moved to context, similar to sampler views (and
create_surface now uses a template just like create_sampler_view). Surfaces
now really should only be used for rendering. In particular they shouldn't be
used as some kind of 2d abstraction for sharing a texture. offset/layout fields
don't make sense any longer and have been removed, width/height should go too.
surfaces and sampler views now specify a layer range (for texture resources),
layer is either array slice, depth slice or cube face.
pipe_subresource is gone array slices (or cube faces) are now treated the same
as depth slices in transfers etc. (that is, they use the z coord of the
respective functions).

Squashed commit of the following:

commit a45bd509014743d21a532194d7b658a1aeb00cb7
Merge: 1aeca28 32e1e59
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Thu Dec 2 04:32:06 2010 +0100

    Merge remote branch 'origin/master' into gallium-array-textures

    Conflicts:
    	src/gallium/drivers/i915/i915_resource_texture.c
    	src/gallium/drivers/i915/i915_state_emit.c
    	src/gallium/drivers/i915/i915_surface.c

commit 1aeca287a827f29206078fa1204715a477072c08
Merge: 912f042 6f7c8c3
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Thu Dec 2 00:37:11 2010 +0100

    Merge remote branch 'origin/master' into gallium-array-textures

    Conflicts:
    	src/gallium/state_trackers/vega/api_filters.c
    	src/gallium/state_trackers/vega/api_images.c
    	src/gallium/state_trackers/vega/mask.c
    	src/gallium/state_trackers/vega/paint.c
    	src/gallium/state_trackers/vega/renderer.c
    	src/gallium/state_trackers/vega/st_inlines.h
    	src/gallium/state_trackers/vega/vg_context.c
    	src/gallium/state_trackers/vega/vg_manager.c

commit 912f042e1d439de17b36be9a740358c876fcd144
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Wed Dec 1 03:01:55 2010 +0100

    gallium: even more compile fixes after merge

commit 6fc95a58866d2a291def333608ba9c10c3f07e82
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Wed Dec 1 00:22:26 2010 +0100

    gallium: some fixes after merge

commit a8d5ffaeb5397ffaa12fb422e4e7efdf0494c3e2
Merge: f7a202f 2da02e7
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Tue Nov 30 23:41:26 2010 +0100

    Merge remote branch 'origin/master' into gallium-array-textures

    Conflicts:
    	src/gallium/drivers/i915/i915_state_emit.c
    	src/gallium/state_trackers/vega/api_images.c
    	src/gallium/state_trackers/vega/vg_context.c

commit f7a202fde2aea2ec78ef58830f945a5e214e56ab
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Wed Nov 24 19:19:32 2010 +0100

    gallium: even more fixes/cleanups after merge

commit 6895a7f969ed7f9fa8ceb788810df8dbcf04c4c9
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Wed Nov 24 03:07:36 2010 +0100

    gallium: more compile fixes after merge

commit af0501a5103b9756bc4d79167bd81051ad6e8670
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Tue Nov 23 19:24:45 2010 +0100

    gallium: lots of compile fixes after merge

commit 0332003c2feb60f2a20e9a40368180c4ecd33e6b
Merge: 26c6346 b6b91fa
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Tue Nov 23 17:02:26 2010 +0100

    Merge remote branch 'origin/master' into gallium-array-textures

    Conflicts:
    	src/gallium/auxiliary/gallivm/lp_bld_sample.c
    	src/gallium/auxiliary/util/u_blit.c
    	src/gallium/auxiliary/util/u_blitter.c
    	src/gallium/auxiliary/util/u_inlines.h
    	src/gallium/auxiliary/util/u_surface.c
    	src/gallium/auxiliary/util/u_surfaces.c
    	src/gallium/docs/source/context.rst
    	src/gallium/drivers/llvmpipe/lp_rast.c
    	src/gallium/drivers/nv50/nv50_state_validate.c
    	src/gallium/drivers/nvfx/nv04_surface_2d.c
    	src/gallium/drivers/nvfx/nv04_surface_2d.h
    	src/gallium/drivers/nvfx/nvfx_buffer.c
    	src/gallium/drivers/nvfx/nvfx_miptree.c
    	src/gallium/drivers/nvfx/nvfx_resource.c
    	src/gallium/drivers/nvfx/nvfx_resource.h
    	src/gallium/drivers/nvfx/nvfx_state_fb.c
    	src/gallium/drivers/nvfx/nvfx_surface.c
    	src/gallium/drivers/nvfx/nvfx_transfer.c
    	src/gallium/drivers/r300/r300_state_derived.c
    	src/gallium/drivers/r300/r300_texture.c
    	src/gallium/drivers/r600/r600_blit.c
    	src/gallium/drivers/r600/r600_buffer.c
    	src/gallium/drivers/r600/r600_context.h
    	src/gallium/drivers/r600/r600_screen.c
    	src/gallium/drivers/r600/r600_screen.h
    	src/gallium/drivers/r600/r600_state.c
    	src/gallium/drivers/r600/r600_texture.c
    	src/gallium/include/pipe/p_defines.h
    	src/gallium/state_trackers/egl/common/egl_g3d_api.c
    	src/gallium/state_trackers/glx/xlib/xm_st.c
    	src/gallium/targets/libgl-gdi/gdi_softpipe_winsys.c
    	src/gallium/targets/libgl-gdi/libgl_gdi.c
    	src/gallium/tests/graw/tri.c
    	src/mesa/state_tracker/st_cb_blit.c
    	src/mesa/state_tracker/st_cb_readpixels.c

commit 26c6346b385929fba94775f33838d0cceaaf1127
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Mon Aug 2 19:37:21 2010 +0200

    fix more merge breakage

commit b30d87c6025eefe7f6979ffa8e369bbe755d5c1d
Merge: 9461bf3 1f1928d
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Mon Aug 2 19:15:38 2010 +0200

    Merge remote branch 'origin/master' into gallium-array-textures

    Conflicts:
    	src/gallium/drivers/llvmpipe/lp_rast.c
    	src/gallium/drivers/llvmpipe/lp_rast_priv.h
    	src/gallium/drivers/r300/r300_blit.c
    	src/gallium/drivers/r300/r300_screen_buffer.c
    	src/gallium/drivers/r300/r300_state_derived.c
    	src/gallium/drivers/r300/r300_texture.c
    	src/gallium/drivers/r300/r300_texture.h
    	src/gallium/drivers/r300/r300_transfer.c
    	src/gallium/drivers/r600/r600_screen.c
    	src/gallium/drivers/r600/r600_state.c
    	src/gallium/drivers/r600/r600_texture.c
    	src/gallium/drivers/r600/r600_texture.h
    	src/gallium/state_trackers/dri/common/dri1_helper.c
    	src/gallium/state_trackers/dri/sw/drisw.c
    	src/gallium/state_trackers/xorg/xorg_exa.c

commit 9461bf3cfb647d2301364ae29fc3084fff52862a
Merge: 17492d7 0eaccb3
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Thu Jul 15 20:13:45 2010 +0200

    Merge commit 'origin/master' into gallium-array-textures

    Conflicts:
    	src/gallium/auxiliary/util/u_blitter.c
    	src/gallium/drivers/llvmpipe/lp_rast.c
    	src/gallium/drivers/llvmpipe/lp_surface.c
    	src/gallium/drivers/r300/r300_render.c
    	src/gallium/drivers/r300/r300_state.c
    	src/gallium/drivers/r300/r300_texture.c
    	src/gallium/drivers/r300/r300_transfer.c
    	src/gallium/tests/trivial/quad-tex.c

commit 17492d705e7b7f607b71db045c3bf344cb6842b3
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Fri Jun 18 10:58:08 2010 +0100

    gallium: rename element_offset/width fields in views to first/last_element

    This is much more consistent with the other fields used there
    (first/last level, first/last layer).
    Actually thinking about removing the ugly union/structs again and
    rename first/last_layer to something even more generic which could also
    be used for buffers (like first/last_member) without inducing headaches.

commit 1b717a289299f942de834dcccafbab91361e20ab
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Thu Jun 17 14:46:09 2010 +0100

    gallium: remove PIPE_SURFACE_LAYOUT_LINEAR definition

    This was only used by the layout field of pipe_surface, but this
    driver internal stuff is gone so there's no need for this driver independent
    layout definition neither.

commit 10cb644b31b3ef47e6c7b55e514ad24bb891fac4
Merge: 5691db9 c85971d
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Thu Jun 17 12:20:41 2010 +0100

    Merge commit 'origin/master' into gallium-array-textures

    Conflicts:
    	src/gallium/docs/source/glossary.rst
    	src/gallium/tests/graw/fs-test.c
    	src/gallium/tests/graw/gs-test.c

commit 5691db960ca3d525ce7d6c32d9c7a28f5e907f3b
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Thu Jun 17 11:29:03 2010 +0100

    st/wgl: fix interface changes bugs

commit 2303ec32143d363b46e59e4b7c91b0ebd34a16b2
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Wed Jun 16 19:42:32 2010 +0100

    gallium: adapt code to interface changes...

commit dcae4f586f0d0885b72674a355e5d56d47afe77d
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Wed Jun 16 19:42:05 2010 +0100

    gallium: separate depth0 and array_size in the resource itself.

    These fields are still mutually exclusive (since no 3d array textures exist)
    but it ultimately seemed to error-prone to adapt all code accept the new
    meaning of depth0 (drivers stick that into hardware regs, calculate mipmap
    sizes etc.). And it isn't really cleaner anyway.
    So, array textures will have depth0 of 1, but instead use array_size,
    3D textures will continue to use depth0 (and have array_size of 1). Cube
    maps also will use array_size to indicate their 6 faces, but since all drivers
    should just be fine by inferring this themselves from the fact it's a cube map
    as they always used to nothing should break.

commit 621737a638d187d208712250fc19a91978fdea6b
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Wed Jun 16 17:47:38 2010 +0100

    gallium: adapt code to interface changes

    There are still usages of pipe_surface where pipe_resource should be used,
    which should eventually be fixed.

commit 2d17f5efe166b2c3d51957c76294165ab30b8ae2
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Wed Jun 16 17:46:14 2010 +0100

    gallium: more interface changes

    In particular to enable usage of buffers in views, and ability to use a
    different pipe_format in pipe_surface.
    Get rid of layout and offset parameter in pipe_surface - the former was
    not used in any (public) code anyway, and the latter should either be computed
    on-demand or driver can use subclass of pipe_surface.
    Also make create_surface() use a template to be more consistent with
    other functions.

commit 71f885ee16aa5cf2742c44bfaf0dc5b8734b9901
Merge: 3232d11 8ad410d
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Mon Jun 14 14:19:51 2010 +0100

    Merge commit 'origin/master' into gallium-array-textures

    Conflicts:
    	src/gallium/auxiliary/util/u_box.h
    	src/gallium/drivers/nv50/nv50_surface.c
    	src/gallium/drivers/nvfx/nvfx_surface.c
    	src/gallium/drivers/r300/r300_blit.c
    	src/gallium/drivers/r300/r300_texture.c
    	src/gallium/drivers/r300/r300_transfer.c
    	src/gallium/drivers/r600/r600_blit.c
    	src/gallium/drivers/r600/r600_screen.h
    	src/gallium/include/pipe/p_state.h

commit 3232d11fe3ebf7686286013c357b404714853984
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Mon Jun 14 11:40:04 2010 +0100

    mesa/st: adapt to interface changes

    still need to fix pipe_surface sharing
    (as that is now per-context).
    Also broken is depth0 handling - half the code assumes
    this is also used for array textures (and hence by extension
    of that cube maps would have depth 6), half the code does not...

commit f433b7f7f552720e5eade0b4078db94590ee85e1
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Mon Jun 14 11:35:52 2010 +0100

    gallium: fix a couple of bugs in interface chnage fixes

commit 818366b28ea18f514dc791646248ce6f08d9bbcf
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:42:11 2010 +0200

    targets: adapt to interface changes

    Yes even that needs adjustments...

commit 66c511ab1682c9918e0200902039247793acb41e
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:41:13 2010 +0200

    tests: adapt to interface changes

    Everything needs to be fixed :-(.

commit 6b494635d9dbdaa7605bc87b1ebf682b138c5808
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:39:50 2010 +0200

    st: adapt non-rendering state trackers to interface changes

    might not be quite right in all places, but they really don't want
    to use pipe_surface.

commit 00c4289a35d86e4fe85919ec32aa9f5ffe69d16d
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:38:48 2010 +0200

    winsys: adapt to interface changes

commit 39d858554dc9ed5dbc795626fec3ef9deae552a0
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:26:54 2010 +0200

    st/python: adapt to interface changes

    don't think that will work, sorry.

commit 6e9336bc49b32139cec4e683857d0958000e15e3
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:26:07 2010 +0200

    st/vega: adapt to interface changes

commit e07f2ae9aaf8842757d5d50865f76f8276245e11
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:25:56 2010 +0200

    st/xorg: adapt to interface changes

commit 05531c10a74a4358103e30d3b38a5eceb25c947f
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:24:53 2010 +0200

    nv50: adapt to interface changes

commit 97704f388d7042121c6d496ba8c003afa3ea2bf3
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:24:45 2010 +0200

    nvfx: adapt to interface changes

commit a8a9c93d703af6e8f5c12e1cea9ec665add1abe0
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:24:01 2010 +0200

    i965g: adapt to interface changes

commit 0dde209589872d20cc34ed0b237e3ed7ae0e2de3
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:22:38 2010 +0200

    i915g: adapt to interface changes

commit 5cac9beede69d12f5807ee1a247a4c864652799e
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:20:58 2010 +0200

    svga: adapt to interface changes

    resource_copy_region still looking fishy.
    Was not very suited to unified zslice/face approach...

commit 08b5a6af4b963a3e4c75fc336bf6c0772dce5150
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:20:01 2010 +0200

    rbug: adapt to interface changes

    Not sure if that won't need changes elsewhere?

commit c9fd24b1f586bcef2e0a6e76b68e40fca3408964
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:19:31 2010 +0200

    trace: adapt to interface changes

commit ed84e010afc5635a1a47390b32247a266f65b8d1
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:19:21 2010 +0200

    failover: adapt to interface changes

commit a1d4b4a293da933276908e3393435ec4b43cf201
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:19:12 2010 +0200

    identity: adapt to interface changes

commit a8dd73e2c56c7d95ffcf174408f38f4f35fd2f4c
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:18:55 2010 +0200

    softpipe: adapt to interface changes

commit a886085893e461e8473978e8206ec2312b7077ff
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:18:44 2010 +0200

    llvmpipe: adapt to interface changes

commit 70523f6d567d8b7cfda682157556370fd3c43460
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:18:14 2010 +0200

    r600g: adapt to interface changes

commit 3f4bc72bd80994865eb9f6b8dfd11e2b97060d19
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:18:05 2010 +0200

    r300g: adapt to interface changes

commit 5d353b55ee14db0ac0515b5a3cf9389430832c19
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:17:37 2010 +0200

    cell: adapt to interface changes

    not even compile tested

commit cf5d03601322c2dcb12d7a9c2f1745e2b2a35eb4
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:14:59 2010 +0200

    util: adapt to interface changes

    amazing how much code changes just due to some subtle interface changes?

commit dc98d713c6937c0e177fc2caf23020402cc7ea7b
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Sat Jun 12 02:12:40 2010 +0200

    gallium: more interface fail, docs

    this also changes flush_frontbuffer to use a pipe_resource instead of
    a pipe_surface - pipe_surface is not meant to be (or at least no longer)
    an abstraction for standalone 2d images which get passed around.
    (This has also implications for the non-rendering state-trackers.)

commit 08436d27ddd59857c22827c609b692aa0c407b7b
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Thu Jun 10 17:42:52 2010 +0200

    gallium: fix array texture interface changes bugs, docs

commit 4a4d927609b62b4d7fb9dffa35158afe282f277b
Author: Roland Scheidegger <sroland@vmware.com>
Date:   Thu Jun 3 22:02:44 2010 +0200

    gallium: interface changes for array textures and related cleanups

    This patch introduces array textures to gallium (note they are not immediately
    usable without the associated changes to the shader side).
    Also, this abandons pipe_subresource in favor of using level and layer
    parameters since the distinction between several faces (which was part of
    pipe_subresource for cube textures) and several z slices (which were not part
    of pipe_subresource but instead part of pipe_box where appropriate for 3d
    textures) is gone at the resource level.
    Textures, be it array, cube, or 3d, now use a "unified" set of parameters,
    there is no distinction between array members, cube faces, or 3d zslices.
    This is unlike d3d10, whose subresource index includes layer information for
    array textures, but which considers all z slices of a 3d texture to be part
    of the same subresource.
    In contrast to d3d10, OpenGL though reuses old 2d and 3d function entry points
    for 1d and 2d array textures, respectively, which also implies that for instance
    it is possible to specify all layers of a 2d array texture at once (note that
    this is not possible for cube maps, which use the 2d entry points, although
    it is possible for cube map arrays, which aren't supported yet in gallium).
    This should possibly make drivers a bit simpler, and also get rid of mutually
    exclusive parameters in some functions (as z and face were exclusive), one
    potential downside would be that 3d array textures could not easily be supported
    without reverting this, but those are nowhere to be seen.

    Also along with adjusting to new parameters, rename get_tex_surface /
    tex_surface_destroy to create_surface / surface_destroy and move them from
    screen to context, which reflects much better what those do (they are analogous
    to create_sampler_view / sampler_view_destroy).

    PIPE_CAP_ARRAY_TEXTURES is used to indicate if a driver supports all of this
    functionality (that is, both sampling from array texture as well as use a range
    of layers as a render target, with selecting the layer from the geometry shader).
2010-12-02 04:33:43 +01:00
Xiang, Haihao
32e1e59146 i965: add support for polygon mode on Sandybridge.
This fixes some mesa demos such as fslight/engine in wireframe mode.
2010-12-02 09:54:35 +08:00
Jakob Bornecrantz
de3ff5af49 i915g: Make sure that new vbo gets updated
Malloc likes to reuse old address as soon as possible this would cause the
new vbo buffer to get the same address as the old. So make sure we set it to
NULL when we allocate a new one. This fixes ipers which will fill up a couple
of VBO buffers per frame.

Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:14 +01:00
Jakob Bornecrantz
442e567aa0 i915g: Improve debug printing for textures
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:14 +01:00
Chris Wilson
f6476822a0 i915g: Fix closure of full batch buffers
Signed-off-by: Chris Wilson <chris@chris-wilson.co.uk>
[danvet: incorporate comments by Dr_Jakob]
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:14 +01:00
Daniel Vetter
600454084b i915g: track TODO items
Just as a reminder for all things currently broken with i915g.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:14 +01:00
Daniel Vetter
0246b2bf27 i915g: assert(depth_surface->offset == 0)
Shouldn't happen and not supported, anyway.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:14 +01:00
Daniel Vetter
1a47a25d2c i915g: enable x-tiling for render targets
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:13 +01:00
Daniel Vetter
8af684e37e i915g: switch rendering to mipmapped textures to (x,y) offsets
Byte offsets simply don't work with tiled render targets when using
tiling bits. Luckily we can cox the hw into doing the right thing
with the DRAWING_RECT command by disabling the drawing rect offset
for the depth buffer.

Minor fixes by Jakob Bornecrantz.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:13 +01:00
Daniel Vetter
9493fe85d1 i915g: enable X-tiling for textures
Tiling is rather fragile in general and results in pure blackness when
unlucky.  Hence add a new option to disable tiling.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:13 +01:00
Daniel Vetter
32345610cc i915g: don't pot-align stride for tiled buffers
libdrm will do this for us, if it's required (i.e. if tiling is
possible).

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:13 +01:00
Daniel Vetter
6ae6e0c6fe i915g: postpone mipmap/face offset calculation
libdrm-intel can refuse to tile buffers for various reasons. For
potentially tiled buffers the stride is therefore only known after
the iws->buffer_create_tiled call. Unconditionally rounding up to whatever
tiling requires wastes space, so rework the code to not use tex->stride
in the layout code.

Luckily only the mimap/face offset calculation uses it which can easily
be solved by storing an (x, y) coordinate pair. Furthermore this will
be usefull later for properly supporting rendering into the different
levels of tiled mipmap textures.

v2: switch to nblocks(x|y): More in line with gallium and better
suited for rendering into mipmap textures.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:13 +01:00
Daniel Vetter
f34fd58ec9 i915g: implement unfenced relocs for textures using tiling bits
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:13 +01:00
Daniel Vetter
a95e694eaf i915g: implement unfenced color&depth buffer using tiling bits
v2: Clarify tiling bit calculation as suggested by Chris Wilson.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:13 +01:00
Daniel Vetter
2ff0879a63 i915g: return tiling in iws->buffer_from_handle
This is needed to properly implement tiling flags. And the gem
implemention fo buffer_from_handle already calls get_tiling, so
it's for free.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:13 +01:00
Daniel Vetter
135b083461 i915g: prepare winsys/batchbuffer for execbuf2
Wire up a fenced parameter, switch all relocations to _FENCED

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:13 +01:00
Daniel Vetter
1c60840338 i915g: switch to tiled allocations, kill set_fence
This way relaxed fencing is handled by libdrm. And buffers _can't_
ever change their tiling.

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:13 +01:00
Daniel Vetter
4a666488c4 i915g: add winsys function to create tiled buffers
Different kernels have different restrictions for tiled buffers.
Hence use the libdrm abstraction to calculate the necessary
stride and height alignment requirements.

Not yet used.

v2: Incorporate review comments from Jakob Bornecrantz

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:12 +01:00
Daniel Vetter
c62f5c7e7b i915g: drop alignment parameter from iws->buffer_create
It's unnecessary. The kernel gem ignores it totally and we can't
run on the old userspace fake bo manager due to lack of dri2.

Also drop the redundant name string from the sw winsys as suggested
by Jakob Bornecrantz

Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-12-02 01:34:12 +01:00
Eric Anholt
b4f585665c glsl: Mark the array access for whole-array comparisons.
By not doing so, the uniform contents of
glsl-uniform-non-uniform-array-compare.shader_test was getting thrown
out since nobody was recorded as dereferencing the array.
2010-12-01 16:14:34 -08:00
Eric Anholt
f361f8a8a9 i965: Add support for loops in the VS.
This follows the changes done for the FS alongside the EU emit code.
2010-12-01 16:14:34 -08:00
Eric Anholt
251d15d888 i965: Enable IF statements in the VS.
While the actual IF instructions were fixed by Zhenyu, we were still
flattening them to conditional moves.
2010-12-01 16:14:34 -08:00
Eric Anholt
843a6a308e i965: Add support for gen6 CONTINUE instruction emit.
At this point, piglit tests for fragment shader loops are working.
2010-12-01 16:14:34 -08:00
Eric Anholt
00e5a743e2 i965: Add support for gen6 BREAK ISA emit.
There are now two targets: the hop-to-end-of-block target, and the
target for where to resume execution for active channels.
2010-12-01 16:14:33 -08:00
Eric Anholt
4890e0f09c i965: Add support for gen6 DO/WHILE ISA emit.
There's no more DO since there's no more mask stack, and WHILE has
been shuffled like IF was.
2010-12-01 16:14:31 -08:00
Eric Anholt
a9f62881a3 i965: Dump the WHILE jump distance on gen6. 2010-12-01 15:22:59 -08:00
Marek Olšák
fcf6b353bf r300g: disable ARB_texture_swizzle if S3TC is enabled on r3xx-only
r3xx cannot swizzle compressed textures. r4xx+ is unaffected.

NOTE: This is a candidate for the 7.9 branch.
2010-12-01 22:54:05 +01:00
Marek Olšák
6478a4de14 r300g: fix texture swizzling with compressed textures on r400-r500
This fixes all S3TC piglit/texwrap tests.

NOTE: This is a candidate for the 7.9 branch.
2010-12-01 22:29:09 +01:00
Ian Romanick
c92550be64 i915: Correctly generate unconditional KIL instructions
Fixes piglit test glsl-fs-discard-03.

NOTE: This is a candidate for the 7.9 branch.
2010-12-01 12:01:13 -08:00
Ian Romanick
b6dbc06742 i915: Request that POW instructions be lowered 2010-12-01 12:01:13 -08:00
Ian Romanick
c4285be9a5 glsl: Lower ir_binop_pow to a sequence of EXP2 and LOG2 2010-12-01 12:01:13 -08:00
Ian Romanick
da61afa738 glsl: Use M_LOG2E constant instead of calling log2 2010-12-01 12:01:12 -08:00
Kenneth Graunke
d2d7a273c5 glsl: Add comments to lower_jumps (from the commit message).
This is essentially Luca's commit message, but placed at the top of the
file.
2010-12-01 11:52:43 -08:00
Kenneth Graunke
1802cb9baf glsl: Remove "discard" support from lower_jumps.
The new lower_discard and opt_discard_simplification passes should
handle all the necessary transformations, so lower_jumps doesn't need to
support it.

Also, lower_jumps incorrectly handled conditional discards - it would
unconditionally truncate all code after the discard.  Rather than fixing
the bug, simply remove the code.

NOTE: This is a candidate for the 7.9 branch.
2010-12-01 11:52:43 -08:00
Kenneth Graunke
940df10100 glsl: Add a lowering pass to move discards out of if-statements.
This should allow lower_if_to_cond_assign to work in the presence of
discards, fixing bug #31690 and likely #31983.

NOTE: This is a candidate for the 7.9 branch.
2010-12-01 11:52:43 -08:00
Kenneth Graunke
9a1d063c6d glsl: Add an optimization pass to simplify discards.
NOTE: This is a candidate for the 7.9 branch.
2010-12-01 11:52:43 -08:00
Marek Olšák
ead2ea89f4 ir_to_mesa: Add support for conditional discards.
NOTE: This is a candidate for the 7.9 branch.

Signed-off-by: Marek Olšák <maraeo@gmail.com>
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
2010-12-01 11:52:36 -08:00
Alex Deucher
2ca9256911 r600c: fix some opcodes on evergreen
There were a few places where we were using the wrong opcodes
on evergreen.  arl still needs to be fixed on evergreen; see
r600g for reference.

NOTE: This is a candidate for the 7.9 branch.

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2010-12-01 13:26:02 -05:00
Marek Olšák
e6d798948e r300/compiler: implement and lower OPCODE_CLAMP
Needed for st/vega.
2010-12-01 18:29:50 +01:00
José Fonseca
6f7c8c3cbf vega: Remove extraneous ; 2010-12-01 12:31:21 +00:00
José Fonseca
792caebced scons: Move MSVS_VERSION option to common module. 2010-12-01 12:23:12 +00:00
José Fonseca
2aa3203660 svga: Silence debug printf. 2010-12-01 12:23:12 +00:00
Chia-I Wu
0dadc0b808 st/vega: Avoid unnecessary constant bufer upload.
Remember the last uploaded data and avoid re-uploading.
2010-12-01 18:36:27 +08:00
Chia-I Wu
d7a6901cac st/vega: Initialize pipe states with renderer.
Initialize vertex elements, rasterizer, stencil ref, and vertex shader
with renderer_create.  Remove RASTERIZER_DIRTY and VS_DIRTY flags.
2010-12-01 18:07:00 +08:00
Chia-I Wu
c91c386012 st/vega: Create drawing surface mask as needed.
As the blend texture, a drawing surface mask is used when masking is
enabled.  It should be created as needed.

s/alpha_mask/surface_mask/ to follow OpenVG 1.1 naming.
2010-12-01 18:03:06 +08:00
Chia-I Wu
04f342b417 st/vega: Delay blend texture creation until needed.
It is used for more advanced blending or mask update.  It might not be
ever needed for some applications.
2010-12-01 17:46:34 +08:00
Chia-I Wu
f8e0dd246b st/vega: Remove st_inlines.h.
Per b0427bedde.
2010-12-01 17:00:22 +08:00
Chia-I Wu
2bb788ccc6 st/vega: Simplify radial gradient.
Eight less instructions with comments.
2010-12-01 16:46:01 +08:00
Chia-I Wu
d7aa03b4fe st/vega: Fix degenerate paints.
Fix the case that the two points of a linear gradient coincide, or the
case that the radius of a radial gradient is equal to or less than 0.
2010-12-01 16:46:01 +08:00
Zhenyu Wang
c530fd3f8a i965: also using align1 mode for math2 on sandybridge
Like Eric's workaround patch of commit 490c23ee6b.
This forces to align1 mode for math2 too.
2010-12-01 15:04:18 +08:00
Chia-I Wu
06e7a55028 st/vega: Fix negated logic in image_draw.
A typo from last commit.
2010-12-01 11:39:33 +08:00
Chia-I Wu
b06de80843 st/vega: Fix paint coordinates transformations.
Depending on whether vgDrawPath(mode), vgDrawImage, or vgDrawGlyph[s] is
called, different paint-to-user and user-to-surface matrices should be
used to derive the sample points for the paint.

This fixes "paint" demo.
2010-12-01 11:31:00 +08:00
Chia-I Wu
ca8bc9c05b st/vega: Bump version to 1.1. 2010-12-01 11:23:53 +08:00
Chia-I Wu
e360f91f15 st/vega: Add color transformation support.
Per OpenVG 1.1.  A new shader stage is added.  It uses the first two
constants of the fragment shader for color transformation parameters.
2010-12-01 11:23:52 +08:00
Chia-I Wu
213e288e78 st/vega: More flexible shader selection.
Divide bits of VegaShaderType into 6 groups: paint, image, mask, fill,
premultiply, and bw.  Each group represents a stage.  At most one shader
from each group will be selected when constructing the final fragment
shader.
2010-12-01 11:23:52 +08:00
Chia-I Wu
30cab4b6cb st/vega: Revive mask layer support. 2010-12-01 11:23:52 +08:00
Chia-I Wu
5d64a06a63 st/vega: Add primitive text support.
Optional features such as auth-hinting are not implemented.  There is no
anti-aliasing, and no effort is done to keep the glyph origin integral.
So the text quality is poor.
2010-12-01 11:23:52 +08:00
Chia-I Wu
34f466d4e6 st/vega: Make image_draw take a matrix. 2010-12-01 11:23:52 +08:00
Chia-I Wu
165cb19abc st/vega: Make path_render and path_stroke take a matrix. 2010-12-01 11:23:51 +08:00
Chia-I Wu
d873f1f5b6 st/vega: Fix image sampler views for alpha-only formats.
For alpha-only VG formats, R = G = B = 1.0.
2010-12-01 11:23:51 +08:00
Chia-I Wu
56f02cedfa st/vega: Update to latest headers. 2010-12-01 11:23:51 +08:00
Chia-I Wu
20ce148c30 st/vega: Get rid of renderer_copy_texture. 2010-12-01 11:23:51 +08:00
Chia-I Wu
33ca973e7a st/vega: vg_copy_texture and vg_copy_surface should share code. 2010-12-01 11:23:51 +08:00
Chia-I Wu
4690cdfe07 st/vega: Clean up renderer fields and functions. 2010-12-01 11:23:50 +08:00
Chia-I Wu
ace4539e88 st/vega: Clean up vg_context fields and functions. 2010-12-01 11:23:50 +08:00
Chia-I Wu
635fe3e192 st/vega: vg_manager should care about only the color buffer.
Move depth/stencil buffer, blend texture view, and alpha mask view
creation to vg_context.c.
2010-12-01 11:23:50 +08:00
Chia-I Wu
ee0f1ab923 st/vega: Make shader_bind call into the renderer.
With this commit, the pipe states are entirely managed by the renderer.
The rest of the code interfaces with the renderer instead of
manipulating the states directly.
2010-12-01 11:23:50 +08:00
Chia-I Wu
b730f0fc52 st/vega: Move g3d states to renderer.
Let vg_context focus on OpenVG states and renderer focus on gallium
states.
2010-12-01 11:23:50 +08:00
Chia-I Wu
96c6637a13 st/vega: Use st_framebuffer for fb width/height.
This allows us to eventually make g3d states opaque.
2010-12-01 11:23:50 +08:00
Chia-I Wu
438359597c st/vega: Delay fb state update to vg_validate_state.
vg_manager_validate_framebuffer should mark the fb dirty and have
vg_validate_state call cso_set_framebuffer.  Rename VIEWPORT_DIRTY to
FRAMEBUFFER_DIRTY.
2010-12-01 11:23:49 +08:00
Chia-I Wu
3b71cb6ad6 st/vega: Add POLYGON_STENCIL and POLYGON_FILL renderer state.
The states are designated for polygon filling.  Polygon filling is a
two-pass process utilizing the stencil buffer.  polygon_fill and
polygon_array_fill functions are updated to make use of the state.
2010-12-01 11:23:49 +08:00
Chia-I Wu
b23f732075 st/vega: Use the renderer for vgMask.
vgMask renders to the alpha mask with special fragment shaders.  The
operation can be supported by switching the renderer to FILTER state.
2010-12-01 11:23:49 +08:00
Chia-I Wu
e5968a5355 st/vega: Add FILTER renderer state for image filtering.
The state is designated to perform image filtering.  execute_filter is
updated to make use of the state.
2010-12-01 11:23:49 +08:00
Chia-I Wu
6b241f532a st/vega: Add CLEAR renderer state for vgClear.
This state provides the ability to clear rectangles of the framebuffer
to the specified color, honoring scissoring.  vegaClear is updated to
make use of the state.
2010-12-01 11:23:49 +08:00
Chia-I Wu
54cb382ea5 st/vega: Add SCISSOR renderer state.
The state can be used to set rectangles of the depth buffer to 0.0f.
update_clip_state is changed to use the state for scissor update.
2010-12-01 11:23:49 +08:00
Chia-I Wu
e31a04ea3b st/vega: Add DRAWTEX renderer state.
This state provides glDrawTex-like function.  It can be used for
vgSetPixels.

Rather than modifying every user of the renderer, this commit instead
modifies renderer_copy_surface to use DRAWTEX or COPY state internally
depending on whether the destination is the framebuffer.
2010-12-01 11:23:48 +08:00
Chia-I Wu
59309337e4 st/vega: Overhaul renderer with renderer states.
Renderer states are high-level states to perform specific tasks.  The
renderer is initially in INIT state.  In that state, the renderer is
used for OpenVG pipeline.

This commit adds a new COPY state to the renderer.  The state is used
for copying between two pipe resources using textured drawing.  It can
be used for vgCopyImage, for example.

Rather than modifying every user of the renderer, this commit instead
modifies renderer_copy_texture to use the COPY state internally.
2010-12-01 11:23:48 +08:00
Chia-I Wu
709e57ae4f llvmpipe: Fix build errors on x86.
The errors were introduced by
efc82aef35.
2010-12-01 11:23:48 +08:00
Kristian Høgsberg
7db49853f0 docs: Fix MESA_drm_image typo 2010-11-30 21:14:50 -05:00
Brian Paul
efc82aef35 gallivm/llvmpipe: squash merge of the llvm-context branch
This branch defines a gallivm_state structure which contains the
LLVMBuilderRef, LLVMContextRef, etc.  All data structures built with
this object can be periodically freed during a "garbage collection"
operation.

The gallivm_state object has to be passed to most of the builder
functions where LLVMBuilderRef used to be used.

Conflicts:
	src/gallium/auxiliary/gallivm/lp_bld_tgsi_soa.c
	src/gallium/drivers/llvmpipe/lp_state_setup.c
2010-11-30 16:35:12 -07:00
Marek Olšák
1f1375d4d8 r300g: fix texture border color once again
I made the texwrap test be more thorough and realized that this driver code
had not been quite right. This commit fixes the border color for depth
textures, compressed textures, and 16-bits-per-channel textures
with up to 2 channels (R16, RG16).

NOTE: This is a candidate for the 7.9 branch.
2010-11-30 23:31:16 +01:00
Kenneth Graunke
2da02e75b1 glsl/linker: Free any IR discarded by optimization passes.
Previously, IR for a linked shader was allocated directly out of the
gl_shader object - meaning all of it lived as long as the shader.

Now, IR is allocated out of a temporary context, and any -live- IR is
reparented/stolen to (effectively) the gl_shader.  Any remaining IR can
be freed.

NOTE: This is a candidate for the 7.9 branch.
2010-11-30 13:48:28 -08:00
Kenneth Graunke
ff994eeff8 glsl: Remove anti-built-in hacks from the print visitor.
Now that we only import built-in signatures that are actually used,
printing them is reasonable.
2010-11-30 13:48:28 -08:00
Kenneth Graunke
f5692f452f glsl: Lazily import built-in function prototypes.
This makes a very simple 1.30 shader go from 196k of memory to 9k.

NOTE: This -may- be a candidate for the 7.9 branch, as the benefit is
substantial.  However, it's not a simple change, so it may be wiser to
wait for 7.10.
2010-11-30 13:48:28 -08:00
Kenneth Graunke
01a25bb64e glsl: Refactor out cloning of function prototypes.
This allows us to reuse some code and will be useful later.
2010-11-30 13:48:28 -08:00
Aras Pranckevicius
4ce084c707 glsl: fix matrix type check in ir_algebraic
Fixes glsl-mat-mul-1.
2010-11-30 13:32:00 -08:00
Eric Anholt
d56c97413e glsl: Quiet unreachable no-return-from-function warning. 2010-11-30 13:29:28 -08:00
Zack Rusin
b22d65e9fc scons: add alias for identity 2010-11-30 16:13:11 -05:00
Eric Anholt
ff79633d9f glsl: Fix structure and array comparisions.
We were trying to emit a single ir_expression to compare the whole
thing.  The backends (ir_to_mesa.cpp and brw_fs.cpp so far) expected
ir_binop_any_nequal or ir_binop_all_equal to apply to at most a vector
(with matrices broken down by the lowering pass).  Break them down to
a bunch of ORed or ANDed any_nequals/all_equals.

Fixes:
glsl-array-compare
glsl-array-compare-02
glsl-fs-struct-equal
glsl-fs-struct-notequal
Bug #31909
2010-11-30 11:42:42 -08:00
Eric Anholt
6b937465d4 glsl: Add a helper constructor for expressions that works out result type.
This doesn't cover all expressions or all operand types, but it will
complain if you overreach and it allows for much greater slack on the
programmer's part.
2010-11-30 11:23:24 -08:00
Keith Whitwell
68a4f63247 llvmpipe: shortcircuit some calls to set_scene_state 2010-11-30 12:01:29 +00:00
Keith Whitwell
d9169364d4 llvmpipe: remove misleading debug string 2010-11-30 12:01:29 +00:00
Keith Whitwell
2d31f048ce llvmpipe: raise dirty flag on transfers to bound constbuf
Need this to trigger the scene to update its shadow of the constant
state.
2010-11-30 12:01:29 +00:00
José Fonseca
31aeac5bf9 wgl: More complete WGL_ARB_pbuffer support. 2010-11-30 10:49:08 +00:00
José Fonseca
c4a43873c5 wgl: Stub WGL_ARB_pbuffer support.
See http://www.opengl.org/registry/specs/ARB/wgl_pbuffer.txt
2010-11-30 10:47:49 +00:00
José Fonseca
af6407a500 scons: Alias for svga 2010-11-30 10:47:26 +00:00
José Fonseca
7bbf675b88 svga: Use consistent hexadecimal representation on debug output. 2010-11-30 10:45:31 +00:00
Marek Olšák
80f24c1575 util: rename u_mempool -> u_slab 2010-11-30 10:12:26 +01:00
Zack Rusin
5572805423 gallivm: fix storing of the addr register
we store into the index specified by the register index, not an
indirect register.
2010-11-30 02:01:43 -05:00
Eric Anholt
001eee52d4 glsl: Make the symbol table's add_variable just use the variable's name. 2010-11-29 17:08:27 -08:00
Eric Anholt
e8f5ebf313 glsl: Make the symbol table's add_function just use the function's name. 2010-11-29 17:08:27 -08:00
Eric Anholt
2927b6c212 i965: Fix type of gl_FragData[] dereference for FB write.
Fixes glsl-fs-fragdata-1, and hopefully Eve Online where I noticed
this bug in the generated shader.  Bug #31952.
2010-11-29 17:08:26 -08:00
Adam Jackson
1ccef926be drivers/x11: unifdef XFree86Server
This code was for the old GLcore build of the software rasteriser.  The
X server switched to a DRI driver for software indirect GLX long ago.

Signed-off-by: Adam Jackson <ajax@redhat.com>
2010-11-29 17:37:54 -05:00
Marek Olšák
e5aa69f6a6 st/mesa: fix texture border color for RED and RG base formats
The spec says the border color should be consistent with the internal
format.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-11-29 17:26:40 +01:00
pontus lidman
b1097607db mesa: check for posix_memalign() errors
Signed-off-by: Brian Paul <brianp@vmware.com>
2010-11-29 09:20:41 -07:00
Dave Airlie
a7cb673aa1 r600g: it looks like r600 can handle dword offsets in the indices.
Tested with piglit + ut2004 still seems to render okay (and it
definitely does this)
2010-11-29 11:38:24 +10:00
Marek Olšák
5d4d8b6205 u_blitter: interpolate clear color using a GENERIC varying instead of COLOR
There are also some u_simple_shaders changes.

On r300, the TGSI_SEMANTIC_COLOR varying is a fixed-point number clamped
to the range [0,1] and limited to 12 bits of precision. Therefore we can't
use it for passing through a clear color in order to clear high precision
texture formats.

This also makes u_blitter use only one vertex shader instead of two.
2010-11-28 17:45:39 +01:00
Henri Verbeet
c6ea4c0e8a r600g: Fix the PIPE_FORMAT_A8_UNORM color swap for Evergreen as well. 2010-11-27 17:40:47 +01:00
Henri Verbeet
7a4599c6f5 r600g: Fix the PIPE_FORMAT_L8A8_UNORM color swaps. 2010-11-27 17:40:47 +01:00
Mathias Fröhlich
c3602ff5ed st/mesa: Set PIPE_TRANSFER_DISCARD for GL_MAP_INVALIDATE_RANGE/BUFFFER_BIT
Signed-off-by: Brian Paul <brianp@vmware.com>

Note: this is a candidate for the 7.9 branch.
2010-11-26 14:03:42 -07:00
Brian Paul
97ae4dad1c st/mesa: fix mapping of zero-sized buffer objects
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=31934
2010-11-26 13:48:49 -07:00
Thomas Hellstrom
5822484510 xorg/vmwgfx: Don't clip video to viewport
Since the viewport is not updated on RandR12 mode switches anymore,
clipping to viewport may incorrectly clip away the video.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-11-26 10:28:01 +01:00
Thomas Hellstrom
28ee7561f9 xorg/vmwgfx: Flush even if we don't autopaint the color key
This may help paint the colorkey before overlay updates in some
situations where the app paints the color key (mainly xine).

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-11-26 10:27:54 +01:00
Marek Olšák
e6e6fcd3a6 r300/compiler: move util functions to radeon_compiler_util
The compiler seriously needs a cleanup as far as the arrangement of functions
is concerned. It's hard to know whether some function was implemented or not
because there are so many places to search in and it can be anywhere and
named anyhow.
2010-11-26 02:23:13 +01:00
Marek Olšák
ea2f56b490 r300/compiler: add a function for swizzling a mask 2010-11-26 02:23:13 +01:00
Marek Olšák
7c29446232 r300/compiler: remove duplicate function rc_mask_to_swz 2010-11-26 02:23:13 +01:00
Marek Olšák
ae3e58d973 r300/compiler: fix rc_rewrite_depth_out for it to work with any instruction
It looks like the function was originally written for ARB_fragment_program.

NOTE: This is a candidate for the 7.9 branch.
2010-11-26 02:22:59 +01:00
Marek Olšák
2c1de07ddf u_blitter: use PIPE_TRANSFER_DISCARD to prevent cpu/gpu stall
But the driver must be smart here and follow PIPE_TRANSFER_DISCARD,
as it should.
2010-11-25 20:25:53 +01:00
Xavier Chantry
c14a261eb9 nvfx: reset nvfx->hw_zeta
If nvfx_framebuffer prepare and validate were called successively with
fb->zsbuf not NULL and then NULL, nvfx->hw_zeta would contain garbage and
this would cause failures in nvfx_framebuffer_relocate/OUT_RELOC(hw_zeta).

This was triggered by piglit/texwrap 2D GL_DEPTH_COMPONENT24 and caused
first a 'write to user buffer!!' error in libdrm and then worse things.

Signed-off-by: Xavier Chantry <chantry.xavier@gmail.com>
Signed-off-by: Francisco Jerez <currojerez@riseup.net>
2010-11-25 17:04:29 +01:00
Xavier Chantry
049065cdfa nvfx: fb->nr_cbufs <= 1 on nv30
7e1bf94631 changed
PIPE_CAP_MAX_RENDER_TARGETS to 1 on nv30.

Signed-off-by: Xavier Chantry <chantry.xavier@gmail.com>
Signed-off-by: Francisco Jerez <currojerez@riseup.net>
2010-11-25 17:04:02 +01:00
Kenneth Graunke
1eb7a81f2e glsl: Add a virtual as_discard() method.
NOTE: This is candidate for the 7.9 branch.
2010-11-25 03:26:55 -08:00
Kenneth Graunke
a82592de92 glsl: Use do_common_optimization in the standalone compiler.
NOTE: This is a candidate for the 7.9 branch.
2010-11-25 01:21:05 -08:00
Kenneth Graunke
e8a24c65bc glsl: Don't inline function prototypes.
Currently, the standalone compiler tries to do function inlining before
linking shaders (including linking against the built-in functions).
This resulted in the built-in function _prototypes_ being inlined rather
than the actual function definition.

This is only known to fix a bug in the standalone compiler; most
programs should be unaffected.  Still, it seems like a good idea.

NOTE: This is a candidate for the 7.9 branch.
2010-11-25 01:19:53 -08:00
Vinson Lee
2cc79acc1a r300/compiler: Move declaration before code.
Fixes this GCC warning with linux-x86 build.
radeon_pair_regalloc.c: In function ‘compute_live_intervals’:
radeon_pair_regalloc.c:222: warning: ISO C90 forbids mixed declarations and code
2010-11-24 23:03:26 -08:00
Vinson Lee
995de71550 r300/compiler: Move declaration before code.
Fixes this GCC warning with linux-x86 build.
radeon_pair_regalloc.c: In function ‘compute_live_intervals’:
radeon_pair_regalloc.c:221: warning: ISO C90 forbids mixed declarations and code
2010-11-24 23:00:03 -08:00
Chia-I Wu
ba1128db45 st/vega: Fix a typo in EXTENDED_BLENDER_OVER_FUNC.
The typo was introduced by commit
231d5457b2.
2010-11-25 13:34:24 +08:00
Chia-I Wu
c9fb8c3bcf st/vega: No flipping in vg_prepare_blend_surface.
The blend sampler view is addressed with unnormalized coordinates in the
fragment shader.  It should have the same orientation as the surface
does.
2010-11-25 13:33:59 +08:00
Chia-I Wu
37ec090ac9 st/vega: Masks and surfaces should share orientation.
The alpha mask is addressed with unnormalized coordinates in the
fragment shader.  It should have the same orientation as the surface
does.

This fixes "mask" OpenVG demo.
2010-11-25 13:33:59 +08:00
Chia-I Wu
9ea4936a36 st/vega: Fix a crash with empty paths. 2010-11-25 13:32:03 +08:00
Chia-I Wu
3965051dff auxiliary: util_blit_pixels_tex should restore the viewport.
Viewport state should be saved/restored.
2010-11-25 13:32:03 +08:00
Dave Airlie
3b5a3fd8d1 r300g/r600g: bump cache manager timeouts to 1s
On lightsmark on my r500 this drop the bufmgr allocations of the sysprof.
2010-11-25 09:18:19 +10:00
Kenneth Graunke
1197393faa mesa: Fix glGet of ES2's GL_MAX_*_VECTORS properties.
Previously, the get table listed all three as having custom locations,
yet find_custom_value did not have cases to handle them.

MAX_VARYING_VECTORS does not need a custom location since MaxVaryings is
already stored as float[4] (or vec4).  MaxUniformComponents is stored as
the number of floats, however, so a custom implementation that divides
by 4 is necessary.

Fixes bugs.freedesktop.org #31495.
2010-11-24 14:09:32 -08:00
Peter Clifton
ee88727df8 meta: Mask Stencil.Clear against stencilMax in _mesa_meta_Clear
This fixes incorrect behaviour when the stencil clear value exceeds
the size of the stencil buffer, for example, when set with:

glClearStencil (~1); /* Set a bit pattern of 111...11111110 */
glClear (GL_STENCIL_BUFFER_BIT);

The clear value needs to be masked by the value 2^m - 1, where m is the
number of bits in the stencil buffer. Previously, we passed the value
masked with 0x7fffffff to _mesa_StencilFuncSeparate which then clamps,
NOT masks the value to the range 0 to 2^m - 1.

The result would be clearing the stencil buffer to 0xff, rather than 0xfe.

Signed-off-by: Peter Clifton <pcjc2@cam.ac.uk>
Signed-off-by: Brian Paul <brianp@vmware.com>
2010-11-24 12:14:54 -07:00
Brian Paul
03a4f97a68 x11: remove test_proxy_teximage() function
This was really just for testing purposes.
2010-11-24 12:11:23 -07:00
Brian Paul
74c324fdba mesa: added _mesa_format_image_size64() 2010-11-24 12:11:23 -07:00
Brian Paul
7bfbd88d2c mesa: add assertion and update comment in _mesa_format_image_size() 2010-11-24 12:11:23 -07:00
Kristian Høgsberg
a889f9ee5c i965: Don't write mrf assignment for pointsize output
https://bugs.freedesktop.org/show_bug.cgi?id=31894
2010-11-24 11:27:43 -05:00
Thomas Hellstrom
f20a219e9e gallium/targets/xorg-vmwgfx: Xv fixes
Make sure regions are properly updated and that the colorkey painting is
flushed before we update the HW overlay.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-11-24 15:23:10 +01:00
Thomas Hellstrom
0b1c0460a0 st/xorg: Add a function to flush pending rendering and damage
This is needed to properly sync with host side rendering. For example,
make sure we flush colorkey painting before updating the overlay.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-11-24 15:23:10 +01:00
Chia-I Wu
1f4c55128b egl_dri2: Fix one context, multiple surfaces.
When a context was made current to another surface, the old code did
this

  dri2_dpy->core->bindContext(cctx, ddraw, rdraw);
  dri2_dpy->core->unbindContext(old_cctx);

and there will be no current context due to the second line.

unbindContext should be called only when bindContext is not.  This fixes
a regression since d19afc57.  Thanks to Neil Roberts for noticing the
issue and creating a test case.
2010-11-24 14:06:30 +08:00
Ian Romanick
78a340fd48 i915: Disallow alpha, red, RG, and sRGB as render targets
Fixes bugzilla #31832

NOTE: This is a candidate for the 7.9 branch.
2010-11-23 18:42:04 -08:00
Brian Paul
903ead0b26 glsl: start restoring some geometry shader code 2010-11-23 17:23:42 -07:00
Brian Paul
6162773ea4 glsl: better handling of linker failures
Upon link error, exit translation loop, free program instructions.
Check for null pointers in calling code.
2010-11-23 17:18:48 -07:00
Brian Paul
2900e56f9d mesa: use gl_shader_type enum 2010-11-23 17:00:08 -07:00
Brian Paul
c628fd743e mesa: replace #defines with new gl_shader_type enum 2010-11-23 15:52:43 -07:00
Brian Paul
512f840702 mesa: _mesa_valid_register_index() to validate register indexes 2010-11-23 15:52:43 -07:00
Brian Paul
b8dacaf174 mesa: rename, make _mesa_register_file_name() non-static
Plus remove unused parameter.
2010-11-23 15:52:42 -07:00
Brian Paul
caf974c525 glsl: use gl_register_file in a few places 2010-11-23 15:52:42 -07:00
Brian Paul
50fd99d172 glsl: fix off by one in register index assertion 2010-11-23 15:52:42 -07:00
Alex Deucher
ed8b5fb24e gallium/egl: fix r300 vs r600 loading
Should fix:
https://bugs.freedesktop.org/show_bug.cgi?id=31841
2010-11-23 15:18:31 -05:00
Eric Anholt
df24450bac i965: Use the new embedded compare in SEL on gen6 for VS MIN and MAX opcodes.
Cuts the extra CMP instruction that used to precede SEL.
2010-11-23 09:23:30 -08:00
Eric Anholt
8a7cf99457 i965: Don't upload line smooth params unless we're line smoothing. 2010-11-23 09:23:30 -08:00
Eric Anholt
008fd3779b i965: Don't upload line stipple pattern unless we're stippling. 2010-11-23 09:23:30 -08:00
Eric Anholt
e29e3c32d9 i965: Don't upload polygon stipple unless required. 2010-11-23 09:23:30 -08:00
Eric Anholt
7720bfffa3 i965: Move gen4 blend constant color to the gen4 blending file. 2010-11-23 09:23:29 -08:00
Tilman Sauerbeck
3688301c59 r600g: Removed duplicated call to tgsi_split_literal_constant().
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-11-23 09:20:54 +01:00
Tom Stellard
4265c2f819 r300/compiler: Don't allow presubtract sources to be remapped twice
https://bugs.freedesktop.org/show_bug.cgi?id=31193

NOTE: This is a candidate for the 7.9 branch.
2010-11-23 00:02:03 -08:00
Mathias Fröhlich
07e0424a17 r600g: Only compare active vertex elements
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-11-23 08:39:43 +01:00
Vinson Lee
f44d96e1af mesa: Clean up header file inclusion in syncobj.h. 2010-11-22 21:51:49 -08:00
Vinson Lee
37195b7f70 llvmpipe: Remove unnecessary headers. 2010-11-22 21:39:14 -08:00
Xiang, Haihao
93102b4cd8 mesa: fix regression from b4bb668020
Pending commands to the previous context aren't flushed since commit b4bb668

Reported-by: Oleksiy Krivoshey <oleksiyk@gmail.com>
Signed-off-by: Xiang, Haihao <haihao.xiang@intel.com>
2010-11-23 08:59:44 +08:00
Alex Deucher
cb7a36b651 r600c: fix VC flush on cedar and palm 2010-11-22 19:27:58 -05:00
Alex Deucher
0e4c5f63b9 r600g: add support for ontario APUs
Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2010-11-22 18:01:26 -05:00
Alex Deucher
072f2cbf29 r600c: add Ontario Fusion APU support
Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2010-11-22 18:01:25 -05:00
Mathias Fröhlich
8d1ad3b21c r300g: Avoid returning values in a static array, fixing a potential race
(Marek: added the initializion of "vec" in the default statement)

NOTE: This is a candidate for the 7.9 branch.

Signed-off-by: Marek Olšák <maraeo@gmail.com>
2010-11-22 23:56:41 +01:00
Alex Deucher
271b7b5914 r600g: fix some winsys functions to deal properly with evergreen
Are these functions actually used anywhere?
2010-11-22 17:39:54 -05:00
Alex Deucher
bf9c80976f r600g: fix additional EVENT_WRITE packet
Add explicit EVENT_TYPE field
2010-11-22 17:39:16 -05:00
Marek Olšák
e7c74a7dfa st/mesa: set MaxUniformComponents
Signed-off-by: Brian Paul <brianp@vmware.com>
2010-11-22 21:44:35 +01:00
Brian Paul
6a0255122a swrast: init alpha value to 1.0 in opt_sample_rgb_2d() 2010-11-22 09:04:13 -07:00
Marek Olšák
9aa089eac0 gallium: add PIPE_SHADER_CAP_SUBROUTINES
This fixes piglit/glsl-vs-main-return and glsl-fs-main-return for the drivers
which don't support RET (i915g, r300g, r600g, svga).

ir_to_mesa does not currently generate subroutines, but it's a matter of time
till it's added. It would then break all the drivers which don't implement
them, so this CAP makes sense.

Signed-off-by: Marek Olšák <maraeo@gmail.com>
2010-11-22 12:41:22 +01:00
Keith Whitwell
b2ddb93ff3 Merge branch 'lp-offset-twoside' 2010-11-22 10:36:01 +00:00
Dave Airlie
d5aadf0d80 r600g: pick correct color swap for A8 fbos.
This fixes fdo bug 31810.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-11-22 16:05:44 +10:00
Tom Stellard
1b6ed80972 r300/compiler: Add a more efficient version of rc_find_free_temporary() 2010-11-21 18:48:31 -08:00
Tom Stellard
8833f53e65 r300/compiler: Enable rename_reg pass for r500 cards
In addition, the rename_reg pass has been rewritten to use
rc_get_readers().
2010-11-21 18:48:31 -08:00
Tom Stellard
bbe49bc585 r300/compiler: Use presubtract operations as much as possible
Previously, presubtract operations where only being used by instructions
with less than three source source registers.
2010-11-21 18:48:31 -08:00
Tom Stellard
ddceededf8 r300/compiler: Convert RGB to alpha in the scheduler 2010-11-21 18:48:31 -08:00
Tom Stellard
681f56af80 r300/compiler: Track readers through branches in rc_get_readers() 2010-11-21 18:48:31 -08:00
Tom Stellard
255860113f r300/compiler: Handle BREAK and CONTINUE in rc_get_readers() 2010-11-21 18:48:31 -08:00
Tom Stellard
96f9580160 r300/compiler: Add rc_get_readers() 2010-11-21 18:48:31 -08:00
Tom Stellard
23f577dbd4 r300/compiler: Ignore alpha dest register when replicating the result
When the result of the alpha instruction is being replicated to the RGB
destination register, we do not need to use alpha's destination register.
This fixes an invalid "Too many hardware temporaries used" error in
the case where a transcendent operation writes to a temporary register
greater than max_temp_regs.

NOTE: This is a candidate for the 7.9 branch.
2010-11-21 18:48:31 -08:00
Tom Stellard
d668659003 r300/compiler: Use zero as the register index for unused sources
This fixes an invalid "Too many hardware temporaries used" error in the
case where a source reads from a temporary register with an index greater
than max_temp_regs and then the source is marked as unused before the
register allocation pass.

NOTE: This is a candidate for the 7.9 branch.
2010-11-21 18:48:31 -08:00
Tom Stellard
3e5f9789d6 r300/compiler: Fix instruction scheduling within IF blocks
Reads of registers that where not written to within the same block were
not being tracked.  So in a situations like this:
0: IF
1: ADD t0, t1, t2
2: MOV t2, t1

Instruction 2 didn't know that instruction 1 read from t2, so
in some cases instruction 2 was being scheduled before instruction 1.

NOTE: This is a candidate for the 7.9 branch.
2010-11-21 18:48:31 -08:00
Tom Stellard
e2301b45c2 r300/compiler: Fix register allocator's handling of loops
NOTE: This is a candidate for the 7.9 branch.
2010-11-21 18:48:31 -08:00
Tom Stellard
412803b5cd r300/compiler: Make sure presubtract sources use supported swizzles
NOTE: This is a candidate for the 7.9 branch.
2010-11-21 18:48:31 -08:00
Vinson Lee
9d08902457 r600: Remove unnecessary header. 2010-11-21 15:03:27 -08:00
Marek Olšák
2892c8bdbc docs: add GL 4.1 status 2010-11-21 23:03:58 +01:00
Marek Olšák
e40a58b7f8 st/mesa: enable ARB_explicit_attrib_location and EXT_separate_shader_objects
Gallium drivers pass all piglit tests for the two (there are 12 tests
for separate_shader_objects and 5 tests for explicit_attrib_location),
and I was told the extensions don't need any driver-specific code.

I made them dependent on PIPE_CAP_GLSL.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-11-21 19:33:45 +01:00
Brian Paul
5e3733fadf mesa: fix get_texture_dimensions() for texture array targets
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=31779
2010-11-21 10:05:51 -07:00
Brian Paul
0ec0f1025d docs: update some GL 3.0 status 2010-11-21 09:40:28 -07:00
Brian Paul
5ed51e950f mesa: hook up GL 3.x entrypoints
Fix up some details in the xml files and regenerate dispatch files.
2010-11-21 09:20:44 -07:00
Brian Paul
81c347ef79 glapi: rename GL3.xml to GL3x.xml as it covers all GL 3.x versions 2010-11-21 09:20:43 -07:00
Brian Paul
197b1d7898 mesa: fix error msg typo 2010-11-21 09:20:43 -07:00
Daniel Vetter
c8fca58d9d i915g: kill idws->pool
The drm winsys only ever handles one gem memory manager. Rip out
the unnecessary complication.

Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-11-21 16:41:19 +01:00
Daniel Vetter
e182618853 i915g: kill buf->map_gtt
Not using the gtt is considered harmful for performance. And for
partial uploads there's always drm_intel_bo_subdata.

Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-11-21 16:41:19 +01:00
Daniel Vetter
d54d67499c i915g: kill RGBA/X formats
It's intel, so always little endian!

Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-11-21 16:41:19 +01:00
Daniel Vetter
8624fe7a49 i915g: add pineview pci ids
Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-11-21 16:41:19 +01:00
Daniel Vetter
aba728eb25 i915g: s/hw_tiled/tiling
More in line with other intel drivers.

Change to use enum by Jakob Bornecrantz.

Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-11-21 16:41:18 +01:00
Daniel Vetter
f77a2690b4 i915g: rip out ->sw_tiled
It looks like this was meant to facilitate unfenced access to textures/
color/renderbuffers. It's totally incomplete and fundamentally broken
on a few levels:
- broken: The kernel needs to about every tiled bo to fix up bit17
  swizzling on swap-in.
- unflexible: fenced/unfenced relocs from execbuffer2 do the same, much
  simpler.
- unneeded: with relaxed fencing tiled gem bos are as memory-efficient
  as this trick.

Hence kill it.

Reviewed-by: Jakob Bornecrantz <wallbraker@gmail.com>
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Signed-off-by: Jakob Bornecrantz <wallbraker@gmail.com>
2010-11-21 16:41:18 +01:00
Joakim Sindholt
bf10055cff r300g: silence guard band cap errors
Somebody should find out what these are. It can be found on Windows
getting a D3DCAPS9 from IDirect3D9::GetCaps() and reading the
GuardBand* values.
2010-11-21 15:45:20 +01:00
Chia-I Wu
b8f6cb3809 st/vega: Fix vgReadPixels with a subrectangle.
Fix a crash when the subrectangle is not inside the fb.  Fix wrong
pipe transfer when sx > 0 or sy + height != fb->height.

This fixes "readpixels" demo.
2010-11-21 19:32:22 +08:00
Chia-I Wu
e8bbaff22e st/vega: Set wrap_r for mask and blend samplers.
These two samplers use non-normalized texture coordinates.  wrap_r
cannot be PIPE_TEX_WRAP_REPEAT (the default).

This fixes

  sp_tex_sample.c:1790:get_linear_unorm_wrap: Assertion `0' failed

assertion failure.
2010-11-21 19:32:10 +08:00
Chia-I Wu
daa265e53c st/vega: vegaLookupSingle should validate the state.
Fix "lookup" demo crash.
2010-11-21 19:26:33 +08:00
Chia-I Wu
f90524a01b tgsi: Add STENCIL to text parser.
Fix OpenVG "filter" demo

  Program received signal SIGSEGV, Segmentation fault.
  0xb7153dc9 in str_match_no_case (pcur=0xbfffe564, str=0x0) at
  tgsi/tgsi_text.c:86
  86         while (*str != '\0' && *str == uprcase( *cur )) {
2010-11-21 19:26:29 +08:00
Vinson Lee
8bea7776a3 mesa: Clean up header file inclusion in stencil.h. 2010-11-20 22:44:33 -08:00
Vinson Lee
9732a93f40 mesa: Clean up header file inclusion in shared.h. 2010-11-20 22:30:27 -08:00
Vinson Lee
20f041952c mesa: Clean up header file inclusion in shaderapi.h. 2010-11-20 22:17:28 -08:00
Vinson Lee
baa0471597 mesa: Clean up header file inclusion in scissor.h. 2010-11-20 22:01:30 -08:00
Vinson Lee
27e96655c7 mesa: Clean up header file inclusion in renderbuffer.h. 2010-11-20 21:32:07 -08:00
Vinson Lee
b6215d18b5 mesa: Clean up header file inclusion in readpix.h. 2010-11-20 21:23:35 -08:00
Vinson Lee
bab188d22f mesa: Clean up header file inclusion in rastpos.h. 2010-11-20 21:14:06 -08:00
Vinson Lee
9b66305b8d mesa: Clean up header file inclusion in polygon.h. 2010-11-20 21:06:09 -08:00
Vinson Lee
f5cbe04b69 intel: Remove unnecessary header. 2010-11-20 20:13:50 -08:00
Vinson Lee
84f5229119 r600: Remove unnecesary header. 2010-11-20 19:04:30 -08:00
Vinson Lee
b59f3dd8ca swrast: Remove unnecessary header. 2010-11-20 19:00:18 -08:00
Vinson Lee
1310806872 st/mesa: Remove unnecessary headers. 2010-11-20 18:48:09 -08:00
Chia-I Wu
bb045d339b scons: Define IN_DRI_DRIVER.
The define is required for DRI drivers.  It is not needed for
libgl-xlib, but the overhead it introduces should be minor.
2010-11-20 17:47:11 -08:00
Xavier Chantry
7e1bf94631 nvfx: only expose one rt on nv30
We do not know how to use more, GL_ARB_draw_buffers is not exposed on blob.
2010-11-20 23:29:12 +01:00
Owen W. Taylor
c63a86e1e5 r600g: Fix location for clip plane registers
The stride between the different clip plane registers was incorrect.

https://bugs.freedesktop.org/show_bug.cgi?id=31788

agd5f: fix evergreen as well.
2010-11-20 12:18:56 -05:00
Marek Olšák
ffb732d8bd r300g: fix rendering with no vertex elements
Fixes glsl-vs-point-size, although I meant to fix glsl-novertexdata.
Since swrast fails glsl-novertexdata too, I guess it's a core issue.
2010-11-20 16:20:48 +01:00
Eric Anholt
b6b91fa029 i965: Remove duplicate MRF writes in the FS backend.
This is quite common for multitexture sampling, and not only cuts down
on the second and later set of MOVs, but typically also allows
compute-to-MRF on the first set.

No statistically siginficant performance difference in nexuiz (n=3),
but it reduces instruction count in one of its shaders and seems like
a good idea.
2010-11-19 20:05:56 -08:00
Eric Anholt
47b1aac1cf i965: Improve compute-to-mrf.
We were skipping it if the instruction producing the value we were
going to compute-to-mrf used its result reg as a source reg.  This
meant that the typical "write interpolated color to fragment color" or
"texture from interpolated texcoord" shader didn't compute-to-MRF.
Just don't check for the interference cases until after we've checked
if this is the instruction we wanted to compute-to-MRF.

Improves nexuiz high-settings performance on my laptop 0.48% +- 0.08%
(n=3).
2010-11-19 19:54:11 -08:00
Eric Anholt
ac89a90401 ir_to_mesa: Detect and emit MOV_SATs for saturate constructs.
The goal here is to avoid regressing performance on ir_to_mesa drivers
for fixed function fragment shaders requiring saturates.
2010-11-19 19:09:32 -08:00
Eric Anholt
19631fab35 i965: Recognize saturates and turn them into a saturated mov.
On pre-gen6, this turns 4 instructions into 1.  We could still do
better by folding the saturate into the instruction generating the
value if nobody else uses it, but that should be a separate pass.
2010-11-19 19:09:31 -08:00
Eric Anholt
02939d643f glsl: Add a helper function for determining if an rvalue could be a saturate.
Hardware pretty commonly has saturate modifiers on instructions, and
this can be used in codegen to produce those, without everyone else
needing to understand clamping other than min and max.
2010-11-19 19:09:18 -08:00
Eric Anholt
602ae2441a i965: Fold constants into the second arg of BRW_SEL as well.
This hits a common case with min/max operations.
2010-11-19 17:42:07 -08:00
Eric Anholt
f9b420d3bd i965: Remove extra \n at the end of every instruction in INTEL_DEBUG=wm. 2010-11-19 17:42:07 -08:00
Eric Anholt
5944cda6ed i965: Just use memset() to clear most members in FS constructors.
This should make it a lot harder to forget to zero things.
2010-11-19 17:42:07 -08:00
Eric Anholt
61126278a3 i965: Fix compute_to_mrf to not move a MRF write up into another live range.
Fixes glsl-fs-copy-propagation-texcoords-1.
2010-11-19 17:42:06 -08:00
Eric Anholt
6b1d7dd781 mesa: Include C++ files in the makedepend of DRI drivers. 2010-11-19 17:42:06 -08:00
Vinson Lee
a172368ef1 glsl: Fix type of label 'default' in switch statement. 2010-11-19 17:28:22 -08:00
Vinson Lee
7aebe181f3 glsl: Add lower_vector.cpp to SConscript. 2010-11-19 17:23:07 -08:00
Ian Romanick
bb756bb0a6 glsl: Fix matrix constructors with vector parameters
When the semantics of write masks in assignments were changed, this
code was not correctly updated.

Fixes piglit test glsl-mat-from-vec-ctor-01.
2010-11-19 17:17:25 -08:00
Kenneth Graunke
63684a9ae7 glsl: Combine many instruction lowering passes into one.
This should save on the overhead of tree-walking and provide a
convenient place to add more instruction lowering in the future.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2010-11-19 15:56:28 -08:00
Kenneth Graunke
b943fb94bf glsl: Simplify a type check by using type->is_integer(). 2010-11-19 15:06:58 -08:00
Ian Romanick
11d6f1c698 glsl: Add ir_quadop_vector expression
The vector operator collects 2, 3, or 4 scalar components into a
vector.  Doing this has several advantages.  First, it will make
ud-chain tracking for components of vectors much easier.  Second, a
later optimization pass could collect scalars into vectors to allow
generation of SWZ instructions (or similar as operands to other
instructions on R200 and i915).  It also enables an easy way to
generate IR for SWZ instructions in the ARB_vertex_program assembler.
2010-11-19 15:00:26 -08:00
Ian Romanick
13f57d42b6 glsl: Add unary ir_expression constructor 2010-11-19 15:00:25 -08:00
Ian Romanick
8e498050dc glsl: Add ir_rvalue::is_negative_one predicate 2010-11-19 15:00:25 -08:00
Ian Romanick
fc92e87b97 glsl: Eliminate assumptions about size of ir_expression::operands
This may grow in the near future.
2010-11-19 15:00:25 -08:00
Ian Romanick
f2616e56de glsl: Add ir_unop_sin_reduced and ir_unop_cos_reduced
The operate just like ir_unop_sin and ir_unop_cos except that they
expect their inputs to be limited to the range [-pi, pi].  Several
GPUs require this limited range for their sine and cosine
instructions, so having these as operations (along with a to-be-written
lowering pass) helps this architectures.

These new operations also matche the semantics of the
GL_ARB_fragment_program SCS instruction.  Having these as operations
helps in generating GLSL IR directly from assembly fragment programs.
2010-11-19 15:00:25 -08:00
Alex Deucher
04ffbe1ac6 r600g: use full range of VS resources for vertex samplers
Now that we have fetch shaders, the full range of VS resources
can be used for sampling.
2010-11-19 15:51:24 -05:00
Alex Deucher
4afd068385 r600g: use meaningful defines for chiprev
Makes the code much clearer.
2010-11-19 15:32:02 -05:00
Alex Deucher
52c66120d8 r600g: translate ARR instruction for evergreen
evergreen variant of:
9f7ec103e2
2010-11-19 15:20:59 -05:00
Jerome Glisse
f609b2ab03 r600g: add fetch shader capabilities
Use fetch shader instead of having fetch instruction in the vertex
shader. Allow to restrict shader update to a smaller part when
vertex buffer input layout changes.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-11-19 13:40:55 -05:00
Alex Deucher
3e76ed4e25 r600g: All EVENT_WRITE packets need the EVENT_INDEX field
6xx-evergreen
2010-11-19 13:35:53 -05:00
Viktor Novotný
af17d89966 dri/nouveau: Clean up magic numbers in get_rt_format
Signed-off-by: Viktor Novotný <noviktor@seznam.cz>
Signed-off-by: Francisco Jerez <currojerez@riseup.net>
2010-11-19 19:04:50 +01:00
Jerome Glisse
fab804bdfe r600g: fix occlusion query on evergreen (avoid lockup)
Occlusion query on evergreen need the event index field to be
set otherwise we endup locking up the GPU.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-11-19 11:53:01 -05:00
Keith Whitwell
546c5ffa11 llvmpipe: twoside for specular color also 2010-11-19 16:17:36 +00:00
Keith Whitwell
081ce2680e llvmpipe: fix up twoside after recent changes
Fix my slot/attr confusion.
2010-11-19 16:16:30 +00:00
Hui Qi Tay
d4b5cf6c05 llvmpipe: fix such that offset/twoside function only does in-place modification 2010-11-19 15:12:19 +00:00
Ian Romanick
c05ccc1ebd ir_to_mesa: Generate smarter code for some conditional moves
Condiation moves with a condition of (a < 0), (a > 0), (a <= 0), or (a
>= 0) can be generated with "a" directly as an operand of the CMP
instruction.  This doesn't help much now, but it will help with
assembly shaders that use the CMP instruction.
2010-11-18 18:19:45 -08:00
Ian Romanick
ad87f2ddc7 glsl: Make is_zero and is_one virtual methods of ir_rvalue
This eliminates the need in some cames to validate that an rvalue is
an ir_constant before checking to see if it's 0 or 1.
2010-11-18 18:19:45 -08:00
Brian Paul
83e93b6008 mesa: pass gl_format to _mesa_init_teximage_fields()
This should prevent the field going unset in the future.  See bug
http://bugs.freedesktop.org/show_bug.cgi?id=31544 for background.

Also remove unneeded calls to clear_teximage_fields().

Finally, call _mesa_set_fetch_functions() from the
_mesa_init_teximage_fields() function so callers have one less
thing to worry about.
2010-11-18 16:15:38 -07:00
José Fonseca
3dcc3153b0 scons: Use inline wrap helpers more consistently. 2010-11-18 13:02:36 +00:00
Dave Airlie
185d862cd8 gallium/noop: report GL 2.1
this should at least make app use the same paths as they would for a real
driver.
2010-11-18 18:11:27 +10:00
Vinson Lee
855c66bde7 glsl: Fix 'control reaches end of non-void function' warning.
Fix this GCC warning.
ir.cpp: In static member function
'static unsigned int ir_expression::get_num_operands(ir_expression_operation)':
ir.cpp:199: warning: control reaches end of non-void function
2010-11-17 22:43:52 -08:00
Chia-I Wu
ca9f99d9c5 mesa: Clean up core.h.
Remove version.h and context.h from core.h.
2010-11-18 11:56:01 +08:00
Chia-I Wu
997a2547d1 st/glx: Replace MESA_VERSION_STRING by xmesa_get_name.
xmesa_get_name returns the name of the st_api, which is the same as
MESA_VERSION_STRING.
2010-11-18 11:56:01 +08:00
Chia-I Wu
db1689c236 st/wgl: Use st_context_iface::share for DrvShareLists. 2010-11-18 11:56:01 +08:00
Chia-I Wu
4f38dcd974 gallium: Add st_context_iface::share to st_api.
It will be used to implement wglShareLists.  Fill st_context_iface::copy
for glXCopyContext as well.
2010-11-18 11:56:00 +08:00
Chia-I Wu
28105471af gallium: Add st_api::name.
It is the name of the rendering API.  This field is informative.
2010-11-18 11:56:00 +08:00
Chia-I Wu
cc5c908d7d st/vega: Do not wait NULL fences. 2010-11-18 11:56:00 +08:00
Eric Anholt
50b4508319 i965: Eliminate dead code more aggressively.
If an instruction writes reg but nothing later uses it, then we don't
need to bother doing it.  Before, we were just killing code that was
never read after it was ever written.

This removes many interpolation instructions for attributes with only
a few comopnents used.  Improves nexuiz high-settings performance .46%
+/- .12% (n=3) on my Ironlake.
2010-11-18 11:16:14 +08:00
Brian Paul
48af60b465 mesa: upgrade to glext.h version 66
The type of the num/count parameter to glProgramParameters4[df]vNV()
changed so some API dispatch code needed updates too.
2010-11-17 20:04:45 -07:00
Alex Deucher
a23f25eba1 r600g: fix buffer alignment
This should fix the remaining buffer alignment issues in r600g.
2010-11-17 21:33:40 -05:00
Eric Anholt
da35388044 i965: Fail on loops on gen6 for now until we write the EU emit code for it. 2010-11-18 09:18:47 +08:00
Eric Anholt
3c8db58a17 i965: Add dumping of the sampler default color. 2010-11-18 09:18:47 +08:00
Eric Anholt
95addca019 i965: Add state dumping for sampler state. 2010-11-18 09:18:47 +08:00
Eric Anholt
03ff02d08b mesa: Don't spam the console in a debug build unless some spam is requested.
It's annoying to use test suites under a Mesa debug build because
pretty output is cluttered with stderr's continuous reports that
you're still using the debug driver.
2010-11-18 09:18:47 +08:00
Eric Anholt
d512cbf58f i965: Shut up spurious gcc warning about GLSL_TYPE enums. 2010-11-18 09:18:47 +08:00
Jakob Bornecrantz
e89e8a4347 gallium: Remove redundant sw and debug target helpers 2010-11-17 23:49:09 +00:00
Jakob Bornecrantz
b46340c740 graw: Use inline debug helper instead of non-inline version 2010-11-17 23:49:09 +00:00
Jakob Bornecrantz
c30656d8c2 libgl-xlib: Use inline debug helper instead of non-inline version 2010-11-17 23:49:08 +00:00
Chad Versace
7819435f2e glsl: Improve usage message for glsl_compiler
The new usage message lists possible command line options. (Newcomers to Mesa
currently have to trawl through the source to find the command line options,
and we should save them from that trouble.)

Example Output
--------------
usage: ./glsl_compiler [options] <file.vert | file.geom | file.frag>

Possible options are:
    --glsl-es
    --dump-ast
    --dump-hir
    --dump-lir
    --link
2010-11-17 15:44:41 -08:00
Kenneth Graunke
007f488150 glsl: Refactor get_num_operands.
This adds sentinel values to the ir_expression_operation enum type:
ir_last_unop, ir_last_binop, and ir_last_opcode.  They are set to the
previous one so they don't trigger "unhandled case in switch statement"
warnings, but should never be handled directly.

This allows us to remove the huge array of 1s and 2s in
ir_expression::get_num_operands().
2010-11-17 15:44:41 -08:00
Jerome Glisse
7ffd4e976f r600g: code cleanup (indent, trailing space, empty line ...)
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-11-17 17:22:08 -05:00
Kenneth Graunke
9935fe705d glsl: Remove the ir_binop_cross opcode. 2010-11-17 13:59:17 -08:00
Kenneth Graunke
af1cba2260 Refresh autogenerated file builtin_function.cpp. 2010-11-17 13:37:16 -08:00
Kenneth Graunke
671ccf593e glsl: Reimplement the "cross" built-in without ir_binop_cross.
We are not aware of any GPU that actually implements the cross product
as a single instruction.  Hence, there's no need for it to be an opcode.
Future commits will remove it entirely.
2010-11-17 13:20:30 -08:00
Kenneth Graunke
302fe4049c Regenerate glcpp parser. 2010-11-17 12:53:07 -08:00
Kenneth Graunke
d719bf8fb4 glsl: Unconditionally define GL_FRAGMENT_PRECISION_HIGH in ES2 shaders.
This is really supposed to be defined only if the driver supports highp
in the fragment shader - but all of our current ES2 implementations do.
So, just define it.  In the future, we'll need to add a flag to
gl_context and only define the macro if the flag is set.

"Fixes" freedesktop.org bug #31673.
2010-11-17 12:50:35 -08:00
Robert Hooker
778917069c egl_dri2: Add missing intel chip ids.
Signed-off-by: Robert Hooker <robert.hooker@canonical.com>
2010-11-17 12:10:53 -08:00
Chad Versace
df883eb157 glsl: Fix Doxygen tag \file in recently renamed files 2010-11-17 12:07:24 -08:00
Chad Versace
b4cdba687c glsl: Fix erroneous cast in ast_jump_statement::hir()
Return values were erroneously cast from (ir_rvalue*) to (ir_expression*).

NOTE: This is a candidate for the 7.9 branch.
2010-11-17 11:59:32 -08:00
Kenneth Graunke
e16c9d5d03 glsl: Fix constant expression handling for <, >, <=, >= on vectors.
ir_binop_less, ir_binop_greater, ir_binop_lequal, and ir_binop_gequal
are defined to work on vectors as well as scalars, as long as the two
operands have the same type.

This is evident from both ir_validate.cpp and our use of these opcodes
in the GLSL lessThan, greaterThan, lessThanEqual, greaterThanEqual
built-in functions.

Found by code inspection.  Not known to fix any bugs.  Presumably, our
tests for the built-in comparison functions must pass because C.E.
handling is done on the ir_call of "greaterThan" rather than the inlined
opcode.  The C.E. handling of the built-in function calls is correct.

NOTE: This is a candidate for the 7.9 branch.
2010-11-17 11:58:56 -08:00
Marek Olšák
fb7ae06f59 r300g: print FS inputs uninitialized due to hardware limits to stderr 2010-11-17 19:01:12 +01:00
Alex Deucher
75e52556a8 r600c/evergreen: texture align is group_bytes just like 6xx/7xx
Default group bytes to 512 on evergreen.  Don't query
tiling config yet for evergreen, the current info returned is not
adequate for evergreen (no way to get bank info).
2010-11-17 11:30:52 -05:00
Brian Paul
1d39df42c4 mesa: minor clean-ups in context code 2010-11-16 20:12:34 -07:00
Brian Paul
85288ad722 mesa: reorder texture_error_check() params
To better match other functions.
2010-11-16 20:12:34 -07:00
Brian Paul
3c59febf05 mesa: 80-column wrapping 2010-11-16 20:12:34 -07:00
Brian Paul
76114d23d1 mesa: whitespace cleanups 2010-11-16 20:12:34 -07:00
Brian Paul
78527154bd mesa: fix error messages and minor reindenting 2010-11-16 20:12:34 -07:00
Kenneth Graunke
bee901a1cf Refresh autogenerated glcpp parser. 2010-11-16 16:22:13 -08:00
Kenneth Graunke
3fb83038a0 glcpp: Define GL_FRAGMENT_PRECISION_HIGH if GLSL version >= 1.30.
Per section 4.5.4 of the GLSL 1.30 specification.
2010-11-16 16:22:12 -08:00
Henri Verbeet
6bbe637c13 r600g: Synchronize supported color formats between Evergreen and r600/r700. 2010-11-17 00:41:42 +01:00
Henri Verbeet
7d0f45563d r600g: Swizzle vertex data only once.
Vertex data swizzles are already done in the vertex shader. Doing them twice
breaks BGRA vertex arrays for example.
2010-11-17 00:41:42 +01:00
Marek Olšák
b6e2c32626 r300g: remove the hack with OPCODE_RET
RET was interpreted as END, which was wrong. Instead, if a shader contains RET
in the main function, it will fail to compile with an error message
from now on.

The hack is from early days.
2010-11-16 22:39:27 +01:00
Ian Romanick
2d2d6a80c1 glsl: Simplify generation of swizzle for vector constructors 2010-11-16 12:11:02 -08:00
Ian Romanick
38e55153af glsl: Refactor is_vec_{zero,one} to be methods of ir_constant
These predicates will be used in other places soon.
2010-11-16 12:11:02 -08:00
José Fonseca
4f84a3aa32 libgl-gdi: Allow to pick softpipe/llvmpipe on runtime. 2010-11-16 18:56:39 +00:00
Vinson Lee
063c6b8f74 mesa: Add definitions for inverse hyperbolic function on MSVC. 2010-11-15 22:00:32 -08:00
Vinson Lee
1935bdca44 glsl: Add ir_constant_expression.cpp to SConscript.
This was accidentally removed in commit 32aaf89823.

Fixes SCons builds.
2010-11-15 20:56:11 -08:00
Brian Paul
9b4b70e7e2 glsl: remove opt_constant_expression.cpp from SConscript
And alphabetize the opt_* files.
2010-11-15 18:59:45 -07:00
Brian Paul
c1928c7f10 mesa: add more work-arounds for acoshf(), asinhf(), atahf() 2010-11-15 18:50:58 -07:00
Brian Paul
88f482a839 glsl: fix assorted MSVC warnings 2010-11-15 18:48:43 -07:00
Brian Paul
20c2debce8 st/mesa: fix glDrawPixels(depth/stencil) bugs
When drawing GL_DEPTH_COMPONENT the usual fragment pipeline steps apply
so don't override the depth state.

When drawing GL_STENCIL_INDEX (or GL_DEPTH_STENCIL) the fragment pipeline
does not apply (only the stencil and Z writemasks apply) so disable writes
to the color buffers.

Fixes some regressions from commit ef8bb7ada9
2010-11-15 18:40:32 -07:00
Kenneth Graunke
32aaf89823 glsl: Rename various ir_* files to lower_* and opt_*.
This helps distinguish between lowering passes, optimization passes, and
other compiler code.
2010-11-15 16:34:20 -08:00
Kenneth Graunke
46b80d6469 glsl: Remove unused and out of date Makefile.am.
This was from when glsl2 lived in a separate repository and used
automake.
2010-11-15 14:47:15 -08:00
Kenneth Graunke
3108095198 glsl: Add constant expression handling for asinh, acosh, and atanh. 2010-11-15 14:08:58 -08:00
Kenneth Graunke
91181c7dd4 glsl: Refresh autogenerated file builtin_function.cpp. 2010-11-15 14:02:52 -08:00
Kenneth Graunke
db9b8c062f glsl: Implement the asinh, acosh, and atanh built-in functions. 2010-11-15 14:02:52 -08:00
Kenneth Graunke
096d36872f generate_builtins.py: Fix inconsistent use of tabs and spaces warning. 2010-11-15 14:02:52 -08:00
Kenneth Graunke
0d082c0e06 glsl: Refresh autogenerated lexer and parser files.
For the last three commits.
2010-11-15 13:33:58 -08:00
Kenneth Graunke
7279feeb19 glsl: Add support for the 'u' and 'U' unsigned integer suffixes. 2010-11-15 13:33:58 -08:00
Kenneth Graunke
2b6c1a0b7c glsl: Add new keywords and reserved words for GLSL 1.30. 2010-11-15 13:33:58 -08:00
Kenneth Graunke
285036fbb0 glsl: Rework reserved word/keyword handling in the lexer.
This consolidates the TOKEN_OR_IDENTIFIER and RESERVED_WORD macros into
a single KEYWORD macro.

The old TOKEN_OR_IDENTIFIER macros handled the case of a word going from
an identifier to a keyword; the RESERVED_WORD macro handled a word going
from a reserved word to a language keyword.  However, neither could
properly handle samplerBuffer (for example), which is an identifier in
1.10 and 1.20, a reserved word in 1.30, and a keyword in 1.40 and on.

Furthermore, the existing macros didn't properly handle reserved words
in GLSL ES 1.00.  The best they could do was return a token (rather than
an identifier), resulting in an obtuse parser error, rather than a
user-friendly "you used a reserved word" error message.
2010-11-15 13:33:57 -08:00
Kenneth Graunke
5dc74e9c77 glsl: Convert glsl_type::base_type from #define'd constants to an enum.
This is nice because printing type->base_type in GDB will now give you a
readable name instead of a number.
2010-11-15 13:33:57 -08:00
Kenneth Graunke
ee36f14fa5 glsl: Remove GLSL_TYPE_FUNCTION define.
Functions are not first class objects in GLSL, so there is never a value
of function type.  No code actually used this except for one function
which asserted it shouldn't occur.  One comment mentioned it, but was
incorrect.  So we may as well remove it entirely.
2010-11-15 13:33:57 -08:00
Henri Verbeet
62fe9c4efc r600g: Add PIPE_FORMAT_L8A8_UNORM for Evergreen as well. 2010-11-15 22:20:12 +01:00
Henri Verbeet
228d0d1153 r600: Evergreen has two extra frac_bits for the sampler LOD state.
Note: this is a candidate for the 7.9 branch.
2010-11-15 22:20:12 +01:00
Henri Verbeet
aa3113ae20 r600g: Evergreen has two extra frac_bits for the sampler LOD state.
The (piglit) mipmap_limits test shows the issue very clearly.
2010-11-15 22:20:12 +01:00
Henri Verbeet
da8c877733 r600g: Cleanup the fenced_bo list in r600_context_fini(). 2010-11-15 22:20:12 +01:00
Jerome Glisse
5da246944a gallium/noop: no operation gallium driver
This driver is a fake swdri driver that perform no operations
beside allocation gallium structure and buffer for upper layer
usage.

It's purpose is to help profiling core mesa/gallium without
having pipe driver overhead hidding hot spot of core code.

scons file are likely inadequate i am unfamiliar with this
build system.

To use it simply rename is to swrast_dri.so and properly set
LIBGL_DRIVERS_PATH env variable.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-11-15 14:56:40 -05:00
Hui Qi Tay
e3f106b5fe llvmpipe: clean up polygon offset function in lp setup code 2010-11-15 17:21:35 +00:00
Francisco Jerez
88850b3e4f dri/nouveau: Kill a bunch of ternary operators. 2010-11-15 17:42:08 +01:00
Francisco Jerez
aceb5b3277 dri/nouveau: Fix typo. 2010-11-15 17:42:08 +01:00
Viktor Novotný
8c94c7138e dri/nouveau: Remove nouveau_class.h, finishing switch to rules-ng-ng headers
Signed-off-by: Francisco Jerez <currojerez@riseup.net>
2010-11-15 17:42:07 +01:00
Viktor Novotný
69f54d2a7e dri/nouveau nv20: Use rules-ng-ng headers
Signed-off-by: Francisco Jerez <currojerez@riseup.net>
2010-11-15 17:42:07 +01:00
Viktor Novotný
f4efc256fd dri/nouveau: nv10: Use rules-ng-ng headers
Signed-off-by: Francisco Jerez <currojerez@riseup.net>
2010-11-15 17:42:07 +01:00
Viktor Novotný
8983855012 dri/nouveau: nv04: Use rules-ng-ng headers
Signed-off-by: Francisco Jerez <currojerez@riseup.net>
2010-11-15 17:42:06 +01:00
Viktor Novotný
dfc2bf818b dri/nouveau: Import headers from rules-ng-ng
Signed-off-by: Francisco Jerez <currojerez@riseup.net>
2010-11-15 17:42:06 +01:00
Brian Paul
3e910faed5 evergreen: set gl_texture_image::TexFormat field in evergreenSetTexBuffer()
See https://bugs.freedesktop.org/show_bug.cgi?id=31544

Note: this is a candidate for the 7.9 branch.
2010-11-15 09:31:33 -07:00
Brian Paul
f2f1c61950 r300: set gl_texture_image::TexFormat field in r300SetTexBuffer2()
See https://bugs.freedesktop.org/show_bug.cgi?id=31544

Note: this is a candidate for the 7.9 branch
2010-11-15 09:31:27 -07:00
Brian Paul
401f1efd3a r200: set gl_texture_image::TexFormat field in r200SetTexBuffer2()
See https://bugs.freedesktop.org/show_bug.cgi?id=31544

Note: this is a candidate for the 7.9 branch.
2010-11-15 09:31:21 -07:00
Brian Paul
0ef3b298e6 r600: set gl_texture_image::TexFormat field in r600SetTexBuffer2()
See https://bugs.freedesktop.org/show_bug.cgi?id=31544

Note: this is a candidate for the 7.9 branch.
2010-11-15 09:18:47 -07:00
Brian Paul
86abc1f104 radeon: set gl_texture_image::TexFormat field in radeonSetTexBuffer2()
See https://bugs.freedesktop.org/show_bug.cgi?id=31544

Note: this is a candidate for the 7.9 branch
2010-11-15 09:18:40 -07:00
Julien Cristau
e86b4c9194 Makefile: don't include the same files twice in the tarball
src/mesa/drivers/dri/*/*/*.[chS] is a superset of
src/mesa/drivers/dri/*/server/*.[ch] and
src/mesa/drivers/dri/common/xmlpool/*.[ch].
include/GL/internal/glcore.h is already in MAIN_FILES, no need for it in
DRI_FILES too.  src/glx/Makefile was listed twice.

Signed-off-by: Julien Cristau <jcristau@debian.org>
Signed-off-by: Brian Paul <brianp@vmware.com>
2010-11-15 08:46:22 -07:00
Daniel Lichtenberger
ef0720758e radeon: fix potential segfault in renderbuffer update
Fixes:
https://bugs.freedesktop.org/show_bug.cgi?id=31617

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2010-11-15 01:32:42 -05:00
Marek Olšák
9cf25b3d1c r300g: return shader caps from Draw for SWTCL vertex shaders 2010-11-14 23:04:18 +01:00
Marek Olšák
ed7cb289b3 r300g: clean up redundancy in draw functions 2010-11-14 19:28:04 +01:00
Eric Anholt
3b337f5cd9 i965: Fix gl_FragCoord inversion when drawing to an FBO.
This showed up as cairo-gl gradients being inverted on everyone but
Intel, where I'd apparently tweaked the transformation to work around
the bug.  Fixes piglit fbo-fragcoord.
2010-11-14 22:35:17 +08:00
Vinson Lee
d11db2a857 i965: Silence uninitialized variable warning.
Silences this GCC warning.
brw_fs.cpp: In member function 'void fs_visitor::split_virtual_grfs()':
brw_fs.cpp:2516: warning: unused variable 'reg'
2010-11-13 21:19:59 -08:00
Marek Olšák
7e2256688a r300g: fix texture border color for all texture formats
This fixes 8 texwrap format tests.
The code should handle arbitrary formats now and is cleaner.

NOTE: This is a candidate for the 7.9 branch.
2010-11-13 16:43:20 +01:00
Vinson Lee
3f6b1756f8 mesa: Clean up header file inclusion in points.h. 2010-11-13 01:16:12 -08:00
Brian Paul
56b4819932 mesa: consolidate assertions in teximage code 2010-11-12 07:21:29 -07:00
Christoph Bumiller
4c22475383 nvc0: import nvc0 gallium driver 2010-11-12 15:17:40 +01:00
Marek Olšák
93edd15178 svga: fill out CAPs for indirect addressing
As per the ps_3_0 and vs_3_0 documentation.
The aL register in D3D9 is quite tricky to use, though.
2010-11-12 03:13:23 +01:00
Marek Olšák
5c7127c07c r600g: fill out CAPs for indirect addressing 2010-11-12 03:13:23 +01:00
Marek Olšák
d279902b40 r300g: fill out CAPs for indirect addressing
To match shader model 2.0 (it's impossible to fully implement ARL
with shader model 3.0 relative addressing).
2010-11-12 03:13:22 +01:00
Marek Olšák
abe2c0d3b0 nvfx: fill out CAPs for indirect addressing
To match shader model 2.0.
2010-11-12 03:13:22 +01:00
Marek Olšák
3c6309e2f7 nv50: fill out CAPs for indirect addressing 2010-11-12 03:13:22 +01:00
Marek Olšák
04bafb2b55 i965g: fill out CAPs for indirect addressing 2010-11-12 03:13:22 +01:00
Marek Olšák
5bf7d668ac i915g: fill out CAPs for indirect addressing 2010-11-12 03:13:22 +01:00
Marek Olšák
53b7ec91ca tgsi: fill out CAPs for indirect addressing 2010-11-12 03:13:22 +01:00
Marek Olšák
cbfdf262cc gallium: add CAPs for indirect addressing and lower it in st/mesa when needed
Required because ATI and NVIDIA DX9 GPUs do not support indirect addressing
of temps, inputs, outputs, and consts (FS-only) or the hw support is so
limited that we cannot use it.

This should make r300g and possibly nvfx more feature complete.

Signed-off-by: Marek Olšák <maraeo@gmail.com>
2010-11-12 03:13:22 +01:00
Brian Paul
d18df9e336 tdfx: s/Format/_BaseFormat/
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=31560
2010-11-11 16:56:45 -07:00
Eric Anholt
6929cdd14b glsl: Free the loop state context when we free the loop state.
Since this was talloced off of NULL instead of the compile state, it
was a real leak over the course of the program.  Noticed with
valgrind --leak-check=full --show-reachable=yes.  We should really
change these passes to generally get the compile context as an argument
so simple mistakes like this stop mattering.
2010-11-11 15:12:37 -08:00
Brian Paul
78587ea012 mesa: fix glDeleteBuffers() regression
This fixes a regression (failed assertion) from commit
c552f273f5 which was hit if glDeleteBuffers()
was called on a buffer that was never bound.

NOTE: this is a candidate for the 7.9 branch.
2010-11-11 15:31:36 -07:00
Brian Paul
c552f273f5 mesa: make glIsBuffer() return false for never bound buffers
Use a dummy buffer object as we do for frame/renderbuffer objects.
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=31514

Note: this is a candidate for the 7.9 branch.
2010-11-11 14:49:53 -07:00
Aras Pranckevicius
d67df5dd9d glsl: fix crash in loop analysis when some controls can't be determined
Fixes loop-07.frag.
2010-11-11 10:49:37 -08:00
Keith Whitwell
7fb16423cc r600g: enforce minimum stride on render target texture images
Fixes piglit/fbo_readpixels since staging upload changes.
2010-11-11 16:20:24 +00:00
Keith Whitwell
8a3c181e9c r600g: do not try to use staging resource for depth textures
Currently r600_resource_copy_region() will turn these copies into
transfers + memcpys, so to avoid recursion we must not turn those
transfers back into blits.
2010-11-11 15:43:31 +00:00
Brian Paul
b3b6476695 mesa: handle more pixel types in mipmap generation code
NOTE: This is a candidate for the 7.9 branch.
2010-11-11 08:33:42 -07:00
Brian Paul
79c65410c1 mesa: add missing formats in _mesa_format_to_type_and_comps()
NOTE: this is a candidate for the 7.9 branch
2010-11-11 08:31:21 -07:00
Brian Paul
c9126d66fa mesa: improve error message 2010-11-11 07:43:46 -07:00
Brian Paul
624661cae4 mesa: #include mfeatures.h in enums.h 2010-11-11 07:43:46 -07:00
Keith Whitwell
6baad55f15 r600g: guard experimental s3tc code with R600_ENABLE_S3TC 2010-11-11 14:30:09 +00:00
Lucas Stach
089056a5f3 nvfx: fill PIPE_CAP_PRIMITIVE_RESTART and PIPE_CAP_SHADER_STENCIL_EXPORT
Signed-off-by: Lucas Stach <dev@lynxeye.de>
Signed-off-by: Francisco Jerez <currojerez@riseup.net>
2010-11-11 14:55:46 +01:00
Francisco Jerez
cdb38b5d3d dri/nouveau: Split hardware/software TNL instantiation more cleanly. 2010-11-11 14:50:50 +01:00
Vinson Lee
dc524adee2 mesa: Fix printf format warnings. 2010-11-10 17:30:59 -08:00
Ian Romanick
bcef51c3b8 mesa: Allow query of MAX_SAMPLES with EXT_framebuffer_multisample
Previously queries of MAX_SAMPLES were only allowed with
ARB_framebuffer_object, but EXT_framebuffer_multisample also enables
this query.  This seems to only effect the i915.  All other drivers
support both extensions or neither extension.

This patch is based on a patch that Kenneth sent along with the report.

NOTE: this is a candidate for the 7.9 branch.

Reported-by: Kenneth Waters <kwaters@chromium.org>
2010-11-10 16:00:03 -08:00
Jakob Bornecrantz
0faa7ada84 libgl-xlib: Use sw helper instead of roll your own 2010-11-10 23:40:18 +00:00
Jakob Bornecrantz
89deebb1af graw: Use inline sw helper instead of roll your own loader 2010-11-10 23:05:17 +00:00
Jakob Bornecrantz
d4c60575f8 galahad: Correct the name of the scons library 2010-11-10 23:05:17 +00:00
Jerome Glisse
8e0230a85c r600g: allow driver to work without submitting cmd to GPU
For driver performance analysis it usefull to be able to
disable as much as possible the GPU interaction so that
one can profile the userspace only.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-11-10 16:49:50 -05:00
Robert Hooker
e8b2d36723 intel: Add a new B43 pci id.
Signed-off-by: Robert Hooker <robert.hooker@canonical.com>
2010-11-10 13:37:47 -08:00
Eric Anholt
9effc1adf1 i965: re-enable gen6 IF statements in the fragment shader.
IF statements were getting flattened while they were broken.  With
Zhenyu's last fix for ENDIF's type, everything appears to have lined
up to actually work.

This regresses two tests:
glsl1-! (not) operator (1, fail)
glsl1-! (not) operator (1, pass)

but fixes tests that couldn't work before because the IFs couldn't be
flattened:
glsl-fs-discard-01
occlusion-query-discard

(and, naturally, this should be a performance improvement for apps
that actually use IF statements to avoid executing a bunch of code).
2010-11-10 13:33:27 -08:00
Eric Anholt
490c23ee6b i965: Work around strangeness in swizzling/masking of gen6 math.
Sometimes we swizzled in a different channel it looked like, and
sometimes we swizzled in zero.  Or something.

Having looked at the output of another code generator for this chip,
this is approximately what they do, too: use align1 math on
temporaries, and then move the results into place.

Fixes:
glean/vp1-EX2 test
glean/vp1-EXP test
glean/vp1-LG2 test
glean/vp1-RCP test (reciprocal)
glean/vp1-RSQ test 1 (reciprocal square root)
shaders/glsl-cos
shaders/glsl-sin
shaders/glsl-vs-masked-cos
shaders/vpfp-generic/vp-exp-alias
2010-11-10 12:36:23 -08:00
Francisco Jerez
47c471f281 meta: Handle bitmaps with alpha test enabled.
Acked-by: Brian Paul <brianp@vmware.com>
2010-11-10 21:24:31 +01:00
Zack Rusin
f623d0c1c2 gallivm: implement indirect addressing over inputs
Instead of messing with the callers simply copy our inputs into a
alloca array at the beginning of the function and then use it.

Reviewed-by: José Fonseca <jfonseca@vmware.com>
2010-11-10 13:00:35 -05:00
Roland Scheidegger
aad65fa112 mesa: remove unneeded DD_POINT_SIZE and DD_LINE_WIDTH tricaps
DD_POINT_SIZE was broken for quite some time, and the only driver (r200) relying
on this no longer needs it.
Both DD_POINT_SIZE and DD_LINE_WIDTH have no users left outside of debugging
output, hence instead of fixing DD_POINT_SIZE setting just drop both of them -
there was a plan to remove tricaps flags entirely at some point.
2010-11-10 17:24:42 +01:00
Roland Scheidegger
c7192ab11f r200: fix r200 large points
DD_POINT_SIZE got never set for some time now (as it was set only in ifdefed
out code), which caused the r200 driver to use the point primitive mistakenly
in some cases which can only do size 1 instead of point sprite. Since the
logic to use point instead of point sprite prim is flaky at best anyway (can't
work correctly for per-vertex point size), just drop this and always emit point
sprites (except for AA points) - reasons why the driver tried to use points for
size 1.0 are unknown though it is possible they are faster or more conformant.
Note that we can't emit point sprites without point sprite cntl as that might
result in undefined point sizes, hence need drm version check (which was
unnecessary before as it should always have selected points). An
alternative would be to rely on the RE point size clamp controls which could
clamp the size to 1.0 min/max even if the SE point size is undefined, but currently
always use 0 for min clamp. (As a side note, this also means the driver does
not honor the gl spec which mandates points, but not point sprites, with zero size
to be rendered as size 1.)
This should fix recent reports of https://bugs.freedesktop.org/show_bug.cgi?id=702.
This is a candidate for the mesa 7.9 branch.
2010-11-10 17:24:41 +01:00
Chia-I Wu
aa139a14ba egl_dri2: Fix __DRI_DRI2 version 1 support.
Correctly set __DRI_API_OPENGL flag.
2010-11-10 23:57:50 +08:00
Marek Olšák
93c04749be r300g: turn magic numbers into names in the hyperz code 2010-11-10 15:14:25 +01:00
Marek Olšák
1d28936dea r300g: rename has_hyperz -> can_hyperz 2010-11-10 15:14:25 +01:00
Marek Olšák
88ddfc57e4 r300g: mention ATI in the renderer string 2010-11-10 15:14:25 +01:00
Keith Whitwell
9a04eca2f8 ws/r600: match bo_busy shared/fence logic in bo_wait
Fixes crash in piglit depthrange-clear.
2010-11-10 11:04:38 +00:00
Vinson Lee
5b8ed2f6d2 mesa: Clean up header file inclusion in pixelstore.h. 2010-11-10 00:49:53 -08:00
Vinson Lee
700add5707 mesa: Clean up header file inclusion in pixel.h. 2010-11-10 00:46:27 -08:00
Zhenyu Wang
65972f992f Revert "i965: VS use SPF mode on sandybridge for now"
This reverts commit 9c39a9fcb2.

Remove VS SPF mode, conditional instruction works for VS now.
2010-11-10 08:17:45 -05:00
Zhenyu Wang
9249af17b8 i965: fix dest type of 'endif' on sandybridge
That should also be immediate value for type W.
2010-11-10 08:17:29 -05:00
Eric Anholt
f289dcd849 i965: Add support for math on constants in gen6 brw_wm_glsl.c path.
Fixes 10 piglit cases that were assertion failing.
2010-11-09 20:20:00 -08:00
Ian Romanick
ad8cb131d8 ir_to_mesa: Refactor code for emitting DP instructions 2010-11-09 18:09:41 -08:00
Eric Anholt
f00929cbdd i965: Allow OPCODE_SWZ to put immediates in the first arg.
Fixes assertion failure with texture swizzling in the GLSL path when
it's triggered (such as gen6 FF or ARB_fp shadow comparisons).

Fixes:
texdepth
texSwizzle
fp1-DST test
fp1-LIT test 3
2010-11-09 17:18:52 -08:00
Kenneth Graunke
afb6fb9a92 glsl: Remove unnecessary "unused variable" warning suppression.
The "instructions" variable -is- used, so the cast to void can go away.
2010-11-09 15:55:40 -08:00
Peter Clifton
efb0417040 intel: Add assert check for blitting alignment.
Also fixup code comment to reflect that the GPU requires DWORD
alignment, but in this case does not actually pass the value "in
DWORDs" as I previously stated.
2010-11-09 14:35:28 -08:00
Eric Anholt
00391c7941 Revert "intel: Fix the client-side swapbuffers throttling."
This reverts commit 76360d6abc.  On
second thought, it turned out that sync objects also used the
wait_rendering API like this, and would need the same treatment, and
so wait_rendering itself is fixed in libdrm now.
2010-11-09 14:03:04 -08:00
Eric Anholt
76360d6abc intel: Fix the client-side swapbuffers throttling.
We were asking for a wait to GTT read (all GPU rendering to it
complete), instead of asking for all GPU reading from it to be
complete.  Prevents swapbuffers-based apps from running away with
rendering, and produces a better input experience.
2010-11-09 13:30:27 -08:00
Ian Romanick
956ae44dcf glsl: Fix incorrect gl_type of sampler2DArray and sampler1DArrayShadow
NOTE: this is a candidate for the 7.9 branch.
2010-11-09 13:05:07 -08:00
José Fonseca
10740acf46 gallivm: Allocate TEMP/OUT arrays only once. 2010-11-09 20:36:28 +00:00
Zack Rusin
528c3cd241 gallivm: implement indirect addressing of the output registers 2010-11-09 20:36:28 +00:00
Vinson Lee
520140a6c9 winsys/xlib: Add cygwin to SConscript.
Fixes SCons NameError exception on Cygwin.
2010-11-09 12:31:11 -08:00
Keith Whitwell
63c3e3a3dc r600: fix my pessimism about PIPE_TRANSFER_x flags
For some reason I though we needed the _DISCARD flag to avoid
readbacks, which isn't true at all.  Now write operations should
pipeline properly, gives a good speedup to demos/tunnel.
2010-11-09 20:12:46 +00:00
Keith Whitwell
9f7ec103e2 r600g: translate ARR instruction 2010-11-09 20:12:46 +00:00
Keith Whitwell
c2c55547dc r600g: attempt to turn on DXTn formats
Seems to sort-of work for non-mipmapped textures.  Better than just
black anyway.
2010-11-09 20:12:46 +00:00
Keith Whitwell
e3ea4aec03 r600g: avoid recursion with staged uploads
Don't use an intermediate for formats which don't support hardware
blits under u_blitter.c, as these will recursively attempt to create a
transfer.
2010-11-09 20:12:46 +00:00
Brian Paul
6e2e136428 mesa: no-op glBufferSubData() on size==0
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=31439

NOTE: this is a candidate for the 7.9 branch
2010-11-09 12:24:51 -07:00
Brian Paul
61ea76c8da softpipe: can't no-op depth test stage when occlusion query is enabled
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=31479
2010-11-09 11:44:34 -07:00
Chia-I Wu
5b6ec5a553 st/dri: Add support for surfaceless current contexts.
Tested with Wayland.
2010-11-10 02:01:04 +08:00
Chia-I Wu
3418f74a94 docs: Update egl docs. 2010-11-10 01:31:38 +08:00
Chia-I Wu
dbacbb8219 autoconf: Add --enable-gallium-egl.
This option comes handy when we want to build gallium DRI drivers but
not st/egl.
2010-11-10 00:57:49 +08:00
Vinson Lee
3e6a05b1aa mesa: Clean up header file inclusion in nvprogram.h. 2010-11-09 06:22:25 -08:00
Vinson Lee
0c123679fc mesa: Clean up header file inclusion in multisample.h. 2010-11-09 06:08:29 -08:00
Vinson Lee
c509bf91ec mesa: Clean up header file inclusion in matrix.h. 2010-11-09 06:00:01 -08:00
Vinson Lee
e09800432b mesa: Clean up header file inclusion in lines.h. 2010-11-09 05:47:17 -08:00
Vinson Lee
a20e440c65 mesa: Clean up header file inclusion in light.h. 2010-11-09 05:35:24 -08:00
Vinson Lee
934fc80b06 mesa: Add missing header and forward declarations in dd.h. 2010-11-09 05:13:48 -08:00
Vinson Lee
90394b2d96 mesa: Clean up header file inclusion in image.h. 2010-11-09 05:00:44 -08:00
Thomas Hellstrom
24c6c41bd0 gallium/targets: Trivial crosscompiling fix
Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-11-09 12:50:12 +01:00
Thomas Hellstrom
0d5b4b320c svga/drm: Optionally resolve calls to powf during link-time
When linked with certain builds of libstdc++, it appears like powf is resolved
by a symbol in that library. Other builds of libstdc++ doesn't contain that
symbol resulting in a linker / loader error. Optionally
resolve that symbol and replace it with calls to logf and expf.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-11-09 12:31:25 +01:00
Thomas Hellstrom
8e630fad72 st/egl: Fix build for include files in nonstandard places
Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-11-09 12:31:24 +01:00
Thomas Hellstrom
6af2a7fe2c mesa: Add talloc includes for gles
Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-11-09 12:31:24 +01:00
Thomas Hellstrom
675aec8178 egl: Add an include for size_t
Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-11-09 12:31:24 +01:00
Zack Rusin
9d9df964c4 scons: build the xorg state trackers only when env includes drm 2010-11-09 10:41:59 +00:00
Vinson Lee
d79d942b2e mesa: Clean up header file inclusion in histogram.h. 2010-11-09 01:14:55 -08:00
Vinson Lee
5b3d6bd39e mesa: Clean up header file inclusion in hint.h. 2010-11-09 01:12:34 -08:00
Vinson Lee
63f1740a5d mesa: Clean up header file inclusion in framebuffer.h. 2010-11-09 01:04:22 -08:00
Vinson Lee
b35d3b33e7 mesa: Clean up header file inclusion in fog.h. 2010-11-09 00:58:46 -08:00
Vinson Lee
08354667a3 mesa: Clean up header file inclusion in ffvertex_prog.h. 2010-11-09 00:56:02 -08:00
Vinson Lee
6121730e74 mesa: Clean up header file inclusion in fbobject.h. 2010-11-09 00:52:49 -08:00
Chad Versace
b62c1c4595 glsl: Fix ir_expression::constant_expression_value()
When the type of the ir_expression is error_type, return NULL.
This fixes bug 31371.
2010-11-09 00:50:54 -08:00
Johann Rudloff
d7855ee332 radeon: Implement GL_OES_EGL_image
agd5f: add support to radeon/r200/r300 as well
2010-11-08 19:59:53 -05:00
Johann Rudloff
b42e562a11 radeon: Implement __DRI_IMAGE and EGL_MESA_image_drm 2010-11-08 19:59:53 -05:00
Alex Deucher
4990b771de egl_dri2: Add radeon chip ids 2010-11-08 19:59:53 -05:00
Johann Rudloff
f9b5201dbd radeon: Implement EGL_MESA_no_surface_extension 2010-11-08 19:59:53 -05:00
Kenneth Graunke
a457ca7844 ir_dead_functions: Actually free dead functions and signatures.
This makes linked shaders use around 36k less memory since the
built-in prototypes are now freed.
2010-11-08 16:22:15 -08:00
Vinson Lee
ef6967ddc2 graw: Add struct pipe_surface forward declaration.
Fixes this GCC warning.
graw.h:93: warning: 'struct pipe_surface' declared inside parameter list
graw.h:93: warning: its scope is only this definition or declaration,
which is probably not what you want
2010-11-08 11:55:30 -08:00
Mario Kleiner
d8eef5196f mesa/r300classic: Fix dri2Invalidate/radeon_prepare_render for page flipping.
A call to radeon_prepare_render() at the beginning of draw
operations was placed too deep in the call chain,
inside r300RunRenderPrimitive(), instead of
r300DrawPrims() where it belongs. This leads to
emission of stale target color renderbuffer into the cs if
bufferswaps via page-flipping are used, and thereby causes
massive rendering corruption due to unsynchronized
rendering into the active frontbuffer.

This patch fixes such problems for use with the
upcoming radeon page-flipping patches.

Signed-off-by: Mario Kleiner <mario.kleiner@tuebingen.mpg.de>
2010-11-08 13:53:23 -05:00
Benjamin Franzke
46c1970067 r600g: implement texture_get_handle (needed for eglExportDRMImageMESA) 2010-11-08 13:44:54 -05:00
Peter Clifton
10b9e018ca intel: Fix emit_linear_blit to use DWORD aligned width blits
The width of the 2D blits used to copy the data is defined as a 16-bit
signed integer, but the pitch must be DWORD aligned. Limit to an integral
number of DWORDs, (1 << 15 - 4) rather than (1 << 15 -1).

Fixes corruption to data uploaded with glBufferSubData.

Signed-off-by: Peter Clifton <pcjc2@cam.ac.uk>
2010-11-08 10:14:17 -08:00
Alex Deucher
5b15b5f4a8 r600c: properly align mipmaps to group size
fixes:
https://bugs.freedesktop.org/show_bug.cgi?id=31400
2010-11-08 12:06:15 -05:00
Michal Krol
136ff67ce8 graw: Export graw_save_surface_to_file().
Allows applications to dump surfaces to file without
referencing gallium/auxiliary entry points statically.

Existing test apps have been modified such that
they save the contents of the fronbuffer only
when the `-o' option's specified.
2010-11-08 17:24:11 +01:00
Michal Krol
9e7132b52d os: Open file streams in binary mode.
Otherwise we'll get garbled data on Windows.
2010-11-08 17:24:11 +01:00
Vinson Lee
962967d080 mesa: Clean up header file inclusion in extensions.h. 2010-11-07 21:15:45 -08:00
Vinson Lee
0be44c9406 mesa: Clean up header file inclusion in enable.h. 2010-11-07 21:09:32 -08:00
Vinson Lee
82cc8261d3 mesa: Clean up header file inclusion in drawtex.h. 2010-11-07 21:05:01 -08:00
Vinson Lee
5c2558884f mesa: Clean up header file inclusion in drawpix.h. 2010-11-07 21:02:31 -08:00
Vinson Lee
5953eac7ac mesa: Clean up header file inclusion in depthstencil.h. 2010-11-07 20:57:32 -08:00
Vinson Lee
e0bbb8e5a4 mesa: Clean up header file inclusion in depth.h. 2010-11-07 20:54:33 -08:00
Vinson Lee
76a5fed501 mesa: Clean up header file inclusion in debug.h. 2010-11-07 20:47:10 -08:00
Vinson Lee
a408dbeb37 mesa: Clean up header file inclusion in convolve.h. 2010-11-07 20:39:54 -08:00
Vinson Lee
cc0c45e7c5 mesa: Clean up header file inclusion in colortab.h. 2010-11-07 20:23:15 -08:00
Vinson Lee
fdf3174007 mesa: Clean up header file inclusion in buffers.h. 2010-11-07 20:00:32 -08:00
Vinson Lee
f26565f221 mesa: Clean up header file inclusion in blend.h. 2010-11-07 19:54:00 -08:00
Vinson Lee
42a8af9239 mesa: Clean up header file inclusion in attrib.h. 2010-11-07 19:49:12 -08:00
Vinson Lee
908272b183 mesa: Clean up header file inclusion in atifragshader.h. 2010-11-07 19:41:42 -08:00
Brian Paul
11dd228415 mesa: make fixed-pt and byte-valued arrays a runtime feature
These ES1 features were only tested for in the vertex array code.
Checking the ctx->API field at runtime is cleaner than the #ifdef
stuff and supports choosing the API at runtime.
2010-11-07 18:35:35 -07:00
Brian Paul
802bd6b705 mesa: remove stray GL_FLOAT case in _mesa_is_legal_format_and_type() 2010-11-07 18:33:53 -07:00
Brian Paul
dd28b4c1fc mesa: implement uint texstore code
We used float temporary images before which could lose precision for
uint-valued texture images.
2010-11-07 18:33:42 -07:00
Brian Paul
90c52c26d8 mesa: rename vars in pixel pack/unpack code 2010-11-07 18:33:20 -07:00
Brian Paul
e54d5a9d68 mesa: consolidate pixel packing/unpacking code 2010-11-07 18:33:07 -07:00
Vinson Lee
3a223c3098 mesa: Clean up header file inclusion in arrayobj.h. 2010-11-07 14:29:21 -08:00
Henri Verbeet
9f06411645 r600g: Mention AMD in the renderer string. 2010-11-07 18:40:12 +01:00
Vinson Lee
6bf0ac0916 mesa: Include mfeatures.h in api_validate.c for FEATURE_* symbols. 2010-11-06 21:13:40 -07:00
Vinson Lee
d421149cc8 mesa: Include mfeatures.h in api_loopback for FEATURE_beginend. 2010-11-06 21:05:16 -07:00
Vinson Lee
fb83400f6b mesa: Clean up header file inclusion in api_validate.h. 2010-11-06 20:56:15 -07:00
Vinson Lee
af12de279e mesa: Clean up header file inclusion in api_loopback.h. 2010-11-06 20:50:13 -07:00
Vinson Lee
31bdc53057 mesa: Clean up header file inclusion in version.h. 2010-11-06 20:40:13 -07:00
Vinson Lee
7a33b1c0a9 mesa: Clean up header file inclusion in accum.h. 2010-11-06 20:27:45 -07:00
Eric Anholt
d348b0c72d mesa: Fix delayed state flagging for EXT_sso-related program changes.
Flushing the vertices after having already updated the state doesn't
do any good.  Fixes useshaderprogram-flushverts-1.  As a side effect,
by moving it to the right place we end up skipping no-op state changes
for traditional glUseProgram.
2010-11-06 11:44:32 -07:00
Francisco Jerez
8eaa97592a meta: Don't try to disable cube maps if the driver doesn't expose the extension.
Signed-off-by: Brian Paul <brianp@vmware.com>
2010-11-06 02:40:21 +01:00
Francisco Jerez
2e64c2209e vbo: Avoid unnecessary copy to/from current in vertex format upgrade.
Rebuilding the vertex format from scratch every time we see a new
vertex attribute is rather costly, new attributes can be appended at
the end avoiding a copy to current and then back again, and the full
attr pointer recalculation.

In the not so likely case of an already existing attribute having its
size increased the old behavior is preserved, this could be optimized
more, not sure if it's worth it.

It's a modest improvement in FlightGear (that game punishes the VBO
module pretty hard in general, framerate goes from some 46 FPS to 50
FPS with the nouveau classic driver).

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-11-06 01:59:59 +01:00
Jakob Bornecrantz
f1600d3a97 scons: Unify state tracker SConscripts 2010-11-05 20:58:49 +00:00
Jakob Bornecrantz
7e9f5eab4e scons: Move dependancy checks to the main gallium scons file 2010-11-05 20:58:49 +00:00
Jakob Bornecrantz
c0db7854d5 scons: Check for libdrm_[intel|radeon] as well
And run SConscripts if they are present.
Also make dri depend on both drm and x11.
2010-11-05 20:58:49 +00:00
Jakob Bornecrantz
98d6ed8742 scons: Check for pkg-config before trying to use it
Silences warning about missing packages
2010-11-05 20:58:49 +00:00
Jakob Bornecrantz
b4ac0adb75 scons: Detabify
Drivers scons files for a later time
2010-11-05 20:58:49 +00:00
Jakob Bornecrantz
834cde5844 scons: Remove old pipebuffer SConscript 2010-11-05 20:58:49 +00:00
Brian Paul
e82fddfcd3 softpipe: disable vertex texturing with draw/llvm
This is a temporary work around to prevent crashes with glean/glsl1
(for example) which try to do vertex shader texturing.
2010-11-05 14:41:40 -06:00
Brian Paul
55c5408ad0 gallivm: add const qualifiers, fix comment string 2010-11-05 08:51:53 -06:00
Brian Paul
e8d6b2793f gallivm: alloca() was called too often for temporary arrays
Need to increment the array index to point to the last value.
Before, we were calling lp_build_array_alloca() over and over for
no reason.
2010-11-05 08:49:57 -06:00
Vinson Lee
3168c6ff1a i965: Silence uninitialized variable warning.
Silences this GCC warning.
brw_wm_fp.c: In function 'brw_wm_pass_fp':
brw_wm_fp.c:966: warning: 'last_inst' may be used uninitialized in this function
brw_wm_fp.c:966: note: 'last_inst' was declared here
2010-11-04 17:42:00 -07:00
Vinson Lee
03577f8250 i965: Silence uninitialized variable warning.
Silences this GCC warning.
brw_wm_fp.c: In function 'precalc_tex':
brw_wm_fp.c:666: warning: 'tmpcoord.Index' may be used uninitialized in this function
2010-11-04 17:39:17 -07:00
Vinson Lee
eba2ad6de2 r300/compiler: Move declaration before code.
Fixes this GCC warning with linux-x86 build.
radeon_dataflow.c: In function 'get_readers_normal_read_callback':
radeon_dataflow.c:472: warning: ISO C90 forbids mixed declarations and code
2010-11-04 17:25:16 -07:00
Brian Paul
c8f1687ce7 llvmpipe: added some debug assertions, but disabled 2010-11-04 18:21:45 -06:00
Vinson Lee
86559ce2d8 r300/compiler: Move declaration before code.
Fixes this GCC warning with linux-x86 build.
radeon_pair_schedule.c: In function 'merge_presub_sources':
radeon_pair_schedule.c:312: warning: ISO C90 forbids mixed declarations and code
2010-11-04 17:18:46 -07:00
Francisco Jerez
7831994868 meta: Fix incorrect rendering of the bitmap alpha component.
Signed-off-by: Brian Paul <brianp@vmware.com>
2010-11-04 13:58:54 -06:00
Francisco Jerez
d846362389 meta: Don't leak alpha function/reference value changes.
Signed-off-by: Brian Paul <brianp@vmware.com>
2010-11-04 13:58:02 -06:00
Brian Paul
ef6b7e0a30 tgsi: remove unused function 2010-11-04 13:35:20 -06:00
Tilman Sauerbeck
646a8b7e1d st/mesa: Reset the constant buffers before destroying the pipe context.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-11-04 20:01:25 +01:00
Brian Paul
e7f5d19a11 gallivm: implement execution mask for scatter stores 2010-11-04 10:01:28 -06:00
Brian Paul
fb94747b66 gallivm: added lp_elem_type() 2010-11-04 10:00:58 -06:00
Brian Paul
ede232e989 gallivm: add pixel offsets in scatter stores
We want to do the scatter store to sequential locations in memory
for the vector of pixels we're processing in SOA format.
2010-11-04 09:31:59 -06:00
Brian Paul
5b294a5d17 gallivm: added debug code to dump temp registers 2010-11-04 09:28:06 -06:00
Michal Krol
5d28d2f9d4 graw/gdi: Fix window dimensions.
The requested window size is of the client area,
so account for surrounding borders and bars when
creating the window.
2010-11-04 15:12:47 +01:00
Michal Krol
c69979f243 scons: Hook-up graw-gdi target. 2010-11-04 14:34:27 +01:00
Michal Krol
29beaed6dc graw/gdi: Initial commit. 2010-11-04 14:34:27 +01:00
Guillermo S. Romero
560ad7e599 r300g: Do not use buf param before checking for NULL.
Commit 8dfafbf086 forgot to update r300g.
There is a buf == NULL check, but buf is used before for var init.

Tested-by: Guillermo S. Romero <gsromero@infernal-iceberg.com>
2010-11-04 13:26:24 +00:00
Hui Qi Tay
315f8daab1 llvmpipe: added llvm offset setup code 2010-11-04 12:57:30 +00:00
Michal Krol
420400f67f tgsi/build: Reduce interface clutter.
Make private those functions that are used internally only.
2010-11-04 12:20:14 +01:00
Michal Krol
f93d6f929f tgsi/exec: Get rid of obsolete condition codes. 2010-11-04 11:51:10 +01:00
Michal Krol
ee9366ab36 tgsi/exec: Cleanup the remaining arithmetic instructions.
As a result remove some nasty macros.
2010-11-04 11:37:24 +01:00
Vinson Lee
d3fcadf840 dri/nouveau: Silence uninitialized variable warning.
Fixes this GCC warning.
nouveau_vbo_t.c: In function 'nv10_vbo_render_prims':
nouveau_render_t.c:161: warning: 'max_out' may be used uninitialized in this function
nouveau_render_t.c:161: note: 'max_out' was declared here
2010-11-03 18:20:22 -07:00
Brian Paul
3ded3e98ff gallivm: add some LLVM var labels 2010-11-03 17:34:07 -06:00
Brian Paul
2fefbc79ac gallivm: implement scatter stores into temp register file
Something is not quite right, however.  The piglit tests mentioned in
fd.o bug 31226 still don't pass.
2010-11-03 17:34:07 -06:00
Kenneth Graunke
c180e95d26 ir_reader: Fix some potential NULL pointer dereferences.
Found by inspection.
2010-11-03 13:39:42 -07:00
Kenneth Graunke
e751ce39bf ir_reader: Remove useless error check.
It's already been determined that length == 3, so clearly swiz->next is
a valid S-Expression.
2010-11-03 13:39:42 -07:00
Kenneth Graunke
0fd665ca63 ir_reader: Return a specific ir_dereference variant.
There's really no reason to return the base class when we have more
specific information about what type it is.
2010-11-03 13:39:42 -07:00
Kenneth Graunke
d2c23ac82a glsl: Don't print a useless space at the end of an S-Expression list.
We really only want to print spaces -between- elements, not after each
element.  This cleans up error messages from IR reader, making them
(mildly) easier to read.
2010-11-03 13:39:41 -07:00
Kenneth Graunke
6c4a83ca3e Refresh autogenerated file builtin_function.cpp. 2010-11-03 13:39:41 -07:00
Kenneth Graunke
91b72864b0 glsl/builtins: Clean up some ugly autogenerated code in atan.
In particular, calling the abs function is silly, since there's already
an expression opcode for that.  Also, assigning to temporaries then
assigning those to the final location is rather redundant.
2010-11-03 13:39:41 -07:00
Kenneth Graunke
84566c770a glsl/builtins: Rename 'x' to 'y_over_x' in atan(float) implementation.
For consistency with the vec2/vec3/vec4 variants.
2010-11-03 13:39:41 -07:00
José Fonseca
01b39b053b r600g: Swap the util_blitter_destroy call order.
Trivial change that avoids a segmentation fault when the blitter state
happens to be bound when the context is destroyed.

The free calls should probably removed altogether in the future -- the
responsibility to destroy the state atoms lies with whoever created it,
and the safest thing for the pipe driver is to not touch any bound state
in its destructor.
2010-11-03 20:25:13 +00:00
Brian Paul
b29ca2a561 mesa: code to unpack RGBA as uints 2010-11-03 11:18:52 -06:00
José Fonseca
54f2116877 xorg/vmwgfx: Link libkms when available. 2010-11-03 15:41:06 +00:00
José Fonseca
d49dfe66cf st/xorg: Detect libkms with scons too. 2010-11-03 15:21:51 +00:00
José Fonseca
12376d8ea3 st/xorg: Add missing \n to error message. 2010-11-03 15:14:29 +00:00
José Fonseca
ab2305b586 xorg/vmwgfx: Add missing source file to SConscript. 2010-11-03 14:02:40 +00:00
Eric Anholt
2aa738bf26 intel: Remove leftover dri1 locking fields in the context. 2010-11-03 06:08:27 -07:00
Eric Anholt
5716ad2425 intel: Remove duplicated teximage miptree to object miptree promotion.
intel_finalize_mipmap_tree() does this optimization too, just more
aggressively.
2010-11-03 06:08:27 -07:00
Eric Anholt
0300c9ab54 intel: Avoid taking logbase2 of several things that we max.
logbase2(max(width, height, depth)) ==
max(logbase2(width), logbase2(height), logbase2(depth)), but in 60
bytes less code.
2010-11-03 06:08:27 -07:00
Eric Anholt
e42ce160b1 i965: Remove dead intel_structs.h file. 2010-11-03 06:08:27 -07:00
Eric Anholt
6ad0283f48 intel: Remove the magic unaligned memcpy code.
In testing on Ironlake, the histogram of clocks/pixel results for the
system memcpy and magic unaligned memcpy show no noticeable difference
(and no statistically significant difference with the 5510 samples
taken, though the stddev is large due to what looks like the cache
effects from the different texture sizes used).
2010-11-03 06:08:27 -07:00
Eric Anholt
bb15408350 intel: Annotate debug printout checks with unlikely().
This provides the optimizer with hints about code hotness, which we're
quite certain about for debug printouts (or, rather, while we
developers often hit the checks for debug printouts, we don't care
about performance while doing so).
2010-11-03 06:08:27 -07:00
Brian Paul
b19b858060 egl/gdi: fix typo: xsurf->gsurf 2010-11-03 07:04:42 -06:00
Keith Whitwell
32bb65217e evergreeng: set hardware pixelcenters according to gl_rasterization_rules 2010-11-03 11:16:04 +00:00
Keith Whitwell
d6b6a0bc17 evergreeng: respect linewidth state, use integer widths only
Discard fractional bits from linewidth.  This matches the nvidia
closed drivers, my reading of the OpenGL SI and current llvmpipe
behaviour.

It looks a lot nicer & avoids ugliness where lines alternate between n
and n+1 pixels in width along their length.

Also fix up r600g to match.
2010-11-03 10:55:22 +00:00
Keith Whitwell
ee07e0e39a r600g: don't call debug_get_bool_option for tiling more than once 2010-11-03 10:55:22 +00:00
Keith Whitwell
b3462601cb evergreeng: protect against null constant buffers
Should do better than this and actually unbind the buffer, but haven't
yet gotten it to work.
2010-11-03 10:55:22 +00:00
Chia-I Wu
3f7876d76f st/egl: Use native_display_buffer for EGL_MESA_drm_image.
native_display_buffer is just a wrapper to resource_{from,get}_handle
for drm backend.
2010-11-03 17:50:25 +08:00
Chia-I Wu
af977b5382 st/egl: Add native_display_buffer interface.
The interface is a wrapper to pipe_screen::resource_from_handle and
pipe_screen::resource_get_handle.  A winsys handle is
platform-dependent.
2010-11-03 17:47:08 +08:00
Chia-I Wu
a5f4338fc4 st/egl: Add extern "C" wrapper to native.h.
This allows a backend to be written in C++.
2010-11-03 17:47:08 +08:00
Keith Whitwell
c3974dc837 r600g: set hardware pixel centers according to gl_rasterization_rules
These were previously being left in the default (D3D) mode.  This mean
that triangles were drawn slightly incorrectly, but also because this
state is relied on by the u_blitter code, all blits were half a pixel
off.
2010-11-03 09:36:01 +00:00
Keith Whitwell
7b120ceac8 r600g: remove unused flink, domain fields from r600_resource
These were being set but not used anywhere.
2010-11-03 09:36:01 +00:00
Keith Whitwell
d4fab99c1c r600g: use a buffer in GTT as intermediate on texture up and downloads
Generalize the existing tiled_buffer path in texture transfers for use
in some non-tiled up and downloads.

Use a staging buffer, which the winsys will restrict to GTT memory.

GTT buffers have the major advantage when they are mapped, they are
cachable, which is a very nice property for downloads, usually the CPU
will want to do look at the data it downloaded.
2010-11-03 09:36:01 +00:00
Keith Whitwell
29c4a15bf6 r600g: propogate resource usage flags to winsys, use to choose bo domains
This opens the question of what interface the winsys layer should
really have for talking about these concepts.

For now I'm using the existing gallium resource usage concept, but
there is no reason not use terms closer to what the hardware
understands - eg. the domains themselves.
2010-11-03 09:36:01 +00:00
Keith Whitwell
14c0bbf469 r600g: propagate usage flags in texture transfers 2010-11-03 09:36:01 +00:00
Chia-I Wu
04ae53ca8a st/egl: Add support for EGL_MATCH_NATIVE_PIXMAP.
Added for completeness.  It makes sense to have such mechanism, but I am
not aware of any user of that..
2010-11-03 17:17:29 +08:00
Chia-I Wu
b8cb14209a st/egl: Add support for swap interval and swap behavior.
The value of EGL_MAX_SWAP_INTERVAL and whether
EGL_SWAP_BEHAVIOR_PRESERVED_BIT is set will depend on the native
backend used.
2010-11-03 16:26:57 +08:00
Chia-I Wu
828d944fd6 st/egl: Remove flush_frontbuffer and swap_buffers.
They are deprecated by native_surface::present and there is no user of
them.
2010-11-03 16:08:47 +08:00
Chia-I Wu
250d81da25 d3d1x: Use native_surface::present.
Replace native_surface::flush_frontbuffer and
native_surface::swap_buffers calls by native_surface::present calls.
2010-11-03 16:08:44 +08:00
Chia-I Wu
0ae4b23c53 st/egl: Use native_surface::present callback.
Replace native_surface::flush_frontbuffer and
native_surface::swap_buffers calls by native_surface::present calls.
2010-11-03 16:08:23 +08:00
Chia-I Wu
94bf657b23 st/egl: Add native_surface::present callback.
The callback presents the given attachment to the native engine.  It
allows the swap behavior and interval to be controlled.  It will replace
native_surface::flush_frontbuffer and native_surface::swap_buffers
shortly.
2010-11-03 16:04:59 +08:00
Chia-I Wu
c9186bd588 egl: Set up the pthread key even TLS is used.
We have to rely on the pthread key destructor to free the current thread
info when a thread exits.
2010-11-03 13:34:17 +08:00
Vinson Lee
93a7e6d94e st/vega: Remove unnecessary headers. 2010-11-02 17:13:44 -07:00
Brian Paul
61f25216e3 mesa: silence new warnings in texobj.c
Silences warning such as:
main/texobj.c:442:40: warning: ISO C99 requires rest arguments to be used
main/texobj.c:498:58: warning: ISO C99 requires rest arguments to be used
2010-11-02 17:41:00 -06:00
Vinson Lee
6f90a7cbff savage: Remove unnecessary header. 2010-11-02 16:23:30 -07:00
Eric Anholt
689def8bbc intel: For batch, use GTT mapping instead of writing to a malloc and copying.
No measurable performance difference on cairo-perf-trace, but
simplifies the code and should have cache benefit in general.
2010-11-02 14:24:42 -07:00
Eric Anholt
1210aa7551 mesa: Don't compute an unused texture completeness debug string.
This showed up at about 1% on cairo-gl firefox-talos-gfx, where
glClear() is called while a texture is incomplete.
2010-11-02 14:24:42 -07:00
Tilman Sauerbeck
965c8a3f1d st/mesa: Reset the index buffer before destroying the pipe context.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-11-02 21:52:40 +01:00
Tilman Sauerbeck
52ba68d0b0 r600g: Destroy the winsys in r600_destroy_screen().
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-11-02 21:52:39 +01:00
Tilman Sauerbeck
907efeea18 r600g: Fixed two memory leaks in winsys.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-11-02 21:52:39 +01:00
Tilman Sauerbeck
ecb1b8b98f r600g: Delete custom_dsa_flush on shutdown.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-11-02 21:52:39 +01:00
Tilman Sauerbeck
c49dcaef65 r600g: We don't support PIPE_CAP_PRIMITIVE_RESTART.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-11-02 21:52:39 +01:00
Tilman Sauerbeck
86778dadc5 r600g: Made radeon_bo::map_count signed.
That way assert(map_count >= 0) can actually fail when we screwed up.

Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-11-02 21:52:39 +01:00
Tilman Sauerbeck
34e75b0ca8 r600g: Fixed unmap condition in radeon_bo_pb_destroy().
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-11-02 21:52:38 +01:00
Tilman Sauerbeck
b675266f0e r600g: Made radeon_bo_pb_map_internal() actually call radeon_bo_map().
This ensures that we increase bo->map_count when radeon_bo_map_internal()
returns successfully, which in turn makes sure we don't decrement
bo->map_count below zero later.

Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-11-02 21:52:38 +01:00
Tilman Sauerbeck
4e34393162 r600g: Removed unused 'ptr' argument from radeon_bo().
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-11-02 21:52:38 +01:00
Jakob Bornecrantz
1318b0ef9e graw: Tidy graw xlib scons file a bit 2010-11-02 18:20:30 +00:00
Brian Paul
2996ce72b1 llvmpipe: add a cast 2010-11-02 11:53:14 -06:00
Brian Paul
9fbf744389 llvmpipe: assign context's frag shader pointer before using it
The call to draw_bind_fragment_shader() was using the old fragment
shader.  This bug would have really only effected the draw module's
use of the fragment shader in the wide point stage.
2010-11-02 11:50:37 -06:00
Chad Versace
223568fbcd mesa: Fix C++ includes in sampler.cpp
Some C++ header files were included in an extern "C" block. When building with
Clang, this caused the build to fail due to namespace errors. (GCC did not
report any errors.)

Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Brian Paul <brianp@vmware.com>
2010-11-02 10:36:20 -07:00
Keith Whitwell
8dfafbf086 st/mesa: unbind constant buffer when not in use
Important as more constant buffers per shader start to get used.

Fix up r600 (tested) and nv50 (untested) to cope with this.  Drivers
previously didn't see unbinds of constant buffers often or ever, so
this isn't always dealt with cleanly.

For r600 just return and keep the reference.  Will try to do better in
a followup change.
2010-11-02 16:57:24 +00:00
Keith Whitwell
debcb43489 llvmpipe: guard against NULL task->query pointer
This doesn't seem like it should be possible, but some test suites
manage to hit this case.  Avoid crashing release builds under those
circumstances.
2010-11-02 16:48:10 +00:00
Keith Whitwell
98445b4307 llvmpipe: avoid generating tri_16 for tris which extend past tile bounds
Don't trim triangle bounding box to scissor/draw-region until after
the logic for emitting tri_16.  Don't generate tri_16 commands for
triangles with untrimmed bounding boxes outside the current tile.

This is important as the tri-16 itself can extend past tile bounds and
we don't want to add code to it to check against tile bounds (slow) or
restrict it to locations within a tile (pessimistic).
2010-11-02 16:48:10 +00:00
Brian Paul
fc70c05dbd mesa: fix aux/accum comment and error message mixups 2010-11-02 09:56:04 -06:00
Brian Paul
4a9ce9b299 mesa: remove always-false conditional in check_compatible()
The two gl_config pointers can never be equal.
2010-11-02 09:40:57 -06:00
Brian Paul
670207e6d0 dri/util: add a bunch of comments 2010-11-02 09:33:23 -06:00
Brian Paul
0fefafb2e4 mesa: move the gl_config struct declaration
It was in the middle of the lighting-related structures before.
Also add some info about field sizes in this structure.
2010-11-02 09:33:17 -06:00
Brian Paul
ee1f047c81 mesa: use GLubyte for edge flag arrays
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=31310
2010-11-02 08:23:24 -06:00
José Fonseca
265b53983e scons: Propagate installation targets.
Fixes libgl-xlib target.
2010-11-02 14:20:12 +00:00
José Fonseca
45f4b85d58 scons: i915 can't build on MSVC either.
I thought I had singled it out before, but apparently not.
2010-11-02 13:49:35 +00:00
José Fonseca
3ae04dd910 scons: Add aliases for several pipe drivers. 2010-11-02 12:35:52 +00:00
José Fonseca
4f8dbd2f5e r600g: List recently added files in SConscript. 2010-11-02 12:35:52 +00:00
Zhenyu Wang
aedc270966 i965: refresh wm push constant also for BRW_NEW_FRAMENT_PROGRAM on gen6
Fix compiz crash.

https://bugs.freedesktop.org/show_bug.cgi?id=31124
2010-11-02 16:06:13 +08:00
Chia-I Wu
16ee7a55ae mesa: Allow contexts of different APIs to coexist.
This effectively redoes 1741ddb747 in a
way that allows contexts of different APIs to coexist.

First, the changes to the remap table are reverted.  The remap table
(driDispatchRemapTable) is always initialized in the same way regardless
of the context API.

es_generator.py is updated to use a local remap table, whose sole
purpose is to help initialize its dispatch table.  The local remap table
and the global one are always different, as they use different
glapidispatch.h.  But the dispatch tables initialized by both remap
tables are always compatible with glapi (libGL.so).

Finally, the semantics of one_time_init are changed to per-api one-time
initialization.
2010-11-02 14:43:35 +08:00
Chia-I Wu
fdede1efaa mesa: Select FEATURE_remap_table when multiple APIs are enabled.
Core mesa should query glapi for the positions of the functions in
_glapi_table when multiple APIs are supported.  It does not know which
glapitable.h glapi used.
2010-11-02 14:17:56 +08:00
Tom Stellard
6b999c89ce r300/compiler: Don't track readers into an IF block.
This makes rc_get_readers_normal() more conservative than it needs to be,
but it fixes some incorrect behavior in the optimization passes.
2010-11-01 22:06:20 -07:00
Chia-I Wu
ad00a92ee7 egl: Rework _eglGetSearchPath.
So that the directory part of EGL_DRIVER, if exists, is prepended to the
search path.  This commit also adds a sanity check to _eglLog.
2010-11-02 01:37:16 +08:00
José Fonseca
583e41855b scons: Disable python state tracker when swig is not present. 2010-11-01 15:27:34 +00:00
José Fonseca
0fd41d236f scons: Restore x11 tool behavior for backwards compatability. 2010-11-01 14:37:18 +00:00
José Fonseca
ab9ca6caa8 scons: Some pipe drivers are not portable for MSVC 2010-11-01 14:24:08 +00:00
Hui Qi Tay
7f0dc5ea1b llvmpipe: Moved draw pipeline twoside function to llvm setup code 2010-11-01 14:14:55 +00:00
José Fonseca
f9156ebcc4 scons: Fix MinGW cross-compilation. 2010-11-01 13:56:16 +00:00
José Fonseca
601498ae73 scons: Revamp how to specify targets to build.
Use scons target and dependency system instead of ad-hoc options.

Now is simply a matter of naming what to build. For example:

  scons libgl-xlib

  scons libgl-gdi

  scons graw-progs

  scons llvmpipe

and so on. And there is also the possibility of scepcified subdirs, e.g.

  scons src/gallium/drivers

If nothing is specified then everything will be build.

There might be some rough corners over the next days. Please bare with me.
2010-11-01 13:30:22 +00:00
Francisco Jerez
a84bd587c6 dri/nouveau: Re-emit the BO state when coming back from a software fallback. 2010-10-31 22:07:38 +01:00
Francisco Jerez
4a282629c2 dri/nouveau: Validate the framebuffer state on read buffer changes. 2010-10-31 22:07:26 +01:00
Francisco Jerez
453b718552 dri/nouveau: Fix type promotion issue on 32bit platforms.
Fixes some VTX protection errors introduced by e89af20926.
2010-10-31 22:07:10 +01:00
Benjamin Franzke
6102683b19 st/egl image: multiply drm buf-stride with blocksize
[olv: formatted for 80-column wrapping]
2010-11-01 01:03:53 +08:00
Chia-I Wu
52ef148923 targets/egl: Fix a warning with --disable-opengl build.
API_DEFINES is the defines for libmesagallium.a.  Append it to
egl_CPPFLAGS only when st_GL.so, which uses libmesagallium.a, is built.
2010-10-31 21:22:26 +08:00
Chia-I Wu
1230050363 autoconf: Tidy configure output for EGL.
Prefix EGL driver names by "egl_".  Make it clear that EGL_CLIENT_APIS
is only used by egl_gallium.
2010-10-31 21:22:26 +08:00
Tom Stellard
a15cf3cd0b r300/compiler: Don't clobber presubtract sources during optimizations
https://bugs.freedesktop.org/show_bug.cgi?id=28294
2010-10-30 22:26:19 -07:00
Francisco Jerez
088145f950 dri/nouveau: Pipeline glTexSubImage texture transfers. 2010-10-31 02:02:33 +01:00
Francisco Jerez
f67fa52293 dri/nouveau: Keep small DYNAMIC_DRAW vertex buffers in system ram. 2010-10-31 02:01:24 +01:00
Francisco Jerez
e89af20926 dri/nouveau: Optimize VBO binding re-emission. 2010-10-31 02:50:44 +02:00
Francisco Jerez
57382e71ef dri/nouveau: Split out array handling to its own file. 2010-10-31 02:50:04 +02:00
Francisco Jerez
9d1f1fcf13 dri/nouveau: Use a macro to iterate over the bound vertex attributes. 2010-10-31 02:45:38 +02:00
Francisco Jerez
dbe1eae785 dri/nouveau: Avoid recursion in nouveau_bo_context_reset(). 2010-10-31 02:45:31 +02:00
Francisco Jerez
f2098e0fef dri/nouveau: Split out the scratch helpers to a separate file. 2010-10-31 02:44:45 +02:00
Francisco Jerez
6daaf45359 dri/nouveau: Tell the vbo module we want real hardware BOs. 2010-10-31 02:44:35 +02:00
Francisco Jerez
6ee9cd482a dri/nouveau: Honor the access flags in nouveau_bufferobj_map_range. 2010-10-31 02:43:14 +02:00
Francisco Jerez
f102c5220c dri/nouveau: Call _mesa_update_state() after framebuffer invalidation.
Previously nouveau_state_emit() was being called directly, sometimes
that doesn't work because it doesn't update the derived GL context.
2010-10-30 19:25:33 +02:00
Francisco Jerez
e3c0b7ba41 dri/nv25: Bind a hierarchical depth buffer. 2010-10-30 19:25:32 +02:00
Francisco Jerez
c5ca972c07 dri/nouveau: Don't assert(0) on compressed internal formats. 2010-10-30 19:25:32 +02:00
Francisco Jerez
920481d387 dri/nv20: Clear with the 3D engine. 2010-10-30 19:25:31 +02:00
Chia-I Wu
cfc81d93f7 st/mesa: Unreference the sampler view in st_bind_surface.
Without this, update_textures may not pick up the new pipe_resource.

It is actually update_textures that should check
stObj->sampler_view->texture != stObj->pt, but let's follow st_TexImage
and others for now.
2010-10-31 01:18:59 +08:00
Brian Paul
9c2b4814d0 osmesa: fix renderbuffer memleak in OSMesaMakeCurrent()
Fixes fd.o bug 31128.
2010-10-30 10:11:37 -06:00
Chia-I Wu
156e955c25 autoconf: st/vega requires --enable-openvg.
Make it a warning for now to smooth the transition.
2010-10-30 14:41:17 +08:00
Kenneth Graunke
cff1aeea10 glsl: Remove unused ARRAY_SIZE macro.
It's also equivalent to Elements(...) which is already used elsewhere.
2010-10-29 11:43:30 -07:00
Eric Anholt
a974949f3b mesa: Make metaops use program refcounts instead of names.
Fixes failure on restoring state when the program was active but
deleted, and the name no longer exists.

Bug #31194
2010-10-29 11:28:38 -07:00
Brian Paul
34e8801b9c mesa: remove dead code 2010-10-29 08:13:31 -06:00
José Fonseca
d070edd4f0 mesa: Fix windows build (uint -> GLuint). 2010-10-29 13:05:31 +01:00
Chia-I Wu
bdd8838631 targets: Add missing quotes to Makefile.xorg.
Fix

  $ make CC="ccache gcc"
2010-10-29 13:00:12 +08:00
Chia-I Wu
9de5c6a1cb Merge branch 'glapi-reorg'
Conflicts:
	src/mapi/glapi/glapi_sparc.S
	src/mapi/glapi/glapi_x86.S
	src/mapi/glapi/glapidispatch.h
	src/mapi/glapi/glapioffsets.h
	src/mapi/glapi/glprocs.h
2010-10-29 12:46:59 +08:00
Chia-I Wu
815faa448c autoconf: Update configuration info.
Output API info first.  Move GLU/GLw/GLUT and EGL near driver info.
2010-10-29 12:42:24 +08:00
Chia-I Wu
c6320c5eb2 docs: Update egl and openvg docs. 2010-10-29 12:11:49 +08:00
Chia-I Wu
be5f34a053 autoconf: Better client API selection.
Make autoconf decide the client APIs enabled first.  Then when OpenGL
and OpenGL ES are disabled, there is no need to build src/mesa/;  when
OpenGL is disabled, no $mesa_driver should be built.  Finally, add
--enable-openvg to enable OpenVG.

With these changes, an OpenVG only build can be configured with

  $ ./configure --disable-opengl --enable-openvg

src/mesa, src/glsl, and src/glx will be skipped, which saves a great
deal of compilation time.

And an OpenGL ES only build can be configured with

  $ ./configure --disable-opengl --enable-gles-overlay
2010-10-29 12:10:46 +08:00
Brian Paul
bdba4608df mesa: pixel transfer ops do not apply to integer-valued textures 2010-10-28 21:17:42 -06:00
Brian Paul
0a3566cec0 mesa: additional integer formats in _mesa_bytes_per_pixel() 2010-10-28 21:17:42 -06:00
Brian Paul
7faf521fad mesa: add const qualifier to _mesa_is_legal_format_and_type() 2010-10-28 21:17:42 -06:00
Brian Paul
113c1832b1 mesa: fix integer cases in _mesa_is_legal_format_and_type()
Some integer formats work with some packed datatypes.
2010-10-28 21:17:42 -06:00
Brian Paul
9fc7fa0a4c mesa: fix incorrect type in _mesa_texstore_rgba_int16() 2010-10-28 21:17:42 -06:00
Brian Paul
b44f9c7e0a mesa: remove obsolete comment 2010-10-28 21:17:42 -06:00
Brian Paul
22c7a69d7b mesa: add extension table entry for GL_EXT_gpu_shader4 2010-10-28 21:17:42 -06:00
Brian Paul
55dc971ded mesa: clean-up array element code
Remove unnecessary GLAPIENTRY keywords, update comments, re-indent.
2010-10-28 21:17:42 -06:00
Brian Paul
d916d81582 mesa: glArrayElement support for integer-valued arrays 2010-10-28 21:17:42 -06:00
Brian Paul
3b82ceec67 mesa: state/queries for GL_MIN/MAX_PROGRAM_TEXEL_OFFSET_EXT 2010-10-28 21:17:42 -06:00
Brian Paul
433e5e6def mesa: consolidate glVertex/Color/etcPointer() code
This removes a bunch of similar error checking code in all the vertex
pointer functions and puts nearly all the error checking in update_array().
2010-10-28 21:17:42 -06:00
Brian Paul
d1184d26bb mesa: add gl_client_array::Integer field and related vertex array state code 2010-10-28 21:17:41 -06:00
Brian Paul
ca2618f4b6 mesa: implement integer-valued vertex attribute functions
The integers still get converted to floats.  That'll have to change someday.
2010-10-28 21:17:41 -06:00
Brian Paul
e2b8c65723 mesa: add new GLvertexformat entries for integer-valued attributes 2010-10-28 21:17:41 -06:00
Brian Paul
ba9995953c mesa: plug in more GL_EXT_gpu_shader4 functions 2010-10-28 21:17:41 -06:00
Brian Paul
9c61ca90ea mesa: add glGetUniformuiv(), plug in uint glUniform funcs 2010-10-28 21:17:41 -06:00
Brian Paul
53eca8d216 mesa: plug in stubs for glBindFragDataLocation(), glGetFragDataLocation() 2010-10-28 21:17:41 -06:00
Brian Paul
a6fb2acfdb glapi: regenerated API files 2010-10-28 21:17:41 -06:00
Brian Paul
20371d40b8 glapi: include EXT_gpu_shader4.xml 2010-10-28 21:17:41 -06:00
Brian Paul
a52dbaa99a glapi: xml spec file for GL_EXT_gpu_shader4 2010-10-28 21:17:41 -06:00
Brian Paul
beea704be2 vbo: re-indent file 2010-10-28 21:17:41 -06:00
Brian Paul
25efd558a3 mesa: remove 'normalized' parameter from _mesa_VertexAttribIPointer() 2010-10-28 21:17:41 -06:00
Eric Anholt
9d45c7d1ce i965: Update the gen6 stencil ref state when stencil state changes.
Fixes 6 piglit tests about stencil operations.
2010-10-28 16:28:42 -07:00
Eric Anholt
b271445e37 i965: Upload required gen6 VS push constants even when using pull constants.
Matches pre-gen6, and fixes glsl-vs-large-uniform-array.
2010-10-28 15:38:38 -07:00
Eric Anholt
c5114c7eab i965: Update gen6 SF state when point state (sprite or attenuation) changes. 2010-10-28 15:38:38 -07:00
Eric Anholt
e30a3e7aa0 i965: Add user clip planes support to gen6.
Fixes piglit user-clip, and compiz desktop switching when dragging a
window and using just 2 desktops.  Bug #30446.
2010-10-28 14:45:11 -07:00
José Fonseca
85a08f8fc7 gallivm: Remove the EMMS opcodes.
Unnecessary now that lp_set_target_options() successful disables MMX code
emission.
2010-10-28 20:42:02 +01:00
José Fonseca
8d364221e9 gallivm: always enable LLVMAddInstructionCombiningPass() 2010-10-28 20:40:34 +01:00
José Fonseca
5479fa34d9 gallium: Avoid using __doc__ in python scripts. 2010-10-28 17:38:18 +01:00
Vinson Lee
a54ab4960b st/mesa: Silence uninitialized variable warning.
Fixes this GCC warning.
state_tracker/st_program.c: In function 'st_print_shaders':
state_tracker/st_program.c:735: warning: 'sh' may be used uninitialized in this function
2010-10-28 06:08:19 -07:00
Tom Stellard
aa43176ebd r300/compiler: Use rc_get_readers_normal() for presubtract optimizations 2010-10-27 22:49:50 -07:00
Kenneth Graunke
cbc966b57b i965: Add bit operation support to the fragment shader backend. 2010-10-27 13:55:30 -07:00
Eric Anholt
9e3641bd0d i965: Make FS uniforms be the actual type of the uniform at upload time.
This fixes some insanity that would otherwise be required for GLSL
1.30 bit ops or gen6 integer uniform operations in general, at the
cost of upload-time pain.  Given that we only have that pain because
mesa's mangling our integer uniforms to be floats, this something that
should be fixed outside of the shader codegen.
2010-10-27 13:54:35 -07:00
Ian Romanick
502943049a docs: add GL_EXT_separate_shader_objects to release notes 2010-10-27 13:45:29 -07:00
Ian Romanick
817ed68710 intel: Enable GL_EXT_separate_shader_objects in Intel drivers 2010-10-27 13:35:53 -07:00
Ian Romanick
f48915ec52 swrast: Enable GL_EXT_separate_shader_objects in software paths 2010-10-27 13:35:53 -07:00
Ian Romanick
84eba3ef71 Track separate programs for each stage
The assumption is that all stages are the same program or that
varyings are passed between stages using built-in varyings.
2010-10-27 13:35:53 -07:00
Ian Romanick
75c6f47288 mesa: Track an ActiveProgram distinct from CurrentProgram
ActiveProgram is the GL_EXT_separate_shader_objects state variable
used for glUniform calls.  glUseProgram also sets this.
2010-10-27 13:35:53 -07:00
Ian Romanick
01abcf3b79 mesa: Add display list support for GL_EXT_separate_shader_objects functions 2010-10-27 13:35:53 -07:00
Ian Romanick
c72aa7fa58 mesa: Skeletal support for GL_EXT_separate_shader_objects
Really just filling in the entry points.  None of them do anything
other than validate their inputs.
2010-10-27 13:35:53 -07:00
Ian Romanick
b97794c041 mesa: Add infrastructure to track GL_EXT_separate_shader_objects 2010-10-27 13:35:53 -07:00
Ian Romanick
44f6e17ebb glapi: Commit files changed by previous commit 2010-10-27 13:35:53 -07:00
Ian Romanick
206e904f3c glapi: Add GL_EXT_separate_shader_objects 2010-10-27 13:35:52 -07:00
Kenneth Graunke
3acc826520 Fix build on systems where "python" is python 3.
First, it changes autoconf to use a "python2" binary when available,
rather than plain "python" (which is ambiguous).  Secondly, it changes
the Makefiles to use $(PYTHON) $(PYTHON_FLAGS) rather than calling
python directly.

Signed-off-by: Xavier Chantry <chantry.xavier@gmail.com>
Signed-off-by: Matthew William Cox <matt@mattcox.ca>
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
2010-10-27 12:49:53 -07:00
Marek Olšák
676c3f08bd r300g: add a default channel ordering of texture border for unhandled formats
It should fix the texture border for compressed textures.
Broken since 8449a4772a.
2010-10-27 21:21:23 +02:00
Alex Deucher
8ff7885e8f r600c: add missing radeon_prepare_render() call on evergreen 2010-10-27 14:30:50 -04:00
Alex Deucher
b194b9b238 r100: revalidate after radeon_update_renderbuffers
This is a port of 603741a86d
to r100.

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2010-10-27 13:53:29 -04:00
Vinson Lee
80adc8ac3b swrast: Print out format on unexpected failure in _swrast_ReadPixels. 2010-10-27 10:16:18 -07:00
Vinson Lee
1b92eb1a4b egl: Remove unnecessary headers. 2010-10-27 09:51:11 -07:00
Vinson Lee
e7343cd704 mesa: Remove unnecessary header. 2010-10-27 09:38:33 -07:00
Vinson Lee
21ce44374a st/mesa: Remove unnecessary header. 2010-10-27 09:33:13 -07:00
Vinson Lee
d674ee2a4d r600g: Silence uninitialized variable warnings. 2010-10-27 09:26:27 -07:00
Vinson Lee
d4cdd2fab0 mesa: Remove unnecessary headers. 2010-10-27 09:09:47 -07:00
Vinson Lee
3c8106402f r300g: Silence uninitialized variable warning.
Fixes this GCC warning.
r300_state_derived.c: In function 'r300_update_derived_state':
r300_state_derived.c:593: warning: 'r' may be used uninitialized in this function
r300_state_derived.c:593: note: 'r' was declared here
2010-10-27 09:02:00 -07:00
Tilman Sauerbeck
8ad9d83fdf r600g: Destroy the blitter.
This fix got lost in the state rework merge.

Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-10-27 08:44:47 +02:00
Tilman Sauerbeck
c6b10cd986 r600g: In radeon_bo(), call LIST_INITHEAD early.
radeon_bo_destroy() will want to read the list field. Without this patch,
we'd end up evaluating the list pointers before they have been properly
set up when we destroyed the newly created bo if it cannot be mapped.

Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-10-27 08:44:35 +02:00
Chia-I Wu
b762db62c2 mesa: Remove unnecessary glapitable.h includes.
With 07b85457d9, glapitable.h is included
by core mesa only to know the size of _glapi_table.  It is not necessary
as the same info is given by _gloffset_COUNT.

This change makes _glapi_table opaque to core mesa.  All operations on
it are supposed to go through one of the SET/GET/CALL macros.
2010-10-27 11:11:11 +08:00
Chia-I Wu
aefd4f76ea vbo: Use CALL_* macros.
Use macros to access _glapi_table consistently.  There is no functional
change.
2010-10-27 11:09:40 +08:00
Chia-I Wu
07b85457d9 glapi: Merge glapioffsets.h into glapidispath.h.
Move defines in glapioffsets.h to glapidispatch.h.  Rename
_gloffset_FIRST_DYNAMIC to _gloffset_COUNT, which is equal to the number
of entries in _glapi_table.

Consistently use SET_by_offset, GET_by_offset, CALL_by_offset, and
_gloffset_* to recursively define all SET/GET/CALL macros.
2010-10-27 11:07:29 +08:00
Chia-I Wu
e4dbfa44ed glapi: Do not use glapioffsets.h.
glapioffsets.h exists for the same reason as glapidispatch.h does.  It
is of no use to glapi.  This commit also drops the use of glapioffsets.h
in glx as glx is considered an extension to glapi when it comes to
defining public GL entries.
2010-10-27 10:49:33 +08:00
Brian Paul
412b960883 mesa: rename function to _mesa_is_format_integer_color()
Be a bit more clear about its operation.
2010-10-26 20:30:42 -06:00
Brian Paul
ab50148fda mesa: fix bug in _mesa_is_format_integer()
We only want to return true if it's an integer _color_ format, not a
depth and/or stencil format.
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=31143
2010-10-26 20:25:23 -06:00
Chia-I Wu
e213968f2b glapi: Move glapidispatch.h to core mesa.
It is a core mesa header, not a glapi header.
2010-10-27 10:08:27 +08:00
Chia-I Wu
b5022ad035 glapi: Do not use glapidispatch.h.
glapidispatch.h exists so that core mesa (libmesa.a) can be built for
DRI drivers or for non-DRI drivers as a compile time decision (whether
IN_DRI_DRIVER is defined).  It is of no use to glapi.  This commit also
drops the use of glapidispatch.h in glx and libgl-xlib as they are
considered extensions to glapi when it comes to defining public GL
entries.
2010-10-27 10:06:25 +08:00
Brian Paul
9b3c4d3e67 mesa: remove the unused _mesa_is_fragment_shader_active() function
This reverts commit 013d5ffeec.
2010-10-26 18:05:37 -06:00
Brian Paul
ccef2110ed mesa: call _mesa_valid_to_render() in glDrawPixels, glCopyPixels, glBitmap
This lets us simplify and consolidate some state checking code.

This implements the GL_INVALID_OPERATION check for all drawing commands
required by GL_EXT_texture_integer.
2010-10-26 18:05:37 -06:00
Brian Paul
705978e283 mesa: do integer FB / shader validation check in _mesa_valid_to_render() 2010-10-26 18:05:37 -06:00
Eric Anholt
bb4f12f538 i965: Disable register spilling on gen6 until it's fixed.
Avoids GPU hang on glsl-fs-convolution-1.
2010-10-26 15:07:25 -07:00
Eric Anholt
00bfdac5b8 i965: Fix VS URB entry sizing.
I'm trying to clamp to a minimum of 1 URB row, not a maximum of 1.

Fixes:
glsl-kwin-blur
glsl-max-varying
glsl-routing
2010-10-26 15:07:10 -07:00
Eric Anholt
88087ba1bf i965: Drop the eot argument to read messages, which can never be set. 2010-10-26 13:46:09 -07:00
Eric Anholt
3ee5d68075 i965: Add support for constant buffer loads on gen6.
Fixes glsl-fs-uniform-array-5.
2010-10-26 13:17:54 -07:00
Eric Anholt
519835de04 i965: Set up the constant buffer on gen6 when it's needed.
This was slightly confused because gen6_wm_constants does the push
constant buffer, while brw_wm_constants does pull constants.
2010-10-26 13:15:01 -07:00
Eric Anholt
6488cf46f5 i965: Fix typo in comment about state flags. 2010-10-26 12:19:46 -07:00
Eric Anholt
33c4b2370f i965: Handle new ir_unop_round_even in channel expression splitting. 2010-10-26 11:23:27 -07:00
Eric Anholt
62452e7d94 i965: Add support for discard instructions on gen6.
It's a little more painful than before because we don't have the handy
mask register any more, and have to make do with cooking up a value
out of the flag register.
2010-10-26 11:21:44 -07:00
Eric Anholt
9b1d26f78f i965: Add disasm for the flag register. 2010-10-26 11:21:44 -07:00
Eric Anholt
0e8c834ffa i965: Clear some undefined fields of g0 when using them for gen6 FB writes.
This doesn't appear to help any testcases I'm looking at, but it looks
like it's required.
2010-10-26 10:34:14 -07:00
Eric Anholt
1732a8bc72 i965: Use SENDC on the first render target write on gen6.
This is apparently required, as the thread will be initiated while it
still has dependencies, and this is what waits for those to be
resolved before writing color.
2010-10-26 10:34:10 -07:00
Eric Anholt
748f3744be i965: Clarify an XXX comment in FB writes with real info. 2010-10-26 10:34:10 -07:00
Eric Anholt
3789d5025a i965: Add EU code for dword scattered reads (constant buffer array indexing). 2010-10-26 10:34:10 -07:00
Chia-I Wu
547e7619aa egl_dri2: Fix a typo that make glFlush be called at wrong time.
We want to call glFlush when there is a current context.  That is,
old_ctx.  This is a regression introduced by
d19afc57fe.
2010-10-26 15:04:28 +08:00
Dave Airlie
d1acb92016 r600g: add assembler support for all the kcache fields. 2010-10-26 12:08:00 +10:00
Brian Paul
326b981d3f mesa: additional teximage error checks for GL_EXT_texture_integer 2010-10-25 19:21:55 -06:00
Brian Paul
862bb1b0ff mesa: additional switch cases for GL_EXT_texture_integer 2010-10-25 19:21:55 -06:00
Brian Paul
751e10fc01 mesa: additional glReadPixels error checks for GL_EXT_texture_integer 2010-10-25 19:21:55 -06:00
Dave Airlie
2d2bafdb30 r600g: fix magic 0x1 ->flat shade ena 2010-10-26 09:47:02 +10:00
Kenneth Graunke
ba2382f50d glsl: Fix constant component count in vector constructor emitting.
Fixes freedesktop.org bug #31101 as well as piglit test cases
assignment-type-mismatch.vert and constructor-28.vert.
2010-10-25 12:56:47 -07:00
Chad Versace
6e00627384 glsl: Fix ast-to-hir for ARB_fragment_coord_conventions
Function ast_declarator_list::hir(), when processing keywords added by
extension ARB_fragment_coord_conventions, made the mistake of checking only if
the extension was __supported by the driver__. The correct behavior is to check
if the extensi0n is __enabled in the parse state__.

NOTE: this is a candidate for the 7.9 branch.

Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
2010-10-25 10:10:58 -07:00
Brian Paul
af03c14d4c translate: remove unused prototypes 2010-10-25 10:34:44 -06:00
Brian Paul
81d5afbbec translate: use function typedefs, casts to silence warnings 2010-10-25 10:31:56 -06:00
Marek Olšák
64276cffcb st/mesa: support RGBA16 and use it for RGBA12 as well
Tested with r300g.

Signed-off-by: Marek Olšák <maraeo@gmail.com>
2010-10-25 18:21:12 +02:00
Brian Paul
1686db70d6 rtasm: use pointer_to_func() to silence warning 2010-10-25 09:18:07 -06:00
Brian Paul
e1e7843d03 util: use pointer_to_func() to silence warning 2010-10-25 09:17:40 -06:00
Brian Paul
da580dbbe8 xlib: silence unused var warning 2010-10-25 09:17:09 -06:00
Brian Paul
2701eb342b mesa: fix uninitialized var warning
http://bugs.freedesktop.org/show_bug.cgi?id=31067
2010-10-25 09:11:26 -06:00
Brian Paul
f72e4b306b mesa: silence enum comparison warning
http://bugs.freedesktop.org/show_bug.cgi?id=31069
2010-10-25 09:10:36 -06:00
Marek Olšák
8449a4772a r300g: fix texture border for 16-bits-per-channel formats
This is kinda hacky, but it's hard to come up with a generic solution for
all formats when only a few are used in practice (I mostly get B8G8R8*8).
2010-10-24 23:43:13 +02:00
Marek Olšák
6e61853590 mesa: allow FBO attachments of formats LUMINANCE, LUMINANCE_ALPHA, and INTENSITY
As per the GL_ARB_framebuffer_object specification.

Signed-off-by: Marek Olšák <maraeo@gmail.com>
2010-10-24 23:14:01 +02:00
Jon TURNEY
70f60c9c89 Ensure -L$(TOP)/$(LIB_DIR) appears in link line before any -L in $LDFLAGS
Ensure -L$(TOP)/$(LIB_DIR) (the staging dir for build products), appears
in the link line before any -L in $LDFLAGS, so that we link driver we are
building with libEGL we have just built, and not an installed version

[olv: make a similar change to targets/egl]

Signed-off-by: Jon TURNEY <jon.turney@dronecode.org.uk>
2010-10-24 23:13:49 +08:00
Dave Airlie
a20c2347a0 r600g: drop more common state handling code 2010-10-24 13:04:44 +10:00
Tilman Sauerbeck
f4a2c62af5 r600g: Also clear bc data when we're destroying a shader.
[airlied: remove unused vars]

Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-10-24 12:56:35 +10:00
Tilman Sauerbeck
ccb9be1056 r600g: Added r600_pipe_shader_destroy().
Not yet complete.

Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-10-24 12:55:18 +10:00
Dave Airlie
9612b482e2 r600g: merge more of the common r600/evergreen state handling 2010-10-24 12:53:50 +10:00
Tilman Sauerbeck
9f9d24c89a r600g: Fixed r600_vertex_element leak.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-10-24 12:44:56 +10:00
Brian Paul
d8740b77ac softpipe: remove >32bpp color restriction
The comment was out of date.  The tile cache does handle >32-bit colors.
2010-10-23 10:27:21 -06:00
Brian Paul
e6ac8d5353 st/mesa: be smarter choosing texture format for glDrawPixels()
This lets us get an integer texture format for integer pixel formats.
2010-10-23 10:23:08 -06:00
Brian Paul
efd9e24312 mesa: display list support for GL_EXT_texture_integer 2010-10-23 10:19:31 -06:00
Brian Paul
98bb70ac84 mesa: plug in GL_EXT_texture_integer functions 2010-10-23 10:19:31 -06:00
Brian Paul
01e13a7d75 mesa: regenerated API files for GL_EXT_texture_integer 2010-10-23 10:19:31 -06:00
Brian Paul
fd6f17c21a glapi: include/build EXT_texture_integer.xml 2010-10-23 10:19:31 -06:00
Brian Paul
9d73c4a9d5 glapi: GL_EXT_texture_integer API 2010-10-23 10:19:31 -06:00
Brian Paul
646afcc340 mesa: simplify target_can_be_compressed() function 2010-10-23 10:19:31 -06:00
Brian Paul
77ca2044a0 st/mesa: add format selection for signed/unsigned integer formats 2010-10-23 10:19:30 -06:00
Brian Paul
d72bf5e79d mesa: added cases for GL_EXT_texture_integer 2010-10-23 10:19:30 -06:00
Brian Paul
7a60512f84 mesa: added cases for GL_EXT_texture_integer formats 2010-10-23 10:19:30 -06:00
Brian Paul
c7d18374dd mesa: compute _IntegerColor field in _mesa_test_framebuffer_completeness() 2010-10-23 10:19:30 -06:00
Brian Paul
9968a3960f mesa: added glGet query for GL_RGBA_INTEGER_MODE_EXT 2010-10-23 10:19:30 -06:00
Brian Paul
f681ea4741 mesa: added new gl_framebuffer::_IntegerColor field 2010-10-23 10:19:30 -06:00
Brian Paul
9ee07a0a27 mesa: added new gl_extensions::EXT_gpu_shader4 field 2010-10-23 10:19:30 -06:00
Brian Paul
4250882ccf softpipe: added some texture sample debug code (disabled) 2010-10-23 10:19:30 -06:00
Brian Paul
2502ee6738 mesa: new glDrawPixels error check for integer formats 2010-10-23 10:19:30 -06:00
Brian Paul
013d5ffeec mesa: added _mesa_is_fragment_shader_active() helper 2010-10-23 10:19:30 -06:00
Brian Paul
f1e97dc264 mesa: minor reformatting, clean-ups 2010-10-23 10:19:30 -06:00
Brian Paul
f5ed39e7e6 mesa: _mesa_is_format_integer() function 2010-10-23 10:19:29 -06:00
Brian Paul
a0bc8eeb32 mesa: _mesa_ClearColorIuiEXT() and _mesa_ClearColorIiEXT()
For GL_EXT_texture_integer.
2010-10-23 10:19:29 -06:00
Brian Paul
f6dbb693d2 mesa: add pixel packing for unscaled integer types
And add some missing GL_RG cases.
2010-10-23 10:19:29 -06:00
Brian Paul
1c131752c3 mesa: split up the image.c file
New files:
pack.c - image/row packing/unpacking functions
pixeltransfer.c - pixel scale/bias/lookup functions
2010-10-23 10:19:29 -06:00
Brian Paul
e67f6ee96e mesa: simplify fbo format checking code 2010-10-23 10:19:29 -06:00
Brian Paul
f9288540ec mesa: 80-column wrapping 2010-10-23 10:19:29 -06:00
Brian Paul
b4c013307b docs: updated GL3 status for primitive restart 2010-10-23 10:19:29 -06:00
Chia-I Wu
6c13fdf60e st/egl: Use resource reference count for egl_g3d_sync. 2010-10-23 17:28:56 +08:00
Chia-I Wu
0d43cbed2f egl: Fix a false negative check in _eglCheckMakeCurrent.
This call sequence

  eglMakeCurrent(dpy, surf, surf, ctx1);
  eglMakeCurrent(dpy, surf, surf, ctx2);

should be valid if ctx1 and ctx2 have the same client API and are not
current in another thread.
2010-10-23 16:58:38 +08:00
Chia-I Wu
d19afc57fe egl: Use reference counting to replace IsLinked or IsBound.
Remove all _egl<Res>IsLinked and _egl<Res>IsBound.  Update
_eglBindContext and drivers to do reference counting.
2010-10-23 15:26:28 +08:00
Chia-I Wu
dc4f845c37 egl: Add reference count for resources.
This is a really simple mechanism.  There is no atomicity and the caller
is expected to hold the display lock.
2010-10-23 15:19:34 +08:00
Chia-I Wu
662e098b56 st/egl: Fix native_mode refresh mode.
Define the unit to match _EGLMode's.
2010-10-23 11:32:06 +08:00
Chia-I Wu
e32ac5b8a9 egl: Fix _eglModeLookup.
Internally a mode belongs to a screen.  But functions like
eglGetModeAttribMESA treat a mode as a display resource: a mode can be
looked up without a screen.  Considering how KMS works, it is better to
stick to the current implementation.

To properly support looking up a mode without a screen, this commit
assigns each mode (of all screens) a unique ID.
2010-10-23 11:20:41 +08:00
Chia-I Wu
37213ceacc egl: Minor changes to the _EGLScreen interface.
Make _eglInitScreen take a display and rename _eglAddScreen to
_eglLinkScreen.  Remove unused functions.
2010-10-23 11:20:41 +08:00
Chia-I Wu
8a6bdf3979 egl: Minor changes to the _EGLConfig interface.
Mainly to rename _eglAddConfig to _eglLinkConfig, along with a few clean
ups.
2010-10-23 11:20:40 +08:00
Chia-I Wu
4ce33ec606 egl: Drop dpy argument from the link functions.
All display resources are already initialized with a display.  Linking
simply links a resource to its display.
2010-10-23 11:20:40 +08:00
Eric Anholt
07cd8f46ac i965: Add support for pull constants to the new FS backend.
Fixes glsl-fs-uniform-array-5, but not 6 which fails in ir_to_mesa.
2010-10-22 14:53:21 -07:00
Eric Anholt
ff622d5528 i965: Move the FS disasm/annotation printout to codegen time.
This makes it a lot easier to track down where we failed when some
code emit triggers an assert.  Plus, less memory allocation for
codegen.
2010-10-22 14:53:21 -07:00
Dave Airlie
39c742fe2a r600g: not fatal if we can't get tiling info from kernel 2010-10-23 07:45:59 +10:00
Marek Olšák
469907d597 r300g: say no to PIPE_CAP_STREAM_OUTPUT and PIPE_CAP_PRIMITIVE_RESTART 2010-10-22 20:34:28 +02:00
Marek Olšák
1d96ad67bc r300g: do not print get_param errors in non-debug build 2010-10-22 20:34:27 +02:00
Keith Whitwell
a1ca5ac7c2 llvmpipe: turn off draw offset/twoside when we can handle it 2010-10-22 18:58:36 +01:00
Brian Paul
dd2499b484 mesa: move declaration before code 2010-10-22 08:59:06 -06:00
Brian Paul
67f6a4a8c4 galahad: silence warnings 2010-10-22 08:58:35 -06:00
Francisco Jerez
a00eec5295 dri/nouveau: Force a "slow" Z clear if we're getting a new depth buffer. 2010-10-22 13:43:57 +02:00
Chia-I Wu
25328509c9 egl: Move fallback routines to eglfallbacks.c.
We do not want them to be all over the places.
2010-10-22 18:38:30 +08:00
Chia-I Wu
5664a98386 egl: Parse image attributes with _eglParseImageAttribList.
Avoid code duplications.
2010-10-22 18:35:09 +08:00
Chia-I Wu
713c8734f4 egl: Move attributes in _EGLImage to _EGLImageAttribs.
The opaque nature of EGLImage implies that extensions almost always
define their own attributes.  Move attributes in _EGLImage to
_EGLImageAttribs and add a helper function to parse attribute lists.
2010-10-22 17:15:45 +08:00
Chia-I Wu
ecca5571b6 egl_glx: Fix borken driver.
The driver was broken since 6eda3f311b.
All configs fail to pass _eglValidateConfig.
2010-10-22 16:26:25 +08:00
Chia-I Wu
0ed96efc1b egl_glx: Drop the use of [SG]ET_CONFIG_ATTRIB.
_EGLConfig can be directly dereferenced now.  Since egl_glx is the last
user of the macros, drop the macros too.
2010-10-22 16:26:25 +08:00
Chia-I Wu
b67f7295b7 egl_dri2: Drop the use of _egl[SG]etConfigKey.
_EGLConfig can be directly dereferenced now.
2010-10-22 16:26:25 +08:00
Brian Paul
aa86c7657c winsys/xlib: rename xm->xlib
Move away from the old Mesa-oriented names.
2010-10-21 19:55:03 -06:00
Brian Paul
3bc6fe371c winsys/xlib: fix up allocation/dealloction of XImage
Fixes a crash upon exit when using remote display.
2010-10-21 19:49:34 -06:00
Brian Paul
4d24f01cb3 winsys/xlib: use Bool type for shm field 2010-10-21 19:37:11 -06:00
Brian Paul
e3298eaf52 winsys/xlib: formatting fixes 2010-10-21 19:17:44 -06:00
Brian Paul
69a07be3e5 Merge branch 'primitive-restart-cleanup'
Conflicts:
	docs/relnotes-7.10.html

This branch is a re-do of the primitive-restart branch with all
the intermediate/temporary stuff cleaned out.
2010-10-21 19:05:47 -06:00
Brian Paul
b2d4dfe5cc docs: added GL_NV_primitive_restart extension 2010-10-21 19:03:39 -06:00
Brian Paul
6692ed6f03 llvmpipe: enable primitive restart 2010-10-21 19:03:38 -06:00
Brian Paul
27d3bab055 softpipe: enable primitive restart 2010-10-21 19:03:38 -06:00
Brian Paul
0eaaceb218 draw: implement primitive splitting for primitive restart 2010-10-21 19:03:38 -06:00
Brian Paul
053875a8b1 st/mesa: support for primitive restart 2010-10-21 19:03:38 -06:00
Brian Paul
adf35e80d3 gallium: new CAP, state for primitive restart 2010-10-21 19:03:38 -06:00
Brian Paul
be45255ab1 vbo: support for primitive restart
We handle splitting of glDrawArrays() calls into two primitives here
so that drivers don't have to worry about it.
2010-10-21 19:03:38 -06:00
Brian Paul
b3de6e703d mesa: plug in primitive restart function 2010-10-21 19:03:38 -06:00
Brian Paul
4f495ec20e mesa: regenerated files with primitive restart 2010-10-21 19:03:38 -06:00
Brian Paul
1cae8b5448 mesa: API spec for primitive restart 2010-10-21 19:03:38 -06:00
Brian Paul
7f26ad80ba mesa: set/get primitive restart state 2010-10-21 19:03:38 -06:00
Brian Paul
a80afbd99e mesa: driver hook for primitive restart 2010-10-21 19:03:38 -06:00
Eric Anholt
1d91f8d916 i965: Be more aggressive in tracking live/dead intervals within loops.
Fixes glsl-fs-convolution-2, which was blowing up due to the array
access insanity getting at the uniform values within the loop.  Each
temporary was considered live across the whole loop.
2010-10-21 16:55:26 -07:00
Brian Paul
13cd611f56 docs: add GL_ARB_texture_rg to release notes 2010-10-21 17:05:36 -06:00
Brian Paul
9ad4589e7e docs: update texture red/green support in GL3.txt 2010-10-21 17:05:35 -06:00
Brian Paul
b66a92de8c st/mesa: added cases for GL_COMPRESSED_RED/RG in st_choose_format() 2010-10-21 17:05:35 -06:00
Brian Paul
d4a296caaa mesa: add missing cases for packing red/green images 2010-10-21 17:05:35 -06:00
Brian Paul
d4c1bcce44 mesa: add GL_RG case to _mesa_source_buffer_exists()
Fixes failure with glReadPixels(format=GL_RG)
2010-10-21 17:05:35 -06:00
Brian Paul
154d91cad9 draw: fix typo in comment 2010-10-21 17:05:35 -06:00
Eric Anholt
4e72525109 i965: Correct scratch space allocation.
One, it was allocating increments of 1kb, but per thread scratch space
is a power of two.  Two, the new FS wasn't getting total_scratch set
at all, so everyone thought they had 1kb and writes beyond 1kb would
go stomping on a neighbor thread.

With this plus the previous register spilling for the new FS,
glsl-fs-convolution-1 passes.
2010-10-21 15:21:28 -07:00
Eric Anholt
0b77d57394 i965: Don't emit register spill offsets directly into g0.
g0 is used by others, and is expected to be left exactly as it was
dispatched to us.  So manually move g0 into our message reg when
spilling/unspilling and update the offset in the MRF.  Fixes failures
in texture sampling after having spilled a register.
2010-10-21 15:21:28 -07:00
Eric Anholt
99b2c8570e i965: Add support for register spilling.
It can be tested with if (0) replaced with if (1) to force spilling for all
virtual GRFs.  Some simple tests work, but large texturing tests fail.
2010-10-21 15:21:01 -07:00
Eric Anholt
7a3f113e79 i965: Fix gl_FrontFacing emit on pre-gen6.
It's amazing this code worked.  Basically, we would get lucky in
register allocation and the tests using frontfacing would happen to
allocate gl_FrontFacing storage and the instructions generating
gl_FrontFacing but pointing at another register to the same hardware
register.  Noticed during register spilling debug, when suddenly they
didn't get allocatd the same storage.
2010-10-21 15:20:01 -07:00
Eric Anholt
5ac6c4ecfe i965: Split register allocation out of the ever-growing brw_fs.cpp. 2010-10-21 15:20:01 -07:00
Kenneth Graunke
3f5fde5c45 Refresh autogenerated file builtin_function.cpp.
Since this is just generated by python, it's questionable whether this
should continue to live in the repository - Mesa already has other
things generated from python as part of the build process.
2010-10-21 11:46:08 -07:00
Kenneth Graunke
2cacaf6e7b generate_builtins.py: Output large strings as arrays of characters.
This works around MSVC's 65535 byte limit, unfortunately at the expense
of any semblance of readability and much larger file size.  Hopefully I
can implement a better solution later, but for now this fixes the build.
2010-10-21 11:45:38 -07:00
Vinson Lee
50095ac87c gallivm: Silence uninitialized variable warning.
Fixes this GCC warning.
gallivm/lp_bld_tgsi_aos.c: In function 'lp_build_tgsi_aos':
gallivm/lp_bld_tgsi_aos.c:516: warning: 'dst0' may be used uninitialized in this function
gallivm/lp_bld_tgsi_aos.c:516: note: 'dst0' was declared here
2010-10-21 11:27:35 -07:00
Vinson Lee
fc59790b87 gallivm: Silence uninitialized variable warnings.
Fixes these GCC warnings.
gallivm/lp_bld_sample_aos.c: In function 'lp_build_sample_image_nearest':
gallivm/lp_bld_sample_aos.c:271: warning: 't_ipart' may be used uninitialized in this function
gallivm/lp_bld_sample_aos.c:271: warning: 'r_ipart' may be used uninitialized in this function
2010-10-21 11:21:03 -07:00
Vinson Lee
0a5666148b gallivm: Silence uninitialized variable warnings.
Fixes these GCC warnings.
gallivm/lp_bld_sample_aos.c: In function 'lp_build_sample_image_linear':
gallivm/lp_bld_sample_aos.c:439: warning: 'r_ipart' may be used uninitialized in this function
gallivm/lp_bld_sample_aos.c:438: warning: 't_ipart' may be used uninitialized in this function
gallivm/lp_bld_sample_aos.c:438: warning: 't_fpart' may be used uninitialized in this function
gallivm/lp_bld_sample_aos.c:439: warning: 'r_fpart' may be used uninitialized in this function
gallivm/lp_bld_sample_aos.c:438: warning: 't_fpart_hi' may be used uninitialized in this function
gallivm/lp_bld_sample_aos.c:438: warning: 't_fpart_lo' may be used uninitialized in this function
gallivm/lp_bld_sample_aos.c:439: warning: 'r_fpart_hi' may be used uninitialized in this function
gallivm/lp_bld_sample_aos.c:439: warning: 'r_fpart_lo' may be used uninitialized in this function
2010-10-21 11:10:15 -07:00
Chia-I Wu
16333e1fc4 mesa: Remove unused vtxfmt_tmp.h.
It was used by the "neutral" tnl module that was dropped in
81ccb3e2ce.
2010-10-21 22:03:34 +08:00
Dave Airlie
f39e6c9c81 r600g: start splitting out common code from eg/r600.
no point duplicating code that doesn't touch hw, also make it easier
to spot mistakes
2010-10-21 19:58:09 +10:00
Dave Airlie
e68c83a5a0 r600g: initial translate state support 2010-10-21 19:58:08 +10:00
Vinson Lee
3a54195679 draw: Remove unnecessary header. 2010-10-21 01:47:52 -07:00
Vinson Lee
abc5435f22 llvmpipe: Remove unnecessary header. 2010-10-21 01:44:48 -07:00
Kenneth Graunke
cc04347b8d glsl: Refresh autogenerated file builtin_function.cpp. 2010-10-21 00:14:38 -07:00
Kenneth Graunke
574c53f551 glsl: Add support for GLSL 1.30's modf built-in. 2010-10-21 00:14:37 -07:00
Kenneth Graunke
94a36faed7 glcpp: Refresh autogenerated lexer file. 2010-10-21 00:13:33 -07:00
Kenneth Graunke
bd55ba568b glcpp: Return NEWLINE token for newlines inside multi-line comments.
This is necessary for the main compiler to get correct line numbers.
2010-10-21 00:13:33 -07:00
Dave Airlie
089aa0ba24 r600g: add texture tiling enable under a debug option.
At the moment you need kernel patches to have texture tiling work
with the kernel CS checker, so once they are upstream and the drm version
is bumped we can make this enable flip the other way most likely.
2010-10-21 13:40:45 +10:00
Dave Airlie
cdd14668b6 r600g: add texture tiling alignment support.
this sets things up to align stride/height with tile sizes,
it also adds support for the 2D/1D array mode cross over point.
2010-10-21 13:37:54 +10:00
Dave Airlie
92ed84d115 r600g: introduce a per-driver resource flag for transfers.
this is to be used to decide not to tile a surface being used for transfers.
2010-10-21 13:36:01 +10:00
Dave Airlie
91e513044d r600g: add r600 surface to store the aligned height.
we need to know the aligned height when binding the surface to cb/zb,
not the gallium surface height.
2010-10-21 13:33:00 +10:00
Dave Airlie
388ce31baa r600g: start adding hooks for aligning width/height for tiles. 2010-10-21 13:32:08 +10:00
Dave Airlie
ea5aab85fd r600g: move to per-miplevel array mode.
Since the hw transitions from 2D->1D sampling below the 2D macrotile
size we need to keep track of the array mode per level so we can
render to it using the CB.
2010-10-21 13:32:08 +10:00
Dave Airlie
206fbd9640 r600g: all non-0 mipmap levels need to be w/h aligned to POT.
this adds a new minify function to the driver to ensure this.
2010-10-21 13:20:14 +10:00
Vinson Lee
2e5764ccf4 swrast: Print out format on unexpected failure in _swrast_DrawPixels. 2010-10-20 15:27:48 -07:00
Kenneth Graunke
b970da4d24 mesa: Remove FEATURE_ARB_shading_language_120 macro.
Everything should be able to support 1.20 at this point.
2010-10-20 15:07:47 -07:00
Kenneth Graunke
a75da2c0e8 glsl: Remove useless ir_shader enumeration value. 2010-10-20 15:07:47 -07:00
Vinson Lee
460da0db4a glsl: Add assert for unhandled ir_shader case.
Silences this GCC warning.
ast_to_hir.cpp: In function 'void apply_type_qualifier_to_variable(const
ast_type_qualifier*, ir_variable*, _mesa_glsl_parse_state*, YYLTYPE*)'
ast_to_hir.cpp:1768: warning: enumeration value 'ir_shader' not handled
in switch
2010-10-20 14:10:26 -07:00
Brian Paul
c492066071 draw: use float version of LLVM Mul/Add instructions
LLVM 2.8 is pickier about int vs float instructions and operands.
2010-10-20 14:56:42 -06:00
Brian Paul
f36346c116 llvmpipe/draw: always enable LLVMAddInstructionCombiningPass()
We were working around an LLVM 2.5 bug but we're using LLVM 2.6 or later now.
This basically reverts commit baddcbc522.
This fixes the piglit bug/tri-tex-crash.c failure.
2010-10-20 14:49:07 -06:00
Orion Poplawski
5a3ac74ad5 osmesa: link against libtalloc
Otherwise consumers have to, and that's lame.

Signed-off-by: Adam Jackson <ajax@redhat.com>
2010-10-20 15:54:57 -04:00
Vinson Lee
89c26866f0 r600g: Ensure r600_src is initialized in tgsi_exp function.
Silences these GCC warnings.
r600_shader.c: In function 'tgsi_exp':
r600_shader.c:2339: warning: 'r600_src[0].rel' is used uninitialized in this function
r600_shader.c:2339: warning: 'r600_src[0].abs' is used uninitialized in this function
r600_shader.c:2339: warning: 'r600_src[0].neg' is used uninitialized in this function
r600_shader.c:2339: warning: 'r600_src[0].chan' is used uninitialized in this function
r600_shader.c:2339: warning: 'r600_src[0].sel' is used uninitialized in this function
2010-10-20 12:44:08 -07:00
Vinson Lee
289900439f draw: Move loop variable declaration outside for loop.
Fixes MSVC build.
2010-10-19 23:48:59 -07:00
Keith Whitwell
05921fd4e5 draw: make sure viewport gets updated in draw llvm shader
The viewport state was being baked in at compile time (oops...)
2010-10-19 22:11:49 -07:00
Keith Whitwell
cd6a31cd4a Merge branch 'llvm-cliptest-viewport' 2010-10-19 21:41:28 -07:00
Hui Qi Tay
ab2e1edd1f draw: corrections to allow for different cliptest cases 2010-10-19 21:34:42 -07:00
Eric Anholt
ae5698e604 i965: Use the new style of IF statement with embedded comparison on gen6.
"Everyone else" does it this way, so follow suit.  It's fewer
instructions, anyway.
2010-10-19 21:17:55 -07:00
Eric Anholt
6ea108e7db i965: Set the source operand types for gen6 if/else/endif to integer.
I don't think this should matter, but I'm not sure, and it's
recommended by a kernel checker in fulsim.
2010-10-19 21:17:55 -07:00
Eric Anholt
d0c87b90a8 i965: Add EU emit support for gen6's new IF instruction with comparison. 2010-10-19 21:17:55 -07:00
Ian Romanick
cc90e62d70 linker: Improve handling of unread/unwritten shader inputs/outputs
Previously some shader input or outputs that hadn't received location
assignments could slip through.  This could happen when a shader
contained user-defined varyings and was used with either
fixed-function or assembly shaders.

See the piglit tests glsl-[fv]s-user-varying-ff and
sso-user-varying-0[12].

NOTE: this is a candidate for the 7.9 branch.
2010-10-19 18:12:32 -07:00
Chad Versace
974fb466f2 glsl: Commit generated file glsl_lexer.cpp
Changes are due to commit "glsl: Fix lexer rule for ^=".
2010-10-19 13:17:33 -07:00
Chad Versace
cba9062d58 glsl: Fix lexer rule for ^=
The caret is a special character, and needs to be quoted or escaped.
2010-10-19 13:17:33 -07:00
Chad Versace
d03ac0f8d8 glsl: Implement ast-to-hir for bit-logic ops
Implement by adding to ast_expression::hir() the following cases:
    - ast_and_assign
    - ast_or_assign
    - ast_xor_assign
2010-10-19 13:17:33 -07:00
Chad Versace
cfdbf8bc84 glsl: Define bit_logic_result_type() in ast_to_hir.cpp
This function type checks the operands of and returns the result type of
bit-logic operations.  It replaces the type checking performed in the
following cases of ast_expression::hir() :
    - ast_bit_and
    - ast_bit_or
    - ast_bit_xor
2010-10-19 13:17:33 -07:00
Chad Versace
338ed6ec29 glsl: Implement ast-to-hir for bit-shift-assignment
Implement by adding to ast_expression::hir() these cases:
    - ast_ls_assign
    - ast_rs_assign
2010-10-19 13:17:33 -07:00
Chad Versace
c0197ab0af glsl: Define shift_result_type() in ast_to_hir.cpp
This function type checks the operands of and returns the result type of
bit-shift operations. It replaces the type checking performed in the following
cases of ast_expression::hir() :
    - ast_lshift
    - ast_rshift
2010-10-19 13:17:33 -07:00
Eric Anholt
f30de69640 i965: Disable thread dispatch when the FS doesn't do any work.
This should reduce the cost of generating shadow maps, for example.
No performance difference measured in nexuiz, though it does trigger
this path.
2010-10-19 10:49:20 -07:00
Eric Anholt
2595589f1d i965: Remove the gen6 emit_mi_flushes I sprinkled around the driver.
These were for debugging in bringup.  Now that relatively complicated
apps are working, they haven't helped debug anything in quite a while.
2010-10-19 10:49:19 -07:00
Eric Anholt
32573792de i965: Tell the shader compiler when we expect depth writes for gen6.
This fixes hangs in some Z-writes-in-shaders tests, though other
pieces don't come out correctly.

Bug #30392: hang in fbo-fblit-d24s8. (still fails with bad color drawn
to some targets)
2010-10-19 10:48:56 -07:00
Vinson Lee
36dde032a4 llvmpipe: Initialize variable. 2010-10-19 10:14:11 -07:00
Vinson Lee
22725eb3e8 llvmpipe: Initialize state variable in debug_bin function. 2010-10-19 10:02:28 -07:00
Vinson Lee
a143b6d5d8 st/xorg: Fix memory leak on error path. 2010-10-19 09:49:15 -07:00
Brian Paul
ec2824cd86 gallivm: fix incorrect type for zero vector in emit_kilp()
http://bugs.freedesktop.org/show_bug.cgi?id=30974
2010-10-19 09:14:19 -06:00
Brian Paul
988b246c47 mesa: fix mesa version string construction
Now that MESA_MINOR=10, we no longer need the extra '0' in the
version string.
2010-10-19 08:59:27 -06:00
Thomas Hellstrom
f82d984352 mesa: Make sure we have the talloc cflags when using the talloc headers
Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-10-19 14:18:20 +02:00
Thomas Hellstrom
9e96b695b0 st/xorg: Fix compilation for Xservers >= 1.10
Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-10-19 12:08:06 +02:00
Thomas Hellstrom
543136d5bd xorg/vmwgfx: Don't use deprecated x*alloc / xfree functions
Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-10-19 11:28:24 +02:00
Thomas Hellstrom
2ab7a8a3eb st/xorg: Don't use deprecated x*alloc / xfree functions
Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-10-19 11:28:18 +02:00
Thomas Hellstrom
0301c9ac62 st/xorg: Fix compilation errors for Xservers compiled without Composite
Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-10-19 11:28:08 +02:00
Thomas Hellstrom
0d0a6e9096 st/xorg, xorg/vmwgfx: Be a bit more frendly towards cross-compiling environments
Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-10-19 11:27:54 +02:00
Vinson Lee
f36a642030 r300/compiler: Remove unused variable. 2010-10-19 00:07:22 -07:00
Tom Stellard
f822cc22f2 r300g: Add new debug option for logging vertex/fragment program stats 2010-10-18 20:51:05 -07:00
Tom Stellard
9d2ab6cb00 r300/compiler: Add a new function for more efficient dataflow analysis
rc_get_readers_normal() supplies a list of readers for a given
instruction.  This function is now being used by the copy propagate
optimization and will eventually be used by most other optimization
passes as well.
2010-10-18 20:51:05 -07:00
Tom Stellard
3cdff41d92 r300/compiler: Clear empty registers after constant folding 2010-10-18 20:51:05 -07:00
Tom Stellard
75734d0a37 r300/compiler: Fix incorrect assumption
It is possible for a single pair instruction arg to select from both an
RGB and an Alpha source.
2010-10-18 20:51:05 -07:00
Tom Stellard
ad683577b2 r300/compiler: Create a helper function for merging presubtract sources 2010-10-18 20:51:05 -07:00
Kenneth Graunke
80c9f756b2 i965: Remove unused variable. 2010-10-18 18:44:19 -07:00
Kenneth Graunke
9c80fa824c glsl: Regenerate parser files. 2010-10-18 17:40:09 -07:00
Kenneth Graunke
0eb0b44647 glsl: Fix copy and paste error in ast_bit_and node creation.
All & operations were incorrectly being generated as ast_bit_or.
2010-10-18 17:40:09 -07:00
Eric Anholt
4af2937416 i965: Avoid blits in BufferCopySubdata on gen6.
Fixes glean/bufferObject.
2010-10-18 14:14:06 -07:00
Eric Anholt
641028debf i965: Fix scissor-offscreen on gen6 like we did pre-gen6. 2010-10-18 13:11:29 -07:00
Eric Anholt
022531209d i965: Assert out on gen6 VS constant buffer reads that hang the GPU for now. 2010-10-18 12:56:44 -07:00
Eric Anholt
66800a04e5 i965: Fix assertion failure on gen6 BufferSubData to busy BO.
Fixes fbo-blit and probably several other tests.
2010-10-18 12:56:44 -07:00
Eric Anholt
746e68c50b i965: Fix a weirdness in NOT handling.
XOR makes much more sense.  Note that the previous code would have
failed for not(not(x)), but that gets optimized out.
2010-10-18 12:56:44 -07:00
Eric Anholt
ea213417f1 i965: Disable the debug printf I added for FS disasm. 2010-10-18 12:56:44 -07:00
Kenneth Graunke
65d4234c23 i965: Add missing "break" statement.
Otherwise, it would try to handle arrays as structures, use
uninitialized memory, and crash.
2010-10-18 12:21:20 -07:00
José Fonseca
f37b114dc3 llvmpipe: Don't test rounding of x.5 numbers.
SSE4.1 has different rules, and so far this doesn't seem to cause any
problems with conformance test suites.
2010-10-18 09:35:21 -07:00
José Fonseca
ac17c62ece gallivm: Add a note about SSE4.1's nearest mode rounding. 2010-10-18 09:32:35 -07:00
Brian Rogers
746b602fbd mesa: Add missing else in do_row_3D
This fixes erroneous "bad format in do_row()" messages

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-10-18 08:11:04 -06:00
Brian Paul
01e0aaefcc llvmpipe: remove lp_setup_coef*.c files from Makefile 2010-10-18 07:59:02 -06:00
Victor Tseng
e19187e1be egl/i965: include inline_wrapper_sw_helper.h
Signed-off-by: Brian Paul <brianp@vmware.com>
2010-10-18 07:55:52 -06:00
Kenneth Graunke
b8276e46f5 glsl: Don't return NULL IR for erroneous bit-shift operators.
Existing code relies on IR being generated (possibly with error type)
rather than returning NULL.  So, don't break - go ahead and generate the
operation.  As long as an error is flagged, things will work out.

Fixes fd.o bug #30914.
2010-10-18 00:26:14 -07:00
Dave Airlie
8a74f7422b r600g: retrieve tiling info from kernel for shared buffers.
we need to know if the back is tiled so we can blit from it properly.
2010-10-18 13:46:42 +10:00
Dave Airlie
375613afe3 r600g: fix transfer function for tiling.
this makes readback with tiled back work better.
2010-10-18 13:46:42 +10:00
Dave Airlie
c61b97d504 r600g: attempt to cleanup depth blit
cleanup what I'm nearly sure is unnecessary work in the depth blit code.
2010-10-18 13:46:25 +10:00
Dave Airlie
21c6459dfb r600g: depth needs to bound to ds 2010-10-18 13:39:55 +10:00
Dave Airlie
69f8eebe72 r600g: fix typo in tiling setup cb code. 2010-10-18 13:39:55 +10:00
Dave Airlie
a1b7333c07 r600g: do proper tracking of views/samplers.
we need to do pretty much what r300g does in for this, this fixes some
issues seen while working on tiling.
2010-10-18 13:39:54 +10:00
Keith Whitwell
9da17fed2e llvmpipe: remove unused arg from jit_setup_tri function 2010-10-17 19:23:40 -07:00
Keith Whitwell
75799b8d02 llvmpipe: remove unused file 2010-10-17 19:11:47 -07:00
Keith Whitwell
0072acd447 Merge remote branch 'origin/master' into lp-setup-llvm
Conflicts:
	src/gallium/drivers/llvmpipe/lp_setup_coef.c
	src/gallium/drivers/llvmpipe/lp_setup_coef.h
	src/gallium/drivers/llvmpipe/lp_setup_coef_intrin.c
	src/gallium/drivers/llvmpipe/lp_setup_point.c
	src/gallium/drivers/llvmpipe/lp_setup_tri.c
	src/gallium/drivers/llvmpipe/lp_state_derived.c
	src/gallium/drivers/llvmpipe/lp_state_fs.h
2010-10-17 19:09:42 -07:00
Keith Whitwell
ca2b2ac131 llvmpipe: fail cleanly on malloc failure in lp_setup_alloc_triangle 2010-10-17 18:48:11 -07:00
Keith Whitwell
543fb77dde llvmpipe: remove setup fallback path 2010-10-17 18:29:28 -07:00
José Fonseca
4dfb43c6a6 gallivm: Comment lp_build_insert_new_block(). 2010-10-17 18:23:18 -07:00
Keith Whitwell
b5236f3da4 llvmpipe: clean up fields in draw_llvm_variant_key 2010-10-17 17:53:29 -07:00
Dave Airlie
5b966f58e3 r600g: set tiling bits in hw state 2010-10-18 09:25:22 +10:00
Dave Airlie
7b3fa03883 r600g: get tiling info from kernel 2010-10-18 09:25:22 +10:00
Dave Airlie
e8e20313af r600g: add defines for tiling 2010-10-18 09:25:22 +10:00
Dave Airlie
82114ac02a r600g: switch to a common formats.h file since they are in different regs 2010-10-18 09:13:46 +10:00
Vinson Lee
c9d297162a llvmpipe: Return non-zero exit code for lp_test_round failures. 2010-10-17 14:09:53 -07:00
Hui Qi Tay
c1d6b31866 draw: corrections for w coordinate 2010-10-17 10:57:43 -07:00
José Fonseca
4afad7d3ed llvmpipe: Initialize bld ctx via lp_build_context_init instead of ad-hoc and broken code. 2010-10-17 10:15:15 -07:00
José Fonseca
a0add0446c llvmpipe: Fix bad refactoring.
'i' and 'chan' have random values here, which could cause a buffer
overflow in debug builds, if chan > 4.
2010-10-17 09:58:04 -07:00
José Fonseca
dc5bdbe0f9 gallivm: Fix SoA cubemap derivative computation.
Derivatives are now scalar.

Broken since 17dbd41cf2.
2010-10-17 09:43:18 -07:00
José Fonseca
709699d2e2 llvmpipe: Ensure z_shift and z_width is initialized. 2010-10-17 07:45:08 -07:00
José Fonseca
914b0d34e8 llvmpipe: Fix depth-stencil regression.
If stencil is enabled then we need to load the z_dst, even if depth
testing is disabled.

This fixes reflect mesa demo.
2010-10-17 07:22:34 -07:00
Dave Airlie
98b3f27439 r600g: add evergreen ARL support.
Thanks to Alex Deucher for pointing out the FLT to int conversion is necessary
and writing an initial patch, this brings about 20 piglits, and I think this
is the last piece to make evergreen and r600 equal in terms of features.
2010-10-17 16:48:30 +10:00
Brian Paul
46c2ee4fad gallivm: use util_snprintf() 2010-10-15 17:32:23 -06:00
Brian Paul
81c27dbfb9 st/mesa: update function name, comments 2010-10-15 17:24:43 -06:00
Brian Paul
fa5309f0b0 st/mesa: use GLuint to avoid problem w/ uint not defined on mingw32 2010-10-15 17:18:39 -06:00
Brian Paul
cba65f7e0e st/mesa: reformatting in st_cb_drawpixels.c 2010-10-15 17:01:56 -06:00
Brian Paul
61a467e515 st/mesa: fix regressions in glDrawPixels(GL_STENCIL_INDEX)
We need to keep track of three different fragment shaders: Z-only, stencil-
only, and Z+stencil.  Before, we were only keeping track of the first one
we encountered.
2010-10-15 16:54:03 -06:00
Brian Paul
b2578ef873 glsl: add ir_unop_round_even case to silence unhandled enum warning 2010-10-15 15:44:01 -06:00
Brian Paul
fb8f3d7711 gallivm: added lp_build_load_volatile()
There's no LLVM C LLVMBuildLoadVolatile() function so roll our own.
Not used anywhere at this time but can come in handy during debugging.
2010-10-15 15:40:33 -06:00
Brian Paul
991f0c2763 gallivm: added lp_build_print_vec4() 2010-10-15 15:40:33 -06:00
Eric Anholt
81d0a1fb3f i965: Set the type of the null register to fix gen6 FS comparisons.
We often use reg_null as the destination when setting up the flag
regs.  However, on gen6 there aren't general implicit conversions to
destination types from src types, so the comparison to produce the
flag regs would be done on the integer result interpreted as a float.
Hilarity ensued.

Fixes 20 piglit cases.
2010-10-15 13:13:56 -07:00
Ian Romanick
20b39c7760 i965: Fix indentation after commit 3322fbaf 2010-10-15 12:11:03 -07:00
Ian Romanick
f29ff6efa6 linker: Trivial indention fix 2010-10-15 12:11:03 -07:00
Jakob Bornecrantz
eb7cf3d2a6 target-helpers: Remove per target software wrapper check
Instead of having a NAME_SOFTWARE check just use the GALLIUM_DRIVER
instead but set the default to native which is the same as not wrapped.
2010-10-15 19:13:00 +01:00
Jakob Bornecrantz
af729571eb egl: Remove unnecessary headers 2010-10-15 19:13:00 +01:00
Jakob Bornecrantz
44207ff71b wrapper: Add a way to dewrap a pipe screen without destroying it 2010-10-15 19:13:00 +01:00
Jakob Bornecrantz
f8f3baa43a wrapper: Fix spelling 2010-10-15 19:13:00 +01:00
Jakob Bornecrantz
992e7c7279 llvmpipe: Move makefile include to before targets
Or plain make inside of the directory wont build libllvmpipe.a
2010-10-15 19:13:00 +01:00
Xavier Chantry
9c439e3c7a nv50: apply layout_mask to tile_flags
The tile_flags now store more than just nv50 page table entry bits.
2010-10-15 15:54:02 +02:00
Keith Whitwell
ac98519c4e llvmpipe: validate color outputs against key->nr_cbufs 2010-10-15 14:49:13 +01:00
Keith Whitwell
ffab84c9a2 llvmpipe: check shader outputs are non-null before using 2010-10-15 14:49:13 +01:00
Vinson Lee
a14376218e mesa: Add missing header to shaderobj.h.
Include compiler.h for ASSERT symbol.
2010-10-15 06:13:18 -07:00
Keith Whitwell
39185efd3a llvmpipe: fix non-sse build after recent changes 2010-10-15 14:11:22 +01:00
Keith Whitwell
392b0954c2 llvmpipe: use aligned loads/stores for plane values 2010-10-15 13:52:00 +01:00
Keith Whitwell
9f9a17eba8 llvmpipe: do plane calculations with intrinsics
This is a step towards moving this code into the rasterizer.
2010-10-15 13:38:06 +01:00
Keith Whitwell
15f4e3a8b9 gallium: move some intrinsics helpers to u_sse.h 2010-10-15 13:29:56 +01:00
Keith Whitwell
8965f042b3 llvmpipe: don't store plane.ei value in binned data
Further reduce the size of a binned triangle.
2010-10-15 13:27:47 +01:00
Keith Whitwell
9bf8a55c4b llvmpipe: slightly shrink the size of a binned triangle 2010-10-15 13:27:47 +01:00
Keith Whitwell
0a1c900103 llvmpipe: don't pass frontfacing as a float 2010-10-15 13:27:47 +01:00
Keith Whitwell
4195febeec llvmpipe: reintroduce SET_STATE binner command
But bin lazily only into bins which are receiving geometry.
2010-10-15 13:27:47 +01:00
Chad Versace
e2c1fe3eb0 glsl: Fix ir validation for bit logic ops
In ir_validate::visit_leave(), the cases for
    - ir_binop_bit_and
    - ir_binop_bit_xor
    - ir_binop_bit_or
were incorrect. It was incorrectly asserted that both operands must be the
same type, when in fact one may be scalar and the other a vector. It was also
incorrectly asserted that the resultant type was the type of the left operand,
which in fact does not hold when the left operand is a scalar and the right
operand is a vector.
2010-10-15 00:20:18 -07:00
Chad Versace
4761d0d22b glsl: Implement constant expr evaluation for bitwise logic ops
Implement by adding the following cases to
ir_exporession::constant_expression_value():
    - ir_binop_bit_and
    - ir_binop_bit_or
    - ir_binop_bit_xor
2010-10-15 00:20:18 -07:00
Chad Versace
adea8150a7 glsl: Implement constant expr evaluation for bit-shift ops
Implement by adding the following cases to
ir_expression::constant_expression_value():
    - ir_binop_lshfit
    - ir_binop_rshfit
2010-10-15 00:20:18 -07:00
Chad Versace
90a8b792c0 glsl: Implement constant expr evaluation for bitwise-not
Implement by adding a case to ir_expression::constant_expression_value()
for ir_unop_bit_not.
2010-10-15 00:20:18 -07:00
Chad Versace
5c4c36f7f3 glsl: Implement ast-to-hir for binary shifts in GLSL 1.30
Implement by adding the following cases to ast_expression::hir():
    - ast_lshift
    - ast_rshift
Also, implement ir validation for the new operators by adding the following
cases to ir_validate::visit_leave():
    - ir_binop_lshift
    - ir_binop_rshift
2010-10-15 00:20:18 -07:00
Chad Versace
f88b4eaa8f glsl: Change generated file glsl_lexer.cpp 2010-10-15 00:20:18 -07:00
Chad Versace
7abdc71afa glsl: Add lexer rules for << and >> in GLSL 1.30
Commit for generated file glsl_lexer.cpp follows this commit.
2010-10-15 00:20:18 -07:00
Dave Airlie
fc6caef4cb r600g: evergreen interpolation support.
On evergreen, interpolation has moved into the fragment shader,
with the interpolation parmaters being passed via GPRs and LDS entries.

This works out the number of interps required and reserves GPR/LDS
storage for them, it also correctly routes face/position values which
aren't interpolated from the vertex shader.

Also if we noticed nothing is to be interpolated we always setup perspective
interpolation for one value otherwise the GPU appears to lockup.

This fixes about 15 piglit tests on evergreen.
2010-10-15 14:59:17 +10:00
Dave Airlie
07a30e3d18 tgsi: add scanner support for centroid inputs 2010-10-15 14:59:17 +10:00
Ian Romanick
3322fbaf3b glsl: Slightly change the semantic of _LinkedShaders
Previously _LinkedShaders was a compact array of the linked shaders
for each shader stage.  Now it is arranged such that each slot,
indexed by the MESA_SHADER_* defines, refers to a specific shader
stage.  As a result, some slots will be NULL.  This makes things a
little more complex in the linker, but it simplifies things in other
places.

As a side effect _NumLinkedShaders is removed.

NOTE: This may be a candidate for the 7.9 branch.  If there are other
patches that get backported to 7.9 that use _LinkedShader, this patch
should be cherry picked also.
2010-10-14 17:16:59 -07:00
Eric Anholt
4b4284c9c9 i965: Fix texturing on pre-gen5.
I broke it in 06fd639c51 by only testing
2 generations of hardware :(
2010-10-14 17:13:19 -07:00
Brian Paul
3d7479d705 llvmpipe: code to dump bytecode to file (disabled) 2010-10-14 17:28:24 -06:00
Brian Paul
62450b3c49 gallivm: add compile-time option to emit inst addrs and/or line numbers
Disabling address printing is helpful for diffing.
2010-10-14 17:28:24 -06:00
Brian Paul
8fb49554d9 mesa: remove post-convolution width/height vars
These were left-over bits from when convolution was removed.
2010-10-14 17:28:24 -06:00
Kenneth Graunke
2bc704d543 glsl: Refresh autogenerated file builtin_function.cpp. 2010-10-14 15:59:47 -07:00
Kenneth Graunke
27ced5c5ff glsl: Add support for the 1.30 round() built-in.
This implements round() via the ir_unop_round_even opcode, rather than
adding a new opcode.  We may wish to add one in the future, since it
might enable a small performance increase on some hardware, but for now,
this should suffice.
2010-10-14 15:59:47 -07:00
Kenneth Graunke
f157812bbb i965: Add support for ir_unop_round_even via the RNDE instruction. 2010-10-14 15:59:47 -07:00
Kenneth Graunke
6dc204c5dc glsl: Add front-end support for GLSL 1.30's roundEven built-in.
Implemented using the op-code introduced in the previous commit.
2010-10-14 15:59:47 -07:00
Kenneth Graunke
d85d25dd1f glsl: Add a new ir_unop_round_even opcode for GLSL 1.30's roundEven.
Also, update ir_to_mesa's "1.30 is unsupported" case to "handle" it.
2010-10-14 15:59:47 -07:00
Dave Airlie
510c503762 r300g: clean up warning due to unknown cap. 2010-10-15 08:46:16 +10:00
Keith Whitwell
8260ab9346 r600g: handle absolute modifier in shader translator
This was being classed as unsupported in one place but used in others.
Enabling it seems to work fine.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-10-15 08:33:50 +10:00
Keith Whitwell
c28f764572 r600g: emit hardware linewidth
Tested with demos/pixeltest - line rasterization doesn't seem to be
set up for GL conventions yet, but at least width is respected now.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-10-15 08:33:25 +10:00
Keith Whitwell
cbf2fb5543 r600/drm: fix segfaults in winsys create failure path
Would try to destroy radeon->cman, radeon->kman both which were still
NULL.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-10-15 08:33:00 +10:00
Hui Qi Tay
26ff7523b6 draw: sanitize llvm variant key
Fixes recompilation, but seems to be broken with llvm 2.8.
2010-10-14 22:34:10 +01:00
Kenneth Graunke
4bab22bca3 i965: Clean up a warning in the old fragment backend.
Hopefully this code can just go away soon.
2010-10-14 13:19:23 -07:00
Eric Anholt
a81d423d93 i965: Enable the new FS backend on pre-gen6 as well.
It is now to the point where we have no regressing piglit tests.  It
also fixes Yo Frankie! and Humus DynamicBranching, probably due to the
piglit bias tests that work that didn't on the Mesa IR backend.

As a downside, performance takes about a 5-10% performance hit at the
moment (e.g. nexuiz 19.8fps -> 18.8fps), which I plan to resolve by
reintroducing 16-wide fragment shaders where possible.  It is a win,
though, for fragment shaders using flow control.
2010-10-14 12:40:50 -07:00
Kenneth Graunke
897f6d3c7d i965: Correctly emit the RNDZ instruction.
Simply using RNDU, RNDZ, or RNDE does not produce the desired result.
Rather, the RND* instructions place a value in the destination register
that may be 1 less than the correct answer.  They can also set per-channel
"increment bits" in a flag register, which, if set, mean dest needs to
be incremented by 1.  A second instruction - a predicated add -
completes the job.

Notably, RNDD always produces the correct answer in a single
instruction.

Fixes piglit test glsl-fs-trunc.
2010-10-14 12:40:16 -07:00
Kenneth Graunke
f541b685aa i965: Use RNDZ for ir_unop_trunc in the new FS.
The existing code used RNDD, which rounds down, rather than toward zero.
2010-10-14 12:40:16 -07:00
Kenneth Graunke
f9bd4c6c26 glsl: Refresh autogenerated file builtin_function.cpp. 2010-10-14 12:40:16 -07:00
Kenneth Graunke
090dd4fcc5 glsl: Add front-end support for the "trunc" built-in. 2010-10-14 12:40:16 -07:00
Kenneth Graunke
c4226142f3 i965: Use logical-not when emitting ir_unop_ceil.
Fixes piglit test glsl-fs-ceil.
2010-10-14 12:40:16 -07:00
Eric Anholt
5dd07b442e i965: Add peepholing of conditional mod generation from expressions.
This cuts usually 2 out of 3 instructions for flag reg generation (if
statements, conditional assignment) by producing the conditional mod
in the expression representing the boolean value.

Fixes glsl-fs-vec4-indexing-temp-dst-in-nested-loop-combined (register
allocation no longer fails for the conditional generation
proliferation)
2010-10-14 12:02:54 -07:00
Eric Anholt
d5599c0b6a i965: Add a function for handling the move of boolean values to flag regs.
This will be a place to peephole comparisions directly to the flag
regs, and for now avoids using MOV with conditional mod on gen6, which
is now illegal.
2010-10-14 12:02:54 -07:00
Kristian Høgsberg
1d33e940d2 Only install vtxfmt tables for OpenGL
GLES1 and GLES2 install their own exec pointers and don't need the
Save table.  Also, the SET_* macros use different indices for the different
APIs so the offsets used in vtxfmt.c are actually wrong for the ES APIs.
2010-10-14 15:00:22 -04:00
Eric Anholt
4f88550ba0 i965: Add a pass to the FS to split virtual GRFs to float channels.
Improves nexuiz performance 0.91% (+/- 0.54%, n=8)
2010-10-14 10:42:55 -07:00
Eric Anholt
b8613d70da i965: Update the live interval when coalescing regs. 2010-10-14 10:42:55 -07:00
Eric Anholt
0c6752026c i965: Set class_sizes[] for the aligned reg pair class.
So far, I've only seen this be a valgrind warning and not a real failure.
2010-10-14 10:42:55 -07:00
Keith Whitwell
f0bd76f28d llvmpipe: don't try to emit non-existent color outputs 2010-10-14 14:08:20 +01:00
Kristian Høgsberg
81ccb3e2ce Drop the "neutral" tnl module
Just always check for FLUSH_UPDATE_CURRENT and call Driver.BeginVertices
when necessary.  By using the unlikely() macros, this ends up as
a 10% performance improvement (for isosurf, anyway) over the old,
complicated function pointer swapping.
2010-10-14 08:53:59 -04:00
Chia-I Wu
d6de1f44a0 st/egl: Do not finish a fence that is NULL.
i915g would dereference the NULL pointer.
2010-10-14 17:16:14 +08:00
Chia-I Wu
c97c77d869 st/egl: Access _EGLConfig directly.
Drop the use of SET_CONFIG_ATTRIB.  Fix the value of EGL_SAMPLE_BUFFERS
along the way.
2010-10-14 17:16:14 +08:00
Chia-I Wu
3fa21881b1 egl: Access config attributes directly.
Replace SET_CONFIG_ATTRIB/GET_CONFIG_ATTRIB by direct dereferences.
2010-10-14 17:16:14 +08:00
Chia-I Wu
282e514240 egl: Use attribute names as the _EGLConfig member names.
This makes _EGLConfig more accessible and scales better when new
attributes are added.
2010-10-14 17:14:44 +08:00
Dave Airlie
68014c8d19 r600g: select linear interpolate if tgsi input requests it 2010-10-14 14:27:34 +10:00
Dave Airlie
0637044add r600g: fixup typo in macro name 2010-10-14 14:19:37 +10:00
Dave Airlie
1e82c28fcf r600g: fixup pos/face ena/address properly 2010-10-14 14:15:15 +10:00
Dave Airlie
8a9f02c5d5 r600g: only pick centroid coordinate when asked.
TGSI tells us when to use this, its not hooked up from GLSL to MESA to TGSI yet though.
2010-10-14 14:15:15 +10:00
Zhenyu Wang
338b3f0b90 Revert "i965: fallback lineloop on sandybridge for now"
This reverts commit 73dab75b41.
2010-10-14 11:24:49 +08:00
Zhenyu Wang
e8e79c1d7e i965: Fix GS hang on Sandybridge
Don't use r0 for FF_SYNC dest reg on Sandybridge, which would
smash FFID field in GS payload, that cause later URB write fail.
Also not use r0 in any URB write requiring allocate.
2010-10-14 11:24:42 +08:00
Eric Anholt
a57ef244fc i965: Add support for rescaling GL_TEXTURE_RECTANGLE coords to new FS. 2010-10-13 17:07:43 -07:00
Fredrik Höglund
a21a2748be r600g: Fix texture sampling with swizzled coords
Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-10-14 09:25:29 +10:00
Dave Airlie
26dacce2c0 r600g: drop unused context members 2010-10-14 09:10:16 +10:00
Ian Romanick
7d8ba5f78f mesa: Clean up various 'unused parameter' warnings in shaderapi 2010-10-13 15:35:23 -07:00
Ian Romanick
ccc1c4c6d9 mesa: Clean up two 'comparison between signed and unsigned' warnings 2010-10-13 15:35:23 -07:00
Ian Romanick
5cb24c4a75 mesa: Refactor validation of shader targets
Actually validate that the implementation supports the particular
shader target as well.  Previously if a driver only supported vertex
shaders, for example, glCreateShaderObjectARB would gladly create a
fragment shader.

NOTE: this is a candidate for the 7.9 branch.
2010-10-13 15:35:18 -07:00
Ian Romanick
babe20b9d1 mesa: Silence unused variable warning 2010-10-13 15:30:20 -07:00
Ian Romanick
4a45595cf3 linker: Reject shaders that have unresolved function calls
This really amounts to just using the return value from
link_function_calls.  All the work was being done, but the result was
being ignored.

Fixes piglit test link-unresolved-funciton.

NOTE: this is a candidate for the 7.9 branch.
2010-10-13 15:30:19 -07:00
Vinson Lee
720bdfbceb glsl: Initialize variable in ir_derefence_array::constant_expression_value
Completely initialize data passed to ir_constant constructor.

Fixes piglit glsl-mat-from-int-ctor-03 valgrind uninitialized value
error on softpipe.
2010-10-13 14:21:08 -07:00
José Fonseca
ae00e34e4b llvmpipe: Generalize the x8z24 fast path to all depth formats.
Together with the previous commit, this generalize the benefits of
d2cf757f44 to all depth formats, in
particular:
- simpler float -> 24unorm conversion
- avoid unsigned comparisons (not directly supported on SSE) by aligning
to the least significant bit
- avoid unecessary/repeated mask ANDing

Verified with trivial/tri-z that the exact same assembly is produced for
X8Z24.
2010-10-13 20:25:57 +01:00
José Fonseca
60c5d4735d gallivm: More accurate float -> 24bit & 32bit unorm conversion. 2010-10-13 20:25:57 +01:00
Brian Paul
e487b665aa gallivm: work-around trilinear mipmap filtering regression with LLVM 2.8
The bug only happens on the AOS / fixed-pt path.
2010-10-13 12:37:42 -06:00
Vinson Lee
bee22ed6b9 gallivm: Remove unnecessary header. 2010-10-13 11:18:40 -07:00
Brian Paul
c3ed27ec76 x11: fix breakage from gl_config::visualType removal 2010-10-13 08:32:08 -06:00
José Fonseca
95c18abb03 llvmpipe: Unbreak Z32_FLOAT.
Z32_FLOAT uses <4 x float> as intermediate/destination type,
instead of <4 x i32>.

The necessary bitcasts got removed with commit
5b7eb868fd

Also use depth/stencil type and build contexts consistently, and
make the depth pointer argument a ordinary <i8 *>, to catch this
sort of issues in the future (and also to pave way for Z16 and
Z32_FLOAT_S8_X24 support).
2010-10-13 15:25:15 +01:00
Kristian Høgsberg
f9995b3075 Drop GLcontext typedef and use struct gl_context instead 2010-10-13 09:43:25 -04:00
Kristian Høgsberg
31aca27c08 Drop GLframebuffer typedef and just use struct gl_framebuffer 2010-10-13 09:43:24 -04:00
Kristian Høgsberg
d3491e775f Rename GLvisual and __GLcontextModes to struct gl_config 2010-10-13 09:43:24 -04:00
Kristian Høgsberg
705e142dda gl: Remove unused GLcontextModes fields 2010-10-13 09:43:24 -04:00
Kristian Høgsberg
e3c1c5377c Get rid of GL/internal/glcore.h
__GLcontextModes is always only used as an implementation internal struct
at this point and we shouldn't install glcore.h anymore.  Anything that
needs __GLcontextModes should just include the struct in its headers files
directly.
2010-10-13 09:43:24 -04:00
Roland Scheidegger
d838e4f66d gallivm: only use lp_build_conv 4x4f -> 1x16 ub fastpath with sse2
This is relying on lp_build_pack2 using the sse2 pack intrinsics which
handle clamping.
(Alternatively could have make it use lp_build_packs2 but it might
not even produce more efficient code than not using the fastpath
in the first place.)
2010-10-13 15:26:37 +02:00
Dave Airlie
ff4b397517 r600g: fix stencil export for evergreen harder 2010-10-13 18:50:37 +10:00
Stephan Schmid
40cc5bfcd7 r600g: fix relative addressing when splitting constant accesses
Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-10-13 18:49:27 +10:00
Dave Airlie
6da8129b3c r600g: add missing eg reg definition 2010-10-13 17:45:10 +10:00
Dave Airlie
92e729bba5 r600g: evergreen add stencil export bit 2010-10-13 17:40:32 +10:00
Dave Airlie
88c1b32c62 r600g: use blitter for hw copy region
at the moment depth copies are failing (piglit depth-level-clamp)
so use the fallback for now until get some time to investigate.
2010-10-13 15:55:49 +10:00
Dave Airlie
f8778eeb40 r600g: drop all use of unsigned long
this changes size on 32/64 bit so is definitely no what you want to use here.
2010-10-13 15:55:48 +10:00
Dave Airlie
e9acf9a3bb r600g: fix transfer stride.
fixes segfaults
2010-10-13 15:55:48 +10:00
Dave Airlie
e3b089126c r600g: remove bpt and start using pitch_in_bytes/pixels.
this mirror changes in r300g, bpt is kinda useless when it comes to some
of the non-simple texture formats.
2010-10-13 15:55:48 +10:00
Dave Airlie
fa797f12b3 r600g: rename pitch in texture to pitch_in_bytes 2010-10-13 15:55:47 +10:00
Dave Airlie
6a0066a69f r600g: use common texture object create function 2010-10-13 15:55:47 +10:00
Dave Airlie
771dd89881 r600g: split out miptree setup like r300g
just a cleanup step towards tiling
2010-10-13 15:55:47 +10:00
Dave Airlie
9979d60c0e r600g: add copy into tiled texture 2010-10-13 15:55:46 +10:00
Dave Airlie
5604276670 r600g: the vs/ps const arrays weren't actually being used.
completely removed them.
2010-10-13 15:56:12 +10:00
Dave Airlie
d59498b780 r600g: reduce size of context structure.
this thing will be in the cache a lot, so having massive big struct
arrays inside it won't be helping anyone.
2010-10-13 15:25:00 +10:00
Vinson Lee
8c107e6ca6 tdfx: Silence unused variable warning on non-debug builds.
Fixes this GCC warning.
tdfx_texman.c: In function 'tdfxTMMoveOutTM_NoLock':
tdfx_texman.c:897: warning: unused variable 'shared'
2010-10-12 22:23:21 -07:00
Dave Airlie
c8d4108fbe r600g: store samplers/views across blit when we need to modify them
also fixup framebuffer state copies to avoid bad state.
2010-10-13 15:11:30 +10:00
Dave Airlie
a8d1d7253e r600g: fix scissor/cliprect confusion
gallium calls them scissors, but r600 hw like r300 is better off using
cliprects to implement them as we can turn them on/off a lot easier.
2010-10-13 15:11:30 +10:00
Dave Airlie
833b4fc11e r600g: fix depth0 setting 2010-10-13 15:11:30 +10:00
Vinson Lee
71fa3f8fe2 r300: Silence uninitialized variable warning.
Fixes this GCC warning.
r300_state.c: In function 'r300InvalidateState':
r300_state.c:2247: warning: 'hw_format' may be used uninitialized in this function
r300_state.c:2247: note: 'hw_format' was declared here
2010-10-12 22:02:27 -07:00
Brian Paul
39de9251c4 mesa: reformatting, comments, code movement 2010-10-12 19:04:05 -06:00
Brian Paul
048a90c1cb draw/llvmpipe: replace DRAW_MAX_TEXTURE_LEVELS with PIPE_MAX_TEXTURE_LEVELS
There's no apparent reason for the former to exist.  And they didn't
even have the same value.
2010-10-12 19:04:05 -06:00
Brian Paul
50f221a01b gallivm: remove newlines 2010-10-12 19:04:05 -06:00
Roland Scheidegger
c1549729ce gallivm: fix different handling of [non]normalized coords in linear soa path
There seems to be no reason for it, so do same math for both
(except the scale mul, of course).
2010-10-13 02:35:05 +02:00
Brian Paul
1ca5f7cc31 mesa: remove assertion w/ undeclared variable texelBytes 2010-10-12 18:32:06 -06:00
Dave Airlie
5f612f5c00 st/mesa: enable stencil shader export extension if supported 2010-10-13 09:30:05 +10:00
Dave Airlie
d9671863ea glsl: add support for shader stencil export
This adds proper support for the GL_ARB_shader_stencil_export extension
to the GLSL compiler. Thanks to Ian for pointing out where I need to add things.
2010-10-13 09:30:05 +10:00
Dave Airlie
39d1feb51e r600g: add shader stencil export support. 2010-10-13 09:30:05 +10:00
Dave Airlie
40acb109de r600g: add support for S8, X24S8 and S8X24 sampler formats. 2010-10-13 09:30:04 +10:00
Dave Airlie
ef8bb7ada9 st/mesa: use shader stencil export to accelerate shader drawpixels.
If the pipe driver has shader stencil export we can accelerate DrawPixels
using it. It tries to pick an S8 texture and works its way to X24S8 and S8X24
if that isn't supported.
2010-10-13 09:30:04 +10:00
Dave Airlie
06642c6175 st/mesa: add option to choose a texture format that we won't render to.
We need a texture to put the drawpixels stuff into, an S8 texture is less
memory/bandwidth than the 32-bit X24S8, but we might not be able to render
directly to an S8, so this lets us specify we won't be rendering to this
texture.
2010-10-13 09:30:04 +10:00
Dave Airlie
d8f6ef4565 softpipe: add support for shader stencil export capability
this allows softpipe to be used to test shader stencil ref exporting.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-10-13 09:30:04 +10:00
Dave Airlie
c79e681a68 mesa: improve texstore for 8/24 formats and add texstore for S8.
this improves mesa texstore for 8/24 so it can create S24X8/X24S8 variants
by keeping the depth bits static.

it also adds a texstore for S8 so we can write out an S8 texture to use
in the sampler for accel draw pixels to save memory bw.

The logic seems sound here, I've worked it out a few times on paper, though
it would be good to have some review.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-10-13 09:30:04 +10:00
Dave Airlie
bec341d00c mesa: add support for FRAG_RESULT_STENCIL.
this is needed to add support for stencil shader export.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-10-13 09:30:03 +10:00
Dave Airlie
d02993c9dc gallium/util: add S8 tile sampling support. 2010-10-13 09:30:03 +10:00
Dave Airlie
67e71429f1 gallium/format: add X32_S8X24_USCALED format.
Has similiar use cases to the S8X24 and X24S8 formats.
2010-10-13 09:30:03 +10:00
Dave Airlie
66a0d1e4b9 gallium/format: add support for X24S8 and S8X24 formats.
these formats are needed for hw that can sample and write stencil values.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-10-13 09:30:03 +10:00
Dave Airlie
4ecb2c105d gallium/tgsi: add support for stencil writes.
this adds the capability + a stencil semantic id, + tgsi scan support.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-10-13 09:30:02 +10:00
Eric Anholt
43873b53c4 i965: Don't rebase the index buffer to min 0 if any arrays are in VBOs.
There was a check to only do the rebase if we didn't have everything
in VBOs, but nexuiz apparently hands us a mix of VBOs and arrays,
resulting in blocking on the GPU to do a rebase.

Improves nexuiz 800x600, high-settings performance on my Ironlake 41%
(+/- 1.3%), from 14.0fps to 19.7fps.
2010-10-12 15:17:35 -07:00
Eric Anholt
3316a54205 intel: Allow CopyTexSubImage to InternalFormat 3/4 textures, like RGB/RGBA.
The format selection of the CopyTexSubImage is pretty bogus still, but
this at least avoids software fallbacks in nexuiz, bringing
performance from 7.5fps to 12.8fps on my machine.
2010-10-12 14:08:00 -07:00
Eric Anholt
080e7aface i965: Fix missing "break;" in i2b/f2b, and missing AND of CMP result.
Fixes glsl-fs-i2b.
2010-10-12 13:07:40 -07:00
Ian Romanick
9fea9e5e21 glsl: Fix incorrect assertion
This assertion was added in commit f1c1ee11, but it did not notice
that the array is accessed with 'size-1' instead of 'size'.  As a
result, the assertion was off by one.  This caused failures in at
least glsl-orangebook-ch06-bump.
2010-10-12 12:50:29 -07:00
Ian Romanick
b2b9b22c10 mesa: Validate assembly shaders when GLSL shaders are used
If an GLSL shader is used that does not provide all stages and
assembly shaders are provided for the missing stages, validate the
assembly shaders.

Fixes bugzilla #30787 and piglit tests glsl-invalid-asm0[12].

NOTE: this is a candidate for the 7.9 branch.
2010-10-12 10:54:28 -07:00
Keith Whitwell
7533c37457 llvmpipe: make sure intrinsics code is guarded with PIPE_ARCH_SSE 2010-10-12 18:28:12 +01:00
Thomas Hellstrom
893620e52e st/xorg: Fix typo
Pointed out by Jakob Bornecrantz.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-10-12 18:26:05 +02:00
Brian Paul
f1c1ee11d3 ir_to_mesa: assorted clean-ups, const qualifiers, new comments 2010-10-12 09:26:54 -06:00
José Fonseca
6fbd4faf97 gallivm: Name anonymous union. 2010-10-12 16:08:09 +01:00
Brian Paul
0ad9d8b538 st/xlib: add some comments 2010-10-12 08:54:54 -06:00
Brian Paul
3633e1f538 glsl2: fix signed/unsigned comparison warning 2010-10-12 08:54:16 -06:00
José Fonseca
e3ec0fdd54 llmvpipe: improve mm_mullo_epi32
Apply Jose's suggestions for a small but measurable improvement in
isosurf.
2010-10-12 14:17:21 +01:00
Thomas Hellstrom
b6b7ce84e5 st/xorg: Don't try to remove invalid fbs
Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-10-12 15:09:05 +02:00
Thomas Hellstrom
201c3d3669 xorg/vmwgfx: Don't hide HW cursors when updating them
Gets rid of annoying cursor flicker

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-10-12 15:09:05 +02:00
Thomas Hellstrom
bfd065c71e st/xorg: Add a customizer option to get rid of annoying cursor update flicker
Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-10-12 15:09:05 +02:00
Thomas Hellstrom
f0bbf130f9 xorg/vmwgfx: Make vmwarectrl work also on 64-bit servers
Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-10-12 15:09:04 +02:00
Thomas Hellstrom
ec08047a80 st/xorg: Don't try to use option values before processing options
Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2010-10-12 15:09:04 +02:00
Keith Whitwell
0ca0382d1b Revert "llvmpipe: try to keep plane c values small"
This reverts commit 9773722c2b.

Looks like there are some floor/rounding issues here that need
to be better understood.
2010-10-12 13:20:39 +01:00
Keith Whitwell
22ec25e2bf gallivm: don't branch on KILLs near end of shader 2010-10-12 13:14:51 +01:00
Keith Whitwell
d0eb854f58 r600g: add missing file to sconscript 2010-10-12 13:08:34 +01:00
Keith Whitwell
1a574afabc gallium: move sse intrinsics debug helpers to u_sse.h 2010-10-12 13:02:28 +01:00
José Fonseca
39331be44e llvmpipe: Fix MSVC build.
MSVC doesn't accept more than 3 __m128i arguments.
2010-10-12 12:27:55 +01:00
Keith Whitwell
b4277bc584 llvmpipe: fix typo in last commit 2010-10-12 11:52:39 +01:00
Keith Whitwell
9773722c2b llvmpipe: try to keep plane c values small
Avoid accumulating more and more fixed point bits.
2010-10-12 11:50:14 +01:00
Keith Whitwell
9d59e148f8 llvmpipe: add debug helpers for epi32 etc 2010-10-12 11:50:13 +01:00
Keith Whitwell
2cf98d5a6d llvmpipe: try to do more of rast_tri_3_16 with intrinsics
There was actually a large quantity of scalar code in these functions
previously.  This tries to move more into intrinsics.

Introduce an sse2 mm_mullo_epi32 replacement to avoid sse4 dependency
in the new rasterization code.
2010-10-12 11:50:07 +01:00
José Fonseca
4cb3b4ced8 llvmpipe: Do not dispose the execution engine.
The engine is a global owned by gallivm module.
2010-10-12 08:36:51 +01:00
Francisco Jerez
c25fcf5aa5 nouveau: Get larger push buffers.
Useful to amortize the command submission/reloc overhead (e.g. etracer
goes from 72 to 109 FPS on nv4b).
2010-10-12 04:13:22 +02:00
Francisco Jerez
70828aa246 dri/nouveau: Initialize tile_flags when allocating a render target. 2010-10-12 04:12:56 +02:00
Dave Airlie
965f69cb0c r600g: fix typo in vertex sampling on r600
fixes https://bugs.freedesktop.org/show_bug.cgi?id=30771

Reported-by: Kevin DeKorte
2010-10-12 09:45:22 +10:00
Eric Anholt
bcec03d527 i965: Always use the new FS backend on gen6.
It's now much more correct for gen6 than the old backend, with just 2
regressions I've found (one of which is common with pre-gen6 and will
be fixed by an array splitting IR pass).

This does leave the old Mesa IR backend getting used still when we
don't have GLSL IR, but the plan is to get GLSL IR input to the driver
for the ARB programs and fixed function by the next release.
2010-10-11 15:32:41 -07:00
Eric Anholt
0cadd32b6d i965: Fix gen6 pixel_[xy] setup to avoid mixing int and float src operands.
Pre-gen6, you could mix int and float just fine.  Now, you get goofy
results.

Fixes:
glsl-arb-fragment-coord-conventions
glsl-fs-fragcoord
glsl-fs-if-greater
glsl-fs-if-greater-equal
glsl-fs-if-less
glsl-fs-if-less-equal
2010-10-11 15:26:59 -07:00
Eric Anholt
17306c60ad i965: Don't compute-to-MRF in gen6 VS math.
There was code to do this for pre-gen6 already, this just enables it
for gen6 as well.
2010-10-11 15:26:59 -07:00
Eric Anholt
720ed3c906 i965: Expand uniform args to gen6 math to full registers to get hstride == 1.
This is a hw requirement in math args.  This also is inefficient, as
we're calculating the same result 8 times, but then we've been doing
that on pre-gen6 as well.  If we're doing math on uniforms, though,
we'd probably be better served by having some sort of mechanism for
precalculating those results into another uniform value to use.

Fixes 7 piglit math tests.
2010-10-11 15:26:58 -07:00
Eric Anholt
317dbf4613 i965: Don't compute-to-MRF in gen6 math instructions. 2010-10-11 15:26:58 -07:00
Eric Anholt
7b5bc38c44 i965: Add a couple of checks for gen6 math instruction limits. 2010-10-11 15:26:58 -07:00
Eric Anholt
25cf241540 i965: Don't consider gen6 math instructions to write to MRFs.
This was leftover from the pre-gen6 cleanups.  One tests regresses
where compute-to-MRF now occurs.
2010-10-11 15:26:58 -07:00
Chad Versace
41c2079855 glsl: Changes in generated file glsl_lexer.cpp
Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2010-10-11 14:25:53 -07:00
Chad Versace
0c9fef6111 glsl: Add lexer rules for uint and uvecN (N=2..4)
Commit for generated file glsl_lexer.cpp follows this commit.

Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
2010-10-11 14:25:48 -07:00
Chad Versace
fc99a3beb9 glsl: Add glsl_type::uvecN_type for N=2,3
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
2010-10-11 14:25:44 -07:00
Chad Versace
a34817917b intel_extensions: Add ability to set GLSL version via environment
Add ability to set the GLSL version used by the GLcontext by setting the
environment variable INTEL_GLSL_VERSION. For example,
    env INTEL_GLSL_VERSION=130 prog args
If the environment variable is missing, the GLSL versions defaults to 120.

Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
2010-10-11 14:25:30 -07:00
Daniel Vetter
603741a86d r200: revalidate after radeon_update_renderbuffers
By calling radeon_draw_buffers (which sets the necessary flags
in radeon->NewGLState) and revalidating if NewGLState is non-zero
in r200TclPrimitive. This fixes an assert in libdrm (the color-/
depthbuffer was changed but not yet validated) and and stops the
kernel cs checker from complaining about them (when they're too
small).

Thanks to Mario Kleiner for the hint to call radeon_draw_buffer
(instead of my half-broken hack).

v2: Also fix the swtcl r200 path.

Cc: Mario Kleiner <mario.kleiner@tuebingen.mpg.de>
Signed-off-by: Daniel Vetter <daniel.vetter@ffwll.ch>
2010-10-11 15:16:44 -04:00
Eric Anholt
c6dbf253d2 i965: Compute to MRF in the new FS backend.
This didn't produce a statistically significant performance difference
in my demo (n=4) or nexuiz (n=3), but it still seems like a good idea
and is recommended by the HW team.
2010-10-11 12:08:13 -07:00
Eric Anholt
06fd639c51 i965: Give the FB write and texture opcodes the info on base MRF, like math. 2010-10-11 12:07:33 -07:00
Eric Anholt
0cd6cea8a3 i965: Give the math opcodes information on base mrf/mrf len.
This is progress towards enabling a compute-to-MRF pass.
2010-10-11 12:03:34 -07:00
Eric Anholt
37758fb1cb i965: Move FS backend structures to a header.
It's time to start splitting some of this up.
2010-10-11 11:52:02 -07:00
Eric Anholt
251fe27854 i965: Reduce register interference checks for changed FS_OPCODE_DISCARD.
While I don't know of any performance changes from this (once extra
reg available out of 128), it makes the generated asm a lot cleaner
looking.
2010-10-11 11:52:01 -07:00
Eric Anholt
90c4022040 i965: Split FS_OPCODE_DISCARD into two steps.
Having the single opcode write then read the reg meant that single
instruction opcodes had to consider their source regs to interfere
with their dest regs.
2010-10-11 11:52:01 -07:00
José Fonseca
986cb9d5cf llvmpipe: Use lp_tgsi_info. 2010-10-11 13:06:25 +01:00
José Fonseca
7c1b5772a8 gallivm: More detailed analysis of tgsi shaders.
To allow more optimizations, in particular for direct textures.
2010-10-11 13:05:32 +01:00
José Fonseca
11dad21718 tgsi: Export some names for some tgsi enums.
Useful to give human legible names in other cases.
2010-10-11 13:05:31 +01:00
José Fonseca
6c1aa4fd49 gallium: Define C99 restrict keyword where absent. 2010-10-11 13:05:31 +01:00
José Fonseca
e1003336f0 gallivm: Eliminate unsigned integer arithmetic from texture coordinates.
SSE support for 32bit and 16bit unsigned arithmetic is not complete, and
can easily result in inefficient code.

In most cases signed/unsigned doesn't make a difference, such as for
integer texture coordinates.

So remove uint_coord_type and uint_coord_bld to avoid inefficient
operations to sneak in the future.
2010-10-11 08:14:09 +01:00
José Fonseca
b18fecbd0e llvmpipe: Remove outdated comment about stencil testing. 2010-10-11 08:14:09 +01:00
Dave Airlie
3322416de4 r600g: don't run with scissors.
This could probably be done much nicer, I've spent a day chasing
a coherency problem in the kernel, that turned out to be incorrect
scissor setup.
2010-10-11 16:23:23 +10:00
Dave Airlie
ef2702fb20 r600g: add TXL opcode support.
fixes glsl1-2D Texture lookup with explicit lod (Vertex shader)
2010-10-11 12:18:05 +10:00
Dave Airlie
ea1d818b58 r600g: enable vertex samplers.
We need to move the texture sampler resources out of the range of the vertex attribs.

We could probably improve this using an allocator but this is the simple answer for now.

makes mesa-demos/src/glsl/vert-tex work.
2010-10-11 11:59:53 +10:00
Dave Airlie
2c47f302af r600g: evergreen has no request size bit in texture word4 2010-10-11 11:59:53 +10:00
Dave Airlie
bd89da79a1 r600g: fix input/output Z export mixup for evergreen. 2010-10-11 11:59:53 +10:00
José Fonseca
17dbd41cf2 gallivm: Pass texture coords derivates as scalars.
We end up treating them as scalars in the end, and it saves some
instructions.
2010-10-10 19:51:35 +01:00
José Fonseca
693667bf88 gallivm: Use variables instead of Phis in loops.
With this commit all explicit Phi emission is now gone.
2010-10-10 19:05:05 +01:00
José Fonseca
48003f3567 gallivm: Allow to disable bri-linear filtering with GALLIVM_DEBUG=no_brilinear runtime option 2010-10-10 18:48:02 +01:00
José Fonseca
124adf253c gallivm: Fix a long standing bug with nested if-then-else emission.
We can't patch true-block at end-if time, as there is no guarantee that
the block at the beginning of the true stanza is the same at the end of
the true stanza -- other control flow elements may have been emitted half
way the true stanza.

Although this bug surfaced recently with the commit to skip mip filtering
when lod is an integer the bug was always there, although probably it
was avoided until now: e.g., cubemap selection nests if-then-else on the
else stanza, which does not suffer from the same problem.
2010-10-10 18:48:02 +01:00
delphi
08f890d4c3 draw: some changes to allow for runtime changes to userclip planes 2010-10-10 08:40:11 +01:00
Francisco Jerez
e2acc7be26 dri/nv10: Fake fast Z clears for pre-nv17 cards. 2010-10-10 04:14:34 +02:00
Francisco Jerez
35a1893fd1 dri/nouveau: Minor cleanup. 2010-10-10 01:48:01 +02:00
José Fonseca
307df6a858 gallivm: Cleanup the rest of the flow module. 2010-10-09 21:39:14 +01:00
José Fonseca
d0ea464159 gallivm: Simplify if/then/else implementation.
No need for for a flow stack anymore.
2010-10-09 21:14:05 +01:00
José Fonseca
1949f8c315 gallivm: Factor out the SI->FP texture size conversion for SoA path too 2010-10-09 20:26:11 +01:00
José Fonseca
d45c379027 gallivm: Remove support for Phi generation.
Simply rely on mem2reg pass. It's easier and more reliable.
2010-10-09 20:14:03 +01:00
José Fonseca
ea7b49028b gallivm: Use varilables instead of Phis for cubemap selection. 2010-10-09 19:53:21 +01:00
José Fonseca
cc40abad51 gallivm: Don't generate Phis for execution mask. 2010-10-09 12:55:31 +01:00
José Fonseca
679dd26623 gallivm: Special bri-linear computation path for unmodified rho. 2010-10-09 12:13:00 +01:00
José Fonseca
81a09c8a97 gallivm: Less code duplication in log computation. 2010-10-09 12:12:59 +01:00
José Fonseca
52427f0ba7 util: Defined M_SQRT2 when not available. 2010-10-09 12:12:59 +01:00
José Fonseca
53d7f5e107 gallivm: Handle code have ret correctly.
Stop disassembling on unconditional backwards jumps.
2010-10-09 12:12:59 +01:00
José Fonseca
edba53024f llvmpipe: Fix MSVC build. Enable the new SSE2 code on non SSE3 systems. 2010-10-09 12:12:58 +01:00
Keith Whitwell
2de720dc8f llvmpipe: simplified SSE2 swz/unswz routines
We've been using these in the linear path for a while now.  Based on
Chris's SSSE3 code, but using only sse2 opcodes.  Speed seems to be
identical, but code is simpler & removes dependency on SSE3.

Should be easier to extend to other rgba8 formats.
2010-10-09 12:12:58 +01:00
Keith Whitwell
5b7eb868fd llvmpipe: clean up shader pre/postamble, try to catch more early-z
Specifically, can do early-depth-test even when alpahtest or
kill-pixel are active, providing we defer the actual z write until the
final mask is avaialable.

Improves demos/fire.c especially in the case where you get close to
the trees.
2010-10-09 11:44:45 +01:00
Keith Whitwell
aa4cb5e2d8 llvmpipe: try to be sensible about whether to branch after mask updates
Don't branch more than once in quick succession.  Don't branch at the
end of the shader.
2010-10-09 11:44:45 +01:00
Keith Whitwell
2ef6f75ab4 gallivm: simpler uint8->float conversions
LLVM seems to finds it easier to reason about these than our
mantissa-manipulation code.
2010-10-09 11:44:45 +01:00
Keith Whitwell
c79f162367 gallivm: prefer blendvb for integer arguments 2010-10-09 11:44:45 +01:00
Keith Whitwell
d2cf757f44 gallivm: specialized x8z24 depthtest path
Avoid unnecessary masking of non-existant stencil component.
2010-10-09 11:44:09 +01:00
Keith Whitwell
954965366f llvmpipe: dump fragment shader ir and asm when LP_DEBUG=fs
Better than GALLIVM_DEBUG if you're only interested in fragment shaders.
2010-10-09 11:43:23 +01:00
Keith Whitwell
6da29f3611 llvmpipe: store zero into all alloca'd values
Fixes slowdown in isosurf with earlier versions of llvm.
2010-10-09 11:43:23 +01:00
Keith Whitwell
40d7be5261 llvmpipe: use alloca for fs color outputs
Don't try to emit our own phi's, let llvm mem2reg do it for us.
2010-10-09 11:43:23 +01:00
Keith Whitwell
8009886b00 llvmpipe: defer attribute interpolation until after mask and ztest
Don't calculate 1/w for quads which aren't visible...
2010-10-09 11:42:48 +01:00
José Fonseca
d0bfb3c514 llvmpipe: Prevent z > 1.0
The current interpolation schemes causes precision loss.

Changing the operation order helps, but does not completely avoid the
problem.

The only short term solution is to clamp z to 1.0.

This is unfortunate, but probably unavoidable until interpolation is
improved.
2010-10-09 09:35:41 +01:00
José Fonseca
34c11c87e4 gallivm: Do size computations simultanously for all dimensions (AoS).
Operate simultanouesly on <width, height, depth> vector as much as possible,
instead of doing the operations on vectors with broadcasted scalars.

Also do the 24.8 fixed point scalar with integer shift of the texture size,
for unnormalized coordinates.

AoS path only for now -- the same thing can be done for SoA.
2010-10-09 09:34:31 +01:00
Zack Rusin
6316d54056 llvmpipe: fix rasterization of vertical lines on pixel boundaries 2010-10-09 08:19:21 +01:00
Vinson Lee
e7843363a5 i965: Initialize member variables.
Fixes these GCC warnings.
brw_wm_fp.c: In function 'search_or_add_const4f':
brw_wm_fp.c:92: warning: 'reg.Index2' is used uninitialized in this function
brw_wm_fp.c:84: note: 'reg.Index2' was declared here
brw_wm_fp.c:92: warning: 'reg.RelAddr2' is used uninitialized in this function
brw_wm_fp.c:84: note: 'reg.RelAddr2' was declared here
2010-10-08 16:40:29 -07:00
Vinson Lee
5abd498c47 i965: Silence unused variable warning on non-debug builds.
Fixes this GCC warning.
brw_vs.c: In function 'do_vs_prog':
brw_vs.c:46: warning: unused variable 'ctx'
2010-10-08 16:30:59 -07:00
Vinson Lee
978ffa1d61 i965: Silence unused variable warning on non-debug builds.
Fixes this GCC warning.
brw_eu_emit.c: In function 'brw_math2':
brw_eu_emit.c:1189: warning: unused variable 'intel'
2010-10-08 16:02:59 -07:00
Vinson Lee
220c0834a4 i915: Silence unused variable warning in non-debug builds.
Fixes this GCC warning.
i915_vtbl.c: In function 'i915_assert_not_dirty':
i915_vtbl.c:670: warning: unused variable 'dirty'
2010-10-08 15:49:02 -07:00
Roland Scheidegger
ff72c79924 gallivm: make use of new iround code in lp_bld_conv.
Only requires sse2 now.
2010-10-09 00:36:38 +02:00
Roland Scheidegger
175cdfd491 gallivm: optimize soa linear clamp to edge wrap mode a bit
Clamp against 0 instead of -0.5, which simplifies things.
The former version would have resulted in both int coords being zero
(in case of coord being smaller than 0) and some "unused" weight value,
whereas now the int coords will be 0 and 1, but weight will be 0, hence the
lerp should produce the same value.
Still not happy about differences between normalized and non-normalized...
2010-10-09 00:36:38 +02:00
Roland Scheidegger
2cc6da85d6 gallivm: avoid unnecessary URem in linear wrap repeat case
Haven't looked at what code this exactly generates but URem can't be fast.
Instead of using two URem only use one and replace the second one with
select/add (this is what the corresponding aos code already does).
2010-10-09 00:36:38 +02:00
Roland Scheidegger
318bb080b0 gallivm: more linear tex wrap mode calculation simplification
Rearrange order of operations a bit to make some clamps easier.
All calculations should be equivalent.
Note there seems to be some inconsistency in the clamp to edge case
wrt normalized/non-normalized coords, could potentially simplify this too.
2010-10-09 00:36:38 +02:00
Roland Scheidegger
99ade19e6e gallivm: optimize some tex wrap mode calculations a bit
Sometimes coords are clamped to positive numbers before doing conversion
to int, or clamped to 0 afterwards, in this case can use itrunc
instead of ifloor which is easier. This is only the case for nearest
calculations unfortunately, except linear MIRROR_CLAMP_TO_EDGE which
for the same reason can use a unsigned float build context so the
ifloor_fract helper can reduce this to itrunc in the ifloor helper itself.
2010-10-09 00:36:38 +02:00
Roland Scheidegger
1e17e0c4ff gallivm: replace sub/floor/ifloor combo with ifloor_fract 2010-10-09 00:36:37 +02:00
Roland Scheidegger
cb3af2b434 gallivm: faster iround implementation for sse2
sse2 supports round to nearest directly (or rather, assuming default nearest
rounding mode in MXCSR). Use intrinsic to use this rather than round (sse41)
or bit manipulation whenever possible.
2010-10-09 00:36:37 +02:00
Roland Scheidegger
0ed8c56bfe gallivm: fix trunc/itrunc comment
trunc of -1.5 is -1.0 not 1.0...
2010-10-09 00:36:37 +02:00
Vinson Lee
0f4984a0fb i915: Silence unused variable warning in non-debug builds.
Fixes this GCC warning.
i830_vtbl.c: In function 'i830_assert_not_dirty':
i830_vtbl.c:704: warning: unused variable 'i830'
2010-10-08 15:35:35 -07:00
Ian Romanick
48156b87bc docs: Update status of GL 3.x related extensions 2010-10-08 14:55:27 -07:00
Ian Romanick
1d3027b507 docs: skeleton for 7.10 release notes 2010-10-08 14:50:34 -07:00
Ian Romanick
0ea8b99332 glsl: Remove const decoration from inlined function parameters
The constness of the function parameter gets inlined with the rest of
the function.  However, there is also an assignment to the parameter.
If this occurs inside a loop the loop analysis code will get confused
by the assignment to a read-only variable.

Fixes bugzilla #30552.

NOTE: this is a candidate for the 7.9 branch.
2010-10-08 14:29:11 -07:00
Ian Romanick
dc459f8756 intel: Enable GL_ARB_explicit_attrib_location 2010-10-08 14:21:23 -07:00
Ian Romanick
dbc6c9672d main: Enable GL_ARB_explicit_attrib_location for swrast 2010-10-08 14:21:23 -07:00
Ian Romanick
68a4fc9d5a glsl: Add linker support for explicit attribute locations 2010-10-08 14:21:23 -07:00
Ian Romanick
eee68d3631 glsl: Track explicit location in AST to IR translation 2010-10-08 14:21:23 -07:00
Ian Romanick
2b45ba8bce glsl: Regenerate files changes by previous commit 2010-10-08 14:21:23 -07:00
Ian Romanick
7f68cbdc4d glsl: Add parser support for GL_ARB_explicit_attrib_location layouts
Only layout(location=#) is supported.  Setting the index requires GLSL
1.30 and GL_ARB_blend_func_extended.
2010-10-08 14:21:22 -07:00
Ian Romanick
eafebed5bd glcpp: Regenerate files changes by previous commit 2010-10-08 14:21:22 -07:00
Ian Romanick
e0c9f67be5 glcpp: Add the define for ARB_explicit_attrib_location when present 2010-10-08 14:21:22 -07:00
Ian Romanick
5ed6610d11 glsl: Regenerate files modified by previous commits 2010-10-08 14:21:22 -07:00
Ian Romanick
e24d35a5b5 glsl: Wrap ast_type_qualifier contents in a struct in a union
This will ease adding non-bit fields in the near future.
2010-10-08 14:21:22 -07:00
Ian Romanick
5ff4cfb788 glsl: Clear type_qualifier using memset 2010-10-08 14:21:22 -07:00
Ian Romanick
fd2aa7d313 glsl: Slight refactor of error / warning checking for ARB_fcc layout 2010-10-08 14:21:22 -07:00
Ian Romanick
dd93035a4d glsl: Refactor 'layout' grammar to match GLSL 1.60 spec grammar 2010-10-08 14:21:22 -07:00
Ian Romanick
4b5489dd6f glsl: Fail linking if assign_attribute_locations fails 2010-10-08 14:21:22 -07:00
Vinson Lee
3b16c591a4 r600g: Silence uninitialized variable warning. 2010-10-08 14:17:14 -07:00
Vinson Lee
36b65a373a r600g: Silence uninitialized variable warning. 2010-10-08 14:14:16 -07:00
Vinson Lee
131485efae r600g: Silence uninitialized variable warning. 2010-10-08 14:08:50 -07:00
Vinson Lee
5e90971475 gallivm: Remove unnecessary header. 2010-10-08 14:03:10 -07:00
Eric Anholt
c52a0b5c7d i965: Add register coalescing to the new FS backend.
Improves performance of my GLSL demo 14.3% (+/- 4%, n=4) by
eliminating the moves used in ir_assignment and ir_swizzle handling.
Still 16.5% to go to catch up to the Mesa IR backend, presumably
because instructions are almost perfectly mis-scheduled now.
2010-10-08 13:22:27 -07:00
Eric Anholt
80c0077a6f i965: Enable attribute swizzling (repositioning) in the gen6 SF.
We were trying to remap a fully-filled array down to only handing the
WM the components it uses.  This is called attribute swizzling, and if
you don't enable it you just get 1:1 mappings of inputs to outputs.

This almost fixes glsl-routing, except for the highest gl_TexCoord[]
indices.
2010-10-08 12:00:04 -07:00
Eric Anholt
cac04a9397 i965: Fix new FS gen6 interpolation for sparsely-populated arrays.
We'd overwrite the same element twice.
2010-10-08 11:59:19 -07:00
Eric Anholt
624ce6f61b i965: Fix gen6 WM push constants updates.
We would compute a new buffer, but never point the hardware at the new
buffer.  This partially fixes glsl-routing, as now it get the updated
uniform for which attribute to draw.
2010-10-08 11:59:19 -07:00
José Fonseca
3fde8167a5 gallivm: Help for combined extraction and broadcasting.
Doesn't change generated code quality, but saves some typing.
2010-10-08 19:48:16 +01:00
José Fonseca
438390418d llvmpipe: First minify the texture size, then broadcast. 2010-10-08 19:11:52 +01:00
José Fonseca
f5b5fb32d3 gallivm: Move into the as much of the second level code as possible.
Also, pass more stuff trhough the sample build context, instead of
arguments.
2010-10-08 19:11:52 +01:00
Eric Anholt
5b24d69fcd i965: Handle swizzles in the addition of YUV texture constants.
If someone happened to land a set in a different swizzle order, we
would have assertion failed.
2010-10-08 10:24:30 -07:00
Eric Anholt
0534e958c9 i965: Drop the check for YUV constants in the param list.
_mesa_add_unnamed_constant() already does that.
2010-10-08 10:24:29 -07:00
Eric Anholt
fa8aba9da4 i965: Drop the check for duplicate _mesa_add_state_reference.
_mesa_add_state_reference does that check for us anyway.
2010-10-08 10:24:29 -07:00
Eric Anholt
e310c22bb7 mesa: Simplify a bit of _mesa_add_state_reference using memcmp. 2010-10-08 10:24:29 -07:00
José Fonseca
6b0c79e058 gallivm: Warn when doing inefficient integer comparisons. 2010-10-08 17:43:15 +01:00
José Fonseca
d5ef59d8b0 gallivm: Avoid control flow for two-sided stencil test. 2010-10-08 17:43:15 +01:00
Keith Whitwell
ef3407672e llvmpipe: fix off-by-one in tri_16 2010-10-08 17:30:08 +01:00
Keith Whitwell
0ff132e5a6 llvmpipe: add rast_tri_4_16 for small lines and points 2010-10-08 17:30:08 +01:00
Keith Whitwell
eeb13e2352 llvmpipe: clean up setup_tri a little 2010-10-08 17:30:08 +01:00
Keith Whitwell
e191bf4a85 gallivm: round rather than truncate in new 4x4f->1x16ub conversion path 2010-10-08 17:30:08 +01:00
José Fonseca
f91b4266c6 gallivm: Use the wrappers for SSE pack intrinsics.
Fixes assertion failures on LLVM 2.6.
2010-10-08 17:30:08 +01:00
Keith Whitwell
607e3c542c gallivm: special case conversion 4x4f to 1x16ub
Nice reduction in the number of operations required for final color
output in many shaders.
2010-10-08 17:30:08 +01:00
Keith Whitwell
29d6a1483d llvmpipe: avoid overflow in triangle culling
Avoid multiplying fixed-point values.  Calculate triangle area in
floating point use that for culling.

Lift area calculations up a level as we are already doing this in the
triangle_both() case.

Would like to share the calculated area with attribute interpolation,
but the way the code is structured makes this difficult.
2010-10-08 17:30:08 +01:00
Keith Whitwell
ad6730fadb llvmpipe: fail gracefully on oom in scene creation 2010-10-08 17:26:29 +01:00
José Fonseca
eb605701aa gallivm: Implement brilinear filtering. 2010-10-08 15:50:28 +01:00
José Fonseca
c8179ef5e8 gallivm: Fix copy'n'paste typo in previous commit. 2010-10-08 14:09:22 +01:00
José Fonseca
df7a2451b1 gallivm: Clamp mipmap level and zero mip weight simultaneously. 2010-10-08 14:06:38 +01:00
José Fonseca
0d84b64a4f gallivm: Use lp_build_ifloor_fract for lod computation.
Forgot this one before.
2010-10-08 14:06:38 +01:00
José Fonseca
4f2e2ca4e3 gallivm: Don't compute the second mipmap level when frac(lod) == 0 2010-10-08 14:06:37 +01:00
José Fonseca
05fe33b71c gallivm: Simplify lp_build_mipmap_level_sizes' interface. 2010-10-08 14:06:37 +01:00
José Fonseca
4eb222a3e6 gallivm: Do not do mipfiltering when magnifying.
If lod < 0, then invariably follows that ilevel0 == ilevel1 == 0.
2010-10-08 14:06:37 +01:00
Vinson Lee
1f01f5cfcf r600g: Remove unnecessary header. 2010-10-08 04:56:49 -07:00
Dave Airlie
8d6a38d7b3 r600g: drop width/height per level storage.
these aren't used anywhere, so just waste memory.
2010-10-08 19:55:05 +10:00
Eric Anholt
bbb840049e i965: Normalize cubemap coordinates like is done in the Mesa IR path.
Fixes glsl-fs-texturecube-2-*
2010-10-07 16:41:13 -07:00
Eric Anholt
4d202da7a4 i965: Disable emitting if () statements on gen6 until we really fix them. 2010-10-07 16:41:13 -07:00
Dave Airlie
1ae5cc2e67 r600g: add some RG texture format support. 2010-10-08 09:37:02 +10:00
Kristian Høgsberg
1d595c7cd4 gles2: Add GL_EXT_texture_format_BGRA8888 support 2010-10-07 17:08:50 -04:00
José Fonseca
321ec1a224 gallivm: Vectorize the rho computation. 2010-10-07 22:08:42 +01:00
Dave Airlie
51f9cc4759 r600g: fix Z export enable bits.
we should be checking output array not input to decide.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-10-07 15:32:05 +10:00
Dave Airlie
97eea87bde r600g: use format from the sampler view not from the texture.
we want to use the format from the sampler view which isn't always the
same as the texture format when creating sampler views.
2010-10-07 15:17:28 +10:00
Andre Maasikas
84457701b0 r600g: fix evergreen interpolation setup
interp data is stored in gpr0 so first interp overwrote it
and subsequent ones got wrong values

reserve register 0 so it's not used for attribs.
alternative is to interpolate attrib0 last (reverse, as r600c does)
2010-10-07 07:51:32 +03:00
Chia-I Wu
b2c0ef8b51 st/vega: Fix version check in context creation.
This fixes a regression since 4531356817.
2010-10-07 12:15:31 +08:00
Chia-I Wu
da495ee870 targets/egl: Fix linking with libdrm. 2010-10-07 12:06:59 +08:00
Eric Anholt
d3163912c1 i965: Fix gen6 pointsize handling to match pre-gen6.
Fixes point-line-no-cull.
Bug #30532
2010-10-06 17:29:29 -07:00
Eric Anholt
b380531fd4 i965: Don't assume that WPOS is always provided on gen6 in the new FS.
We sensibly only provide it if the FS asks for it.  We could actually
skip WPOS unless the FS needed WPOS.zw, but that's something for
later.

Fixes: glsl-texture2d and probably many others.
2010-10-06 12:13:08 -07:00
Eric Anholt
1fdc8c007e i965: Add support for gl_FrontFacing on gen6.
Fixes glsl1-gl_FrontFacing var (2) with new FS.
2010-10-06 12:13:08 -07:00
Eric Anholt
a760b5b509 i965: Refactor gl_FrontFacing setup out of general variable setup. 2010-10-06 12:13:08 -07:00
Eric Anholt
75270f705f i965: Gen6's sampler messages are the same as Ironlake.
This should fix texturing in the new FS backend.
2010-10-06 12:13:08 -07:00
Eric Anholt
fe6efc25ed i965: Don't do 1/w multiplication in new FS for gen6
Not needed now that we're doing barycentric.
2010-10-06 12:13:08 -07:00
Eric Anholt
5d99b01501 i965: Add some clarification of the WECtrl field. 2010-10-06 12:13:08 -07:00
Eric Anholt
5eeaf3671e i965: Fix botch in the header_present case in the new FS.
I only set it on the color_regions == 0 case, missing the important
case, causing GPU hangs on pre-gen6.
2010-10-06 12:13:08 -07:00
José Fonseca
9fe510ef35 llvmpipe: Cleanup depth-stencil clears.
Only cosmetic changes. No actual practical difference.
2010-10-06 19:08:21 +01:00
José Fonseca
33f88b3492 util: Cleanup util_pack_z_stencil and friends.
- Handle PIPE_FORMAT_Z32_FLOAT packing correctly.

- In the integer version z shouldn't be passed as as double.

- Make it clear that the integer versions should only be used for masks.

- Make integer type sizes explicit (uint32_t for now, although
  uint64_t will be necessary later to encode f32_s8_x24).
2010-10-06 19:08:18 +01:00
José Fonseca
87dd859b34 gallivm: Compute lod as integer whenever possible.
More accurate/faster results for PIPE_TEX_MIPFILTER_NEAREST. Less
FP <-> SI conversion overall.
2010-10-06 18:51:25 +01:00
José Fonseca
1c32583581 gallivm: Only apply min/max_lod when necessary. 2010-10-06 18:50:57 +01:00
Keith Whitwell
5849a6ab64 gallivm: don't apply zero lod_bias 2010-10-06 18:49:32 +01:00
José Fonseca
af05f61576 gallivm: Combined ifloor & fract helper.
The only way to ensure we don't do redundant FP <-> SI conversions.
2010-10-06 18:47:01 +01:00
José Fonseca
012d57737b gallivm: Fast implementation of iround(log2(x))
Not tested yet, but should be correct.
2010-10-06 18:46:59 +01:00
José Fonseca
4648846bd6 gallivm: Use a faster (and less accurate) log2 in lod computation. 2010-10-06 18:46:29 +01:00
José Fonseca
df3505b193 gallivm: Take the type signedness in consideration in round/ceil/floor. 2010-10-06 18:46:08 +01:00
Eric Anholt
feca660939 i965: Fix up IF/ELSE/ENDIF for gen6.
The jump delta is now in the part of the instruction where the
destination fields used to be, and the src args are ignored (or not,
for the new non-predicated IF that we don't use yet).
2010-10-06 10:09:45 -07:00
Eric Anholt
f7cb28fad9 i965: Gen6 no longer has the IFF instruction; always use IF. 2010-10-06 10:09:45 -07:00
Eric Anholt
3c97c00e38 i965: Add back gen6 headerless FB writes to the new FS backend.
It's not that hard to detect when we need the header.
2010-10-06 10:09:44 -07:00
Jerome Glisse
3fabd218a0 r600g: fix dirty state handling
Avoid having object ending up in dead list of dirty object.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-10-06 13:01:31 -04:00
Eric Anholt
634abbf7b2 i965: Also do constant propagation for the second operand of CMP.
We could do the first operand as well by flipping the comparison, but
this covered several CMPs in code I was looking at.
2010-10-06 09:33:26 -07:00
Eric Anholt
dcd0261aff i965: Enable the constant propagation code.
A debug disable had slipped in.
2010-10-06 09:33:26 -07:00
Jerome Glisse
1644bb0f40 r600g: avoid segfault due to unintialized list pointer
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-10-06 09:41:19 -04:00
José Fonseca
06472ad7e8 llvmpipe: Fix sprite coord perspective interpolation of Q.
Q coordinate's coefficients also need to be multiplied by w, otherwise
it will have 1/w, causing problems with TXP.
2010-10-06 11:46:41 +01:00
José Fonseca
e74955eba3 llvmpipe: Fix perspective interpolation for point sprites.
Once a fragment is generated with LP_INTERP_PERSPECTIVE set for an input,
it will do a divide by w for that input. Therefore it's not OK to treat LP_INTERP_PERSPECTIVE as
LP_INTERP_LINEAR or vice-versa, even if the attribute is known to not
vary.

A better strategy would be to take the primitive in consideration when
generating the fragment shader key, and therefore avoid the per-fragment
perspective divide.
2010-10-06 11:44:59 +01:00
José Fonseca
446dbb9217 llvmpipe: Dump a few missing shader key flags. 2010-10-06 11:41:08 +01:00
Keith Whitwell
591e1bc34f llvmpipe: make debug_fs_variant respect variant->nr_samplers 2010-10-06 11:40:30 +01:00
José Fonseca
5661e51c01 retrace: Handle clear_render_target and clear_depth_stencil. 2010-10-06 11:37:49 +01:00
Dave Airlie
9528fc2107 r600g: add evergreen stencil support.
this sets the stencil up for evergreen properly.
2010-10-06 09:21:16 +10:00
Jerome Glisse
ea5a74fb58 r600g: userspace fence to avoid kernel call for testing bo busy status
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-10-05 17:04:25 -04:00
Brian Paul
3d6eec0a87 st/mesa: replace assertion w/ conditional in framebuffer invalidation
https://bugs.freedesktop.org/show_bug.cgi?id=30632

NOTE: this is a candidate for the 7.9 branch.
2010-10-05 14:33:17 -06:00
Jerome Glisse
2cf3199ee3 r600g: simplify block relocation
Since flush rework there could be only one relocation per
register in a block.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-10-05 15:23:07 -04:00
Bas Nieuwenhuizen
ac8a1ebe55 r600g: use dirty list to track dirty blocks
Got a speed up by tracking the dirty blocks in a seperate list instead of looping through all blocks. This version should work with block that get their dirty state disabled again and I added a dirty check during the flush as some blocks were already dirty.
2010-10-05 15:16:06 -04:00
Ian Romanick
b2e52cdf83 docs: added news item for 7.9 release
Also fix link to release notes in 7.9-rc1 news item.
2010-10-05 10:07:16 -07:00
Ian Romanick
cdf29c44ed docs: Import news updates from 7.9 branch
Partially cherry-picked from commit 61653b488d
2010-10-05 10:05:04 -07:00
Ian Romanick
8f32c64bd1 docs: Update mailing lines from sf.net to freedesktop.org
(cherry picked from commit c19bc5de96)
2010-10-05 10:02:30 -07:00
Ian Romanick
13a90e8900 docs: download.html does not need to be updated for each release
(cherry picked from commit 41e371e351)
2010-10-05 10:02:10 -07:00
Ian Romanick
d0981675cc docs: Import 7.8.x release notes from 7.8 branch. 2010-10-05 10:01:34 -07:00
Ian Romanick
792b0308fc docs: Import 7.9 release notes from 7.9 branch. 2010-10-05 09:54:41 -07:00
Nicolas Kaiser
71fd35d1ad nv50: fix always true conditional in shader optimization 2010-10-05 18:53:15 +02:00
Jerome Glisse
585e4098aa r600g: improve bo flushing
Flush read cache before writting register. Track flushing inside
of a same cs and avoid reflushing same bo if not necessary. Allmost
properly force flush if bo rendered too and then use as a texture
in same cs (missing pipeline flush dunno if it's needed or not).

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-10-05 10:43:23 -04:00
Jerome Glisse
12d16e5f14 r600g: store reloc information in bo structure
Allow fast lookup of relocation information & id which
was a CPU time consumming operation.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-10-05 10:42:56 -04:00
Dave Airlie
bf21b7006c pb: fix numDelayed accounting
we weren't decreasing when removing from the list.
2010-10-05 19:08:41 +10:00
Dave Airlie
12be1568d0 r600g: avoid unneeded bo wait
if we know the bo has gone not busy, no need to add another bo wait

thanks to Andre (taiu) on irc for pointing this out.
2010-10-05 16:00:48 +10:00
Dave Airlie
d2c06b5037 r600g: drop use_mem_constant.
since we plan on using dx10 constant buffers everywhere.
2010-10-05 16:00:23 +10:00
Dave Airlie
46997d4fc2 r600g: drop mman allocator
we don't use this since constant buffers are now being used on all gpus.
2010-10-05 15:57:57 +10:00
Dave Airlie
05813ad5f4 r600g: add bo busy backoff.
When we go to do a lot of bos in one draw like constant bufs we need
to avoid bouncing off the busy ioctl, this mitigates by backing off
on busy bos for a short amount of times.
2010-10-05 15:51:38 +10:00
Dave Airlie
49866c8f34 pb: don't keep checking buffers after first busy
If we assume busy buffers are added to the list in order its unlikely
we'd fine one after the first busy one that isn't busy.
2010-10-05 15:50:58 +10:00
Dave Airlie
3c38e4f138 r600g: add bo fenced list.
this just keeps a list of bos submitted together, and uses them to decide
bo busy state for the whole group.
2010-10-05 15:35:52 +10:00
Brian Paul
fb5e6f88fc swrast: fix choose_depth_texture_level() to respect mipmap filtering state
NOTE: this is a candidate for the 7.9 branch.
2010-10-04 19:59:46 -06:00
Marek Olšák
d0408cf55d r300g: fix microtiling for 16-bits-per-channel formats
These texture formats (like R16G16B16A16_UNORM) were untested until now
because st/mesa doesn't use them. I am testing this with a hacked st/mesa
here.
2010-10-05 02:57:00 +02:00
Marek Olšák
57b7300804 update release notes for Gallium
I am trying to be exhaustive, but still I might have missed tons of other
changes to Gallium.
(cherry picked from commit 968a9ec76e)

Conflicts:

	docs/relnotes-7.9.html
2010-10-05 02:56:59 +02:00
Ian Romanick
4d435c400d docs: Add list of bugs fixed in 7.9 2010-10-04 17:39:48 -07:00
Eric Anholt
ea909be58d i965: Add support for gen6 FB writes to the new FS.
This uses message headers for now, since we'll need it for MRT.  We
can cut out the header later.
2010-10-04 16:08:17 -07:00
Eric Anholt
739aec39bd i965: In disasm, gen6 fb writes don't put msg reg # in destreg_conditionalmod.
It instead sensibly appears in the src0 slot.
2010-10-04 16:08:17 -07:00
Eric Anholt
3bf8774e9c i965: Add initial folding of constants into operand immediate slots.
We could try to detect this in expression handling and do it
proactively there, but it seems like less logic to do it in one
optional pass at the end.
2010-10-04 16:08:17 -07:00
Eric Anholt
e27c88d8e6 i965: Add trivial dead code elimination in the new FS backend.
The glsl core should be handling most dead code issues for us, but we
generate some things in codegen that may not get used, like the 1/w
value or pixel deltas.  It seems a lot easier this way than trying to
work out up front whether we're going to use those values or not.
2010-10-04 16:08:17 -07:00
Eric Anholt
9faf64bc32 i965: Be more conservative on live interval calculation.
This also means that our intervals now highlight dead code.
2010-10-04 16:08:17 -07:00
Vinson Lee
a0a8e24385 r600g: Fix SCons build. 2010-10-04 15:56:55 -07:00
Jerome Glisse
b25c52201b r600g: remove dead label & fix indentation
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-10-04 17:25:19 -04:00
Jerome Glisse
243d6ea609 r600g: rename radeon_ws_bo to r600_bo
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-10-04 17:25:19 -04:00
Jerome Glisse
674452faf9 r600g: use r600_bo for relocation argument, simplify code
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-10-04 17:25:19 -04:00
Jerome Glisse
d22a1247d8 r600g: allow r600_bo to be a sub allocation of a big bo
Add bo offset everywhere needed if r600_bo is ever a sub bo
of a bigger bo.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-10-04 17:25:19 -04:00
Jerome Glisse
294c9fce1b r600g: rename radeon_ws_bo to r600_bo
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-10-04 17:25:19 -04:00
delphi
25bb05fef0 draw: added userclip planes and updated variant_key 2010-10-04 22:08:16 +01:00
Krzysztof Smiechowicz
68c7994ab5 nvfx: Pair os_malloc_aligned() with os_free_aligned().
From AROS.
2010-10-04 11:43:29 -07:00
Dave Airlie
3d45d57044 r600g: TODO domain management
no wonder it was slow, the code is deliberately forcing stuff into GTT,
we used to have domain management but it seems to have disappeared.
2010-10-04 16:41:49 +10:00
Dave Airlie
1c2b3cb1e9 r600g: fix wwarning in bo_map function 2010-10-04 16:26:46 +10:00
Dave Airlie
6dc051557d r600g: the code to check whether a new vertex shader is needed was wrong
this code was memcmp'ing two structs, but refcounting one of them afterwards,
so any subsequent memcmp was never going to work.

again this stops unnecessary uploads of vertex program,
2010-10-04 16:24:59 +10:00
Dave Airlie
92aba9c1f5 r600g: break out of search for reloc bo after finding it.
this function was taking quite a lot of pointless CPU.
2010-10-04 15:58:39 +10:00
Eric Anholt
14bf92ba19 i965: Fix glean/texSwizzle regression in previous commit.
Easy enough patch, who needs a full test run.  Oh, that's right.  Me.
2010-10-03 00:24:09 -07:00
Eric Anholt
a7fa00dfc5 i965: Set up swizzling of shadow compare results for GL_DEPTH_TEXTURE_MODE.
The brw_wm_surface_state.c handling of GL_DEPTH_TEXTURE_MODE doesn't
apply to shadow compares, which always return an intensity value.  The
texture swizzles can do the job for us.

Fixes:
glsl1-shadow2D(): 1
glsl1-shadow2D(): 3
2010-10-02 23:48:14 -07:00
Eric Anholt
4fb0c92c69 i965: Add support for EXT_texture_swizzle to the new FS backend. 2010-10-02 23:44:44 -07:00
Marek Olšák
8f7177e0de r300g: add support for L8A8 colorbuffers
Blending with DST_ALPHA is undefined. SRC_ALPHA works, though.
I bet some other formats have similar limitations too.
2010-10-02 23:19:38 +02:00
Marek Olšák
e75bce026c r300g: add support for R8G8 colorbuffers
The hw swizzles have been obtained by a brute force approach,
and only C0 and C2 are stored in UV88, the other channels are
ignored.

R16G16 is going to be a lot trickier.
2010-10-02 21:42:22 +02:00
Dave Airlie
71a079fb4e mesa/st: initial attempt at RG support for gallium drivers
passes all piglit RG tests with softpipe.
2010-10-02 17:03:15 +10:00
Kenneth Graunke
f317713432 i965: Fix incorrect batchbuffer size in gen6 clip state command.
FORCE_ZERO_RTAINDEX should be in the fourth (and final) dword.
2010-10-01 21:53:28 -07:00
Eric Anholt
64a9fc3fc1 i965: Don't try to emit code if we failed register allocation. 2010-10-01 17:19:04 -07:00
Eric Anholt
6397addd61 i965: Fix off-by-ones in handling the last members of register classes.
Luckily, one of them would result in failing out register allocation
when the other bugs were encountered.  Applies to
glsl-fs-vec4-indexing-temp-dst-in-nested-loop-combined, which still
fails register allocation, but now legitimately.
2010-10-01 17:19:04 -07:00
Eric Anholt
afb64311e3 i965: Add a sanity check for register allocation sizes. 2010-10-01 17:19:03 -07:00
Eric Anholt
5ee0941316 i965: When producing a single channel swizzle, don't make a temporary.
This quickly cuts 8% of the instructions in my glsl demo.
2010-10-01 17:19:03 -07:00
Eric Anholt
a0799725f5 i965: Restore the forcing of aligned pairs for delta_xy on chips with PLN.
By doing so using the register allocator now, we avoid wasting a
register to make the alignment happen.
2010-10-01 17:19:03 -07:00
Alex Deucher
fb0eed84ca r600c: fix segfault in evergreen stencil code
Fixes:
https://bugs.freedesktop.org/show_bug.cgi?id=30551
2010-10-01 20:14:25 -04:00
Vinson Lee
7af2a22d1f r600g: Remove unnecessary headers. 2010-10-01 17:06:33 -07:00
Vinson Lee
20846a8ce1 r600g: Remove unused variable.
Fixes this GCC warning.
r600_shader.c: In function 'tgsi_split_literal_constant':
r600_shader.c:818: warning: unused variable 'index'
2010-10-01 17:02:01 -07:00
Ian Romanick
1ca6cbec1b rgtc: Detect RGTC formats as color formats and as compressed formats 2010-10-01 16:55:35 -07:00
Ian Romanick
5ebbabc5cc mesa: Trivial correction to comment 2010-10-01 16:55:35 -07:00
Ian Romanick
69c78bf2c2 mesa: Fix misplaced #endif
If FEATURE_texture_s3tc is not defined, FXT1 formats would erroneously
fall through to the MESA_FORMAT_RGBA_FLOAT32 case.
2010-10-01 16:55:35 -07:00
Ian Romanick
7c6147014a ARB_texture_rg: Add GL_COMPRESSED_{RED,RG} cases in _mesa_is_color_format 2010-10-01 16:55:35 -07:00
Ian Romanick
e2a054b70c mesa: Add ARB_texture_compression_rgtc as an alias for EXT_texture_compression_rgtc
Change the name in the extension tracking structure to ARB (from EXT).
2010-10-01 16:55:35 -07:00
Vinson Lee
e5fd15199d savage: Remove unnecessary header. 2010-10-01 16:57:19 -07:00
Vinson Lee
841503fddf glsl: Remove unnecessary header. 2010-10-01 16:27:58 -07:00
Ian Romanick
c77cd9ec10 i965: Enable GL_ARB_texture_rg 2010-10-01 15:49:13 -07:00
Ian Romanick
9ef390dc14 mesa: Enable GL_ARB_texture_rg in software paths 2010-10-01 15:49:13 -07:00
Ian Romanick
421f4d8dc1 ARB_texture_rg: Allow RED and RG textures as FBO color buffer attachments 2010-10-01 15:49:13 -07:00
Ian Romanick
5d1387b2da ARB_texture_rg: Add R8, R16, RG88, and RG1616 internal formats 2010-10-01 15:49:13 -07:00
Ian Romanick
214a33f610 ARB_texture_rg: Handle RED and RG the same as RGB for tex env 2010-10-01 15:49:13 -07:00
Ian Romanick
cd5dea6401 ARB_texture_rg: Add GL_RED as a valid GL_DEPTH_TEXTURE_MODE 2010-10-01 15:49:13 -07:00
Ian Romanick
cc6f13def5 ARB_texture_rg: Add GL_TEXTURE_{RED,GREEN}_SIZE query support 2010-10-01 15:49:12 -07:00
Ian Romanick
3ebbc176f9 ARB_texture_rg: Correct some errors in RED / RG internal format handling
Fixes several problems:

The half-float, float, and integer internal formats depend on
ARB_texture_rg and other extensions.

RG_INTEGER is not a valid internal format.

Generic compressed formats depend on ARB_texture_rg, not
EXT_texture_compression_rgtc.

Use GL_RED instead of GL_R.
2010-10-01 15:49:12 -07:00
Ian Romanick
bb45ab0a96 ARB_texture_rg: Add GLX protocol support 2010-10-01 15:49:12 -07:00
Nicolas Kaiser
96efa8a923 i965g: use Elements macro instead of manual sizeofs
Signed-off-by: Nicolas Kaiser <nikai@nikai.net>
Signed-off-by: Brian Paul <brianp@vmware.com>
2010-10-01 16:41:13 -06:00
Eric Anholt
e9bcc83289 i965: Fix up copy'n'pasteo from moving coordinate setup around for gen4. 2010-10-01 14:09:00 -07:00
Eric Anholt
bfd9715c3c i965: Add real support for pre-gen5 texture sampling to the new FS.
Fixes 36 testcases, including glsl-fs-shadow2d*-bias which fail on the
Mesa IR backend.
2010-10-01 14:02:48 -07:00
richard
92eb07a281 evergreen : fix z format setting, enable stencil. 2010-10-01 16:10:02 -04:00
Eric Anholt
8f63a44636 i965: Pre-gen6, map VS outputs (not FS inputs) to URB setup in the new FS.
We should fix the SF to actually give us just the data we need, but
this fixes regressions in the new FS until then.

Fixes:
glsl-kwin-blur
glsl-routing
2010-10-01 12:21:51 -07:00
Eric Anholt
ff5ce9289b i965: Also increment attribute location when skipping unused slots.
Fixes glsl1-texcoord varying.
2010-10-01 12:19:21 -07:00
Eric Anholt
354c40a624 i965: Fix the gen6 jump size for BREAK/CONT in new FS.
Since gen5, jumps are in increments of 64 bits instead of increments
of 128-bit instructions.
2010-10-01 12:19:21 -07:00
Eric Anholt
efc4a6f790 i965: Add gen6 attribute interpolation to new FS backend.
Untested, since my hardware is not booting at the moment.
2010-10-01 12:19:21 -07:00
Jerome Glisse
29b491bd03 r600g: indentation fixes
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-10-01 10:26:58 -04:00
Dave Airlie
738aa29289 r600g: setup basic loop consts on r600 + evergreen.
this sets up a single loop constant like r600c does.
2010-10-01 16:06:31 +10:00
Dave Airlie
7777c997e0 r600g: only set the Z export if shader exports it. 2010-10-01 16:06:30 +10:00
Alex Deucher
0c39a53aa6 r600c: pull over 6xx/7xx vertex fixes for evergreen 2010-10-01 00:51:37 -04:00
Dave Airlie
539a2978ed r600g: flush SH cache on constant change on evergreen 2010-10-01 14:43:02 +10:00
Dave Airlie
b67aa5311f r600g: fix evergreen draw-buffers
just a typo in the register headers.
2010-10-01 14:24:14 +10:00
Dave Airlie
14c95bb4ee r600g: add cb flushing for extra buffers + depth buffer on r600/evergreen 2010-10-01 14:05:02 +10:00
Dave Airlie
ac225c76a6 r600g: sync vertex/texture cache on resources on evergreen
this gets rid of lots of the instability on evergreen,
which isn't surprising since it really broken not to flush caches.
2010-10-01 14:04:32 +10:00
Dave Airlie
d662195f00 r600g: fixup vertex format picking.
there are some vertex formats defined in r600c not in the docs.
2010-10-01 13:36:56 +10:00
Dave Airlie
e973221538 r600g: add assembler support for other vtx fetch fields.
this shouldn't change behaviour, just push the choice of what
to do out to the shader.
2010-10-01 13:36:56 +10:00
Eric Anholt
1d073cb2d9 i965: Split the gen4 and gen5 sampler handling apart.
Trying to track the insanity of the different argument layouts for
normal/shadow crossed with normal/lod/bias one generation at a time is
enough.

Fixes: glsl1-texture2D() with bias.
(first test passing in this code that doesn't pass without it!)
2010-09-30 20:23:40 -07:00
Eric Anholt
5f237a1ccb i965: Use the lowering pass for texture projection.
We should end up with the same code, but anyone else with this issue
could share the handling (which I got wrong for shadow comparisons in
the driver before).
2010-09-30 20:23:40 -07:00
Eric Anholt
aae338104f glsl: Add a lowering pass for texture projection. 2010-09-30 20:23:36 -07:00
Dave Airlie
35cfe286d6 r600g: realign evergreen code with r600 code.
fixes segfault in depth-tex-modes-glsl and OA startup.
2010-10-01 11:15:13 +10:00
Alex Deucher
a3e9998614 r600c: add reloc for CB_COLOR0_ATTRIB
We'll need a reloc for tiling eventually,
so add it now.
2010-09-30 20:55:54 -04:00
Dave Airlie
5eccdc62b9 r600g: add reloc for evergreen color attrib
we'll need this for color tiling on evergreen.
2010-10-01 10:52:09 +10:00
Dave Airlie
40ccb235d6 r600g: drop depth quirk on evergreen
none of the EG cards need the quirk.
2010-10-01 10:30:17 +10:00
Dave Airlie
05d1d86907 r600g: add winsys support for CTL constants.
These need to be emitted, we also need them to do proper vtx start,
instead of abusing index offset.
2010-10-01 10:30:16 +10:00
Dave Airlie
084c29baed r600g: fix evergreen depth flushing.
although evergreen can apparantly sample direct from 24-bit,
just make it work with the current method for now.
2010-10-01 10:17:20 +10:00
Dave Airlie
7ae4da8056 r600g: use Elements macro instead of manual sizeofs 2010-10-01 10:17:20 +10:00
Brian Paul
66992463ac draw: check for null sampler pointers
http://bugs.freedesktop.org/show_bug.cgi?id=30516
2010-09-30 16:42:17 -06:00
Brian Paul
542d6cb1b8 gallivm: added some comments 2010-09-30 16:42:17 -06:00
John Doe
40181aef60 r600g: keep a mapping around for each bo
Save a lot of call into the kernel and thus improve performances.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-30 17:53:36 -04:00
John Doe
dde1391cc9 r600g: don't double count dirty block
This avoid to overcount the number of dwords we need and
thus avoid maximazation of cs buffer use.

Signed-off-by: Jerome Glisse <jglisse@redhat.com
2010-09-30 17:38:18 -04:00
Jerome Glisse
113f1cdfce evergreeng: avoid overlapping border color btw VS & PS
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-30 17:07:28 -04:00
Eric Anholt
c6960e4471 i965: Fix new FS handling of builtin uniforms with packed scalars in structs.
We were pointing each element at the .x channel of the
ParameterValues.

Fixes glsl1-linear fog.
2010-09-30 13:45:42 -07:00
Eric Anholt
a7cddd7de3 mesa: Don't reference a W component in setting up a vec3 uniform component.
The 965 driver would try to set up storage for the W component, and
the offsets would get mixed up.
2010-09-30 13:45:42 -07:00
Eric Anholt
6f6542a483 i965: Fix whole-structure/array assignment in new FS.
We need to walk the type tree to get the right register types for
structure components.  Fixes glsl-fs-statevar-call.
2010-09-30 13:45:42 -07:00
Tom Fogal
3661f757ee Revert "Prefer intrinsics to handrolled atomic ops."
This reverts commit 5f66b340aa, quickly
fixing 30514.
2010-09-30 14:41:53 -06:00
Jerome Glisse
9d4ae914e2 r600g: fix constant & literal src splitting, also fix mplayer gl2 shader
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-30 16:33:12 -04:00
Tom Fogal
5f66b340aa Prefer intrinsics to handrolled atomic ops. 2010-09-30 13:20:57 -06:00
Tom Fogal
76a60faf52 Implement x86_64 atomics for compilers w/o intrinsics.
Really old gcc's (3.3, at least) don't have support for the
intrinsics we need.  This implements a fallback for that case.
2010-09-30 13:20:51 -06:00
Adam Jackson
0c86e1f294 i965: Update renderer strings for sandybridge
Signed-off-by: Adam Jackson <ajax@redhat.com>
2010-09-30 14:08:35 -04:00
Jerome Glisse
153105cfbf r600g: use constant buffer instead of register for constant
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-30 13:47:29 -04:00
Brian Paul
874f3a57ce gallivm: check for level=0 case in lp_build_minify()
This lets us avoid the shift and max() operations.
2010-09-30 10:53:30 -06:00
José Fonseca
4e6f5e8d43 gallivm: More comprehensive border usage logic. 2010-09-30 17:42:01 +01:00
Chia-I Wu
e2b51b7c5b st/egl: Drop context argument from egl_g3d_get_egl_image.
Fix a regression since 17eace581d.
2010-09-30 23:45:27 +08:00
Nicolas Kaiser
4160d947d2 st: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:31 -06:00
Nicolas Kaiser
bad10b961a math: remove duplicated includes
Remove duplicated includes.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:31 -06:00
Nicolas Kaiser
9674929bce main: remove duplicated includes
Remove duplicated includes.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:31 -06:00
Nicolas Kaiser
8c92a80b62 dri/savage: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:30 -06:00
Nicolas Kaiser
1663e6da2f dri/radeon: remove duplicated includes
Remove duplicated includes.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:30 -06:00
Nicolas Kaiser
a7670be8a1 dri/r600: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:30 -06:00
Nicolas Kaiser
223c4b4188 dri/r300: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:30 -06:00
Nicolas Kaiser
705d98deb8 dri/r128: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:29 -06:00
Nicolas Kaiser
f094b35207 dri/mga: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:29 -06:00
Nicolas Kaiser
1a98a46304 dri/intel: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:29 -06:00
Nicolas Kaiser
c24144f41f dri/i965: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:24 -06:00
Nicolas Kaiser
f831212eab dri/i915: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:24 -06:00
Nicolas Kaiser
b958dabe16 dri/i810: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:24 -06:00
Nicolas Kaiser
c24e062fdb dri/common: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:24 -06:00
Nicolas Kaiser
7eed3dba58 glx: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:23 -06:00
Nicolas Kaiser
3f28dbd9bb gallium/winsys: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:23 -06:00
Nicolas Kaiser
218d973786 gallium/st: remove duplicated includes
Remove duplicated includes.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:23 -06:00
Nicolas Kaiser
6f136094f4 gallium/softpipe: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:23 -06:00
Nicolas Kaiser
d2149f6f22 gallium/llvmpipe: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:23 -06:00
Nicolas Kaiser
3e472bee2d gallium/i915: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:22 -06:00
Nicolas Kaiser
b719c91c82 gallium/util: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:21 -06:00
Nicolas Kaiser
237fa8a81c gallium/rtasm: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:21 -06:00
Nicolas Kaiser
3b7b1db661 egl: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:21 -06:00
Nicolas Kaiser
7d0b89fda0 swrast: remove duplicated include
Remove duplicated include.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-30 09:36:20 -06:00
Francisco Jerez
065163bcd2 dri/nv10: Use fast Z clears. 2010-09-30 16:48:28 +02:00
Francisco Jerez
bdd19da218 dri/nouveau: Remove unnecessary flush. 2010-09-30 16:48:20 +02:00
Francisco Jerez
6f39280ba9 dri/nouveau: Have a smaller amount of larger scratch buffers.
Larger VBOs avoid many kernel trips to get them in sync with the GPU.
2010-09-30 16:46:46 +02:00
Chia-I Wu
ebeb4a7e8a mapi: Fix compiler warnings.
Do not use "void *" in arithmetics.
2010-09-30 17:09:59 +08:00
Chia-I Wu
d63b2622f1 st/egl: Skip single-buffered configs in EGL.
Let DRI2 report single-buffered configs and skip them in EGL.  This is
based on the patch by Luca Barbieri.
2010-09-30 17:04:56 +08:00
Chia-I Wu
6b2f1561ad egl: Check extensions.
Do not call into the driver if the extension for the called function is
not enabled.
2010-09-30 16:55:07 +08:00
Zhenyu Wang
72b368ae69 i965: always set tiling for fbo depth buffer on sandybridge
Sandybridge requires depth buffer must be tiling.

Fix 'fbo_firecube' demo.
2010-09-30 10:51:26 +08:00
Marek Olšák
83278d384e r300g: fix conditional rendering in non-wait path
NOTE: This is a candidate for the 7.9 branch.
2010-09-30 02:44:30 +02:00
Eric Anholt
ad1506c5ac i965: Remove my "safety counter" code from loops.
I've screwed this up enough times that I don't think it's worth it.
This time, it was that I was doing it once per top-level body
instruction instead of just once at the end of the loop body.
2010-09-29 16:40:31 -07:00
Eric Anholt
b90c7d1713 i965: Add live interval analysis and hook it up to the register allocator.
Fixes 13 piglit cases that failed at register allocation before.
2010-09-29 16:40:31 -07:00
Eric Anholt
e1261d3c49 i965: First cut at register allocation using graph coloring.
The interference is totally bogus (maximal), so this is equivalent to
our trivial register assignment before.  As in, passes the same set of
piglit tests.
2010-09-29 16:40:31 -07:00
Eric Anholt
9ff90b7230 ra: First cut at a graph-coloring register allocator for mesa.
Notably missing is choice of registers to spill.
2010-09-29 16:40:31 -07:00
Eric Anholt
21148e1c0a i965: Clean up the virtual GRF handling.
Now, virtual GRFs are consecutive integers, rather than offsetting the
next one by the size.  We need the size information to still be around
for real register allocation, anyway.
2010-09-29 16:40:31 -07:00
Dave Airlie
4378c17c88 r600g: return string for chip family
use same strings as r600c.
2010-09-30 09:17:20 +10:00
Dave Airlie
dbcd652602 r600g: clean up some code from move to new paths.
mainly remove 2 suffix from function names
2010-09-30 09:12:57 +10:00
Dave Airlie
2bc9d3f498 r600g: add L8A8 unorm.
fixes texEnv warnings.
2010-09-30 09:04:50 +10:00
Dave Airlie
534f7d5749 r600g: port r300g fix for X* formats in texformat code 2010-09-30 09:04:50 +10:00
Eric Anholt
0efea25c4b i956: Make new FS discard do its work in a temp, not the null reg!
Fixes:
glsl-fs-discard-02 (GPU hang)
glsl1-discard statement (2)
2010-09-29 15:52:36 -07:00
Eric Anholt
3da98c1ca5 i965: Fix use of undefined mem_ctx in vector splitting. 2010-09-29 15:51:05 -07:00
José Fonseca
e3ccfd4e03 gallivm: Use SSE4.1's ROUNDSS/ROUNDSD for scalar rounding. 2010-09-29 22:29:23 +01:00
José Fonseca
21f392c971 python/retrace: Handle set_index_buffer and draw_vbo. 2010-09-29 22:29:22 +01:00
José Fonseca
c7f33624f9 trace: Fix set_index_buffer and draw_vbo tracing. 2010-09-29 22:29:22 +01:00
Vinson Lee
02b8fb3ed5 r300/compiler: Move declaration before code.
Fixes this GCC warning on linux-x86 build.
r3xx_vertprog.c: In function ‘ei_if’:
r3xx_vertprog.c:396: warning: ISO C90 forbids mixed declarations and code
2010-09-29 14:22:20 -07:00
Vinson Lee
7c7fdef3b1 r300/compiler: Move declaration before code.
Fixes these GCC warnings on linux-x86 build.
r500_fragprog_emit.c: In function ‘emit_paired’:
r500_fragprog_emit.c:237: warning: ISO C90 forbids mixed declarations and code
r500_fragprog_emit.c: In function ‘emit_tex’:
r500_fragprog_emit.c:367: warning: ISO C90 forbids mixed declarations and code
r500_fragprog_emit.c: In function ‘emit_flowcontrol’:
r500_fragprog_emit.c:415: warning: ISO C90 forbids mixed declarations and code
r500_fragprog_emit.c: In function ‘r500BuildFragmentProgramHwCode’:
r500_fragprog_emit.c:633: warning: ISO C90 forbids mixed declarations and code
2010-09-29 14:13:49 -07:00
Vinson Lee
ae664daa25 r300/compiler: Move declaration before code.
Fixes these GCC warnings on linux-x86 build.
r500_fragprog.c: In function ‘r500_transform_IF’:
r500_fragprog.c:45: warning: ISO C90 forbids mixed declarations and code
r500_fragprog.c: In function ‘r500FragmentProgramDump’:
r500_fragprog.c:256: warning: ISO C90 forbids mixed declarations and code
2010-09-29 14:04:06 -07:00
Vinson Lee
a4f296d618 r300/compiler: Move declaration before code.
Fixes these GCC warnings on linux-x86 build.
r300_fragprog_emit.c: In function ‘emit_alu’:
r300_fragprog_emit.c:143: warning: ISO C90 forbids mixed declarations and code
r300_fragprog_emit.c:156: warning: ISO C90 forbids mixed declarations and code
r300_fragprog_emit.c: In function ‘finish_node’:
r300_fragprog_emit.c:271: warning: ISO C90 forbids mixed declarations and code
r300_fragprog_emit.c: In function ‘emit_tex’:
r300_fragprog_emit.c:344: warning: ISO C90 forbids mixed declarations and code
2010-09-29 13:56:27 -07:00
Vinson Lee
b96a391d14 r300/compiler: Remove declaration before code.
Fixes these GCC warnings on linux-x86 build.
r300_fragprog_swizzle.c: In function ‘r300_swizzle_is_native’:
r300_fragprog_swizzle.c:120: warning: ISO C90 forbids mixed declarations and code
r300_fragprog_swizzle.c: In function ‘r300_swizzle_split’:
r300_fragprog_swizzle.c:159: warning: ISO C90 forbids mixed declarations and code
2010-09-29 13:44:10 -07:00
Vinson Lee
dafbf480db r300/compiler: Move declaration before code.
Fixes this GCC warning on linux-x86 build.
radeon_rename_regs.c: In function ‘rc_rename_regs’:
radeon_rename_regs.c:112: warning: ISO C90 forbids mixed declarations and code
2010-09-29 13:40:45 -07:00
Vinson Lee
0d0273142a r300/compiler: Move declaration before code.
Fixes this GCC warning on linux-x86 build.
radeon_remove_constants.c: In function ‘rc_remove_unused_constants’:
radeon_remove_constants.c💯 warning: ISO C90 forbids mixed declarations and code
2010-09-29 13:34:56 -07:00
Vinson Lee
4cd4fd37aa r300/compiler: Move declaration before code.
Fixes these GCC warning on linux-x86 build.
radeon_optimize.c: In function ‘constant_folding’:
radeon_optimize.c:419: warning: ISO C90 forbids mixed declarations and code
radeon_optimize.c:425: warning: ISO C90 forbids mixed declarations and code
radeon_optimize.c:432: warning: ISO C90 forbids mixed declarations and code
2010-09-29 13:30:34 -07:00
Vinson Lee
38c31de445 r600g: Fix SCons build. 2010-09-29 13:14:34 -07:00
Vinson Lee
07a38505c6 r300/compiler: Move declaration before code.
Fixes these GCC warnings on linux-x86 build.
radeon_dataflow_deadcode.c: In function ‘push_branch’:
radeon_dataflow_deadcode.c:112: warning: ISO C90 forbids mixed declarations and code
radeon_dataflow_deadcode.c: In function ‘update_instruction’:
radeon_dataflow_deadcode.c:183: warning: ISO C90 forbids mixed declarations and code
radeon_dataflow_deadcode.c: In function ‘rc_dataflow_deadcode’:
radeon_dataflow_deadcode.c:352: warning: ISO C90 forbids mixed declarations and code
radeon_dataflow_deadcode.c:379: warning: ISO C90 forbids mixed declarations and code
2010-09-29 13:13:09 -07:00
Jerome Glisse
6abd7771c6 r600g: more cleanup
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-29 15:40:32 -04:00
Vinson Lee
7e536371f9 r600g: Update SConscript.
Fixes SCons build.
2010-09-29 12:16:39 -07:00
Vinson Lee
a9d5808232 r300/compiler: Move declaration before code.
Fixes this GCC warning on linux-x86 build.
radeon_pair_regalloc.c: In function ‘rc_pair_regalloc_inputs_only’:
radeon_pair_regalloc.c:330: warning: ISO C90 forbids mixed declarations and code
2010-09-29 12:15:14 -07:00
Vinson Lee
22c06a08e7 r600g: Update SConscript.
Fixes SCons build.
2010-09-29 12:09:21 -07:00
Vinson Lee
4f80a2d170 r300/compiler: Move declaration before code.
Fixes these GCC warnings on linux-x86 build.
radeon_pair_schedule.c: In function ‘emit_all_tex’:
radeon_pair_schedule.c:244: warning: ISO C90 forbids mixed declarations and code
radeon_pair_schedule.c: In function ‘destructive_merge_instructions’:
radeon_pair_schedule.c:291: warning: ISO C90 forbids mixed declarations and code
radeon_pair_schedule.c:438: warning: ISO C90 forbids mixed declarations and code
radeon_pair_schedule.c: In function ‘scan_read’:
radeon_pair_schedule.c:619: warning: ISO C90 forbids mixed declarations and code
radeon_pair_schedule.c: In function ‘scan_write’:
radeon_pair_schedule.c:645: warning: ISO C90 forbids mixed declarations and code
radeon_pair_schedule.c: In function ‘schedule_block’:
radeon_pair_schedule.c:673: warning: ISO C90 forbids mixed declarations and code
radeon_pair_schedule.c: In function ‘rc_pair_schedule’:
radeon_pair_schedule.c:730: warning: ISO C90 forbids mixed declarations and code
2010-09-29 12:02:02 -07:00
Jerome Glisse
1235becaa1 r600g: cleanup
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-29 15:06:04 -04:00
Vinson Lee
845bda34d0 r600g: Update SConscript.
This is a follow-up to commit 9c284b5cae.

Fixes SCons build.
2010-09-29 11:52:55 -07:00
Marek Olšák
94e9ab975c r300g: add support for formats beginning with X, like X8R8G8B8
This is actually a format translator fix.
2010-09-29 20:43:44 +02:00
Vinson Lee
4e07aadabb r300/compiler: Move declaration before code.
Fixes these GCC warnings on linux-x86 build.
radeon_pair_translate.c: In function ‘set_pair_instruction’:
radeon_pair_translate.c:153: warning: ISO C90 forbids mixed declarations and code
radeon_pair_translate.c:170: warning: ISO C90 forbids mixed declarations and code
radeon_pair_translate.c: In function ‘rc_pair_translate’:
radeon_pair_translate.c:336: warning: ISO C90 forbids mixed declarations and code
radeon_pair_translate.c:341: warning: ISO C90 forbids mixed declarations and code
2010-09-29 11:41:14 -07:00
Vinson Lee
45d22a9b20 r300/compiler: Move declaration before code.
Fixes these GCC warnings on linux-x86 build.
radeon_program_alu.c: In function ‘r300_transform_trig_simple’:
radeon_program_alu.c:882: warning: ISO C90 forbids mixed declarations and code
radeon_program_alu.c:932: warning: ISO C90 forbids mixed declarations and code
radeon_program_alu.c: In function ‘radeonTransformTrigScale’:
radeon_program_alu.c:996: warning: ISO C90 forbids mixed declarations and code
radeon_program_alu.c: In function ‘r300_transform_trig_scale_vertex’:
radeon_program_alu.c:1033: warning: ISO C90 forbids mixed declarations and code
2010-09-29 11:32:11 -07:00
Jerome Glisse
9c284b5cae r600g: delete old path
Lot of clean can now happen.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-29 14:28:48 -04:00
Vinson Lee
483971e649 r300/compiler: Move declaration before code.
Fixes this GCC warning on linux-x86 build.
radeon_emulate_loops.c: In function ‘rc_emulate_loops’:
radeon_emulate_loops.c:517: warning: ISO C90 forbids mixed declarations and code
2010-09-29 11:19:55 -07:00
Vinson Lee
760d7c5d7d r300/compiler: Move declaration before code.
Fixes these GCC warnings with linux-x86 build.
radeon_emulate_branches.c: In function ‘handle_if’:
radeon_emulate_branches.c:65: warning: ISO C90 forbids mixed declarations and code
radeon_emulate_branches.c:71: warning: ISO C90 forbids mixed declarations and code
radeon_emulate_branches.c: In function ‘handle_else’:
radeon_emulate_branches.c:94: warning: ISO C90 forbids mixed declarations and code
radeon_emulate_branches.c: In function ‘handle_endif’:
radeon_emulate_branches.c:201: warning: ISO C90 forbids mixed declarations and code
radeon_emulate_branches.c: In function ‘fix_output_writes’:
radeon_emulate_branches.c:267: warning: ISO C90 forbids mixed declarations and code
radeon_emulate_branches.c:284: warning: ISO C90 forbids mixed declarations and code
radeon_emulate_branches.c: In function ‘rc_emulate_branches’:
radeon_emulate_branches.c:307: warning: ISO C90 forbids mixed declarations and code
2010-09-29 11:10:08 -07:00
Vinson Lee
aa62416ae1 mesa: Fix printf format warning.
Fixes this GCC warning.
math/m_debug_xform.c: In function '_math_test_all_transform_functions':
math/m_debug_xform.c:320: warning: format not a string literal and no format arguments
2010-09-29 10:46:46 -07:00
Vinson Lee
9c841abebc mesa: Fix printf format warning.
Fixes this GCC warning.
math/m_debug_norm.c: In function '_math_test_all_normal_transform_functions':
math/m_debug_norm.c:365: warning: format not a string literal and no format arguments
2010-09-29 10:44:17 -07:00
Vinson Lee
ae0cd81189 mesa: Fix printf format warning.
Fixes this GCC warning.
math/m_debug_clip.c: In function '_math_test_all_cliptest_functions':
math/m_debug_clip.c:363: warning: format not a string literal and no format arguments
2010-09-29 10:30:04 -07:00
Jerome Glisse
5646964b13 r600g: use a hash table instead of group
Instead of creating group of register use a hash table
to lookup into which block each register belongs. This
simplify code a bit.

Signed-off-by: Jerome Glisse <jglisse@redhat.com
2010-09-29 12:44:32 -04:00
Brian Paul
0cb545a7f2 draw: pass sampler state down to llvm jit state
Fixes a regression caused from the change to make min/max lod dynamic
state.

https://bugs.freedesktop.org/show_bug.cgi?id=30437
2010-09-29 10:34:43 -06:00
Marek Olšák
698893889a Makefile: ensure Gallium's Makefile.xorg and SConscript.dri are in the tarball
Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-29 09:51:55 -06:00
José Fonseca
e3a3a5378e scons: New build= option, with support for checked builds.
Where checked build is compiler optimizations plus debugging checks --
ideal for testing CPU bound loads and running test automation loads.
2010-09-29 14:24:52 +01:00
José Fonseca
67450f0644 scons: New build= option, with support for checked builds.
Where checked build is compiler optimizations plus debugging checks --
ideal for testing CPU bound loads and running test automation loads.
2010-09-29 14:17:26 +01:00
José Fonseca
fdcc168a16 llvmpipe: Decouple sampler view and sampler state updates.
Fixes glean pbo crash.

It would be possible to avoid crashing without decoupling, but given
that state trackers give no guarantee that number of views is consistent,
that would likely cause too many state updates (or miss some).
2010-09-29 14:16:35 +01:00
Kristian Høgsberg
4b70fe8421 glx: Only remove drawables from the hash when we actually delete them
https://bugs.freedesktop.org/show_bug.cgi?id=30457
2010-09-29 08:32:29 -04:00
Dave Airlie
08839c4055 Revert "r600g: add initial vertex translate support."
This reverts commit 914b669b08.

I didn't mean to commit this yet, will redo in new state system once
we clean it up.
2010-09-29 20:04:00 +10:00
Hui Qi Tay
3744d1c7d3 draw: added viewport and cliptest flags
Corrections in store_clip to store clip coordinates in AoS form.
Viewport & cliptest flag options based on variant key.
Put back draw_pt_post_vs and now 2 paths based on whether clipping
occurs or not.
2010-09-29 10:11:59 +01:00
Hui Qi Tay
94f65d095a draw: cliptest and viewport done in a single loop in vertex shader
Cliptesting now done at the end of vs in draw_llvm instead of
draw_pt_post_vs.

Added viewport mapping transformation and further cliptesting to
vertex shader in draw_llvm.c

Alternative path where vertex header setup, clip coordinates store,
cliptesting and viewport mapping are done earlier in the vertex
shader.

Still need to hook this up properly according to the return value of
"draw_llvm_shader" function.
2010-09-29 10:10:09 +01:00
Zhenyu Wang
d4da253b29 Revert "i965: Always set tiling for depth buffer on sandybridge"
This reverts commit 0a1910c267.

oops, shouldn't apply tiling depth buffer for other chips as well.
2010-09-29 15:18:37 +08:00
Tom Stellard
b27a809266 r300/compiler: Don't merge instructions that write output regs and ALU result
https://bugs.freedesktop.org/show_bug.cgi?id=30415

NOTE: This is a candidate for the 7.9 branch.
2010-09-28 23:52:41 -07:00
Tom Stellard
1b76dde0cd r300/compiler: Don't use rc_error() unless the error is unrecoverable
https://bugs.freedesktop.org/show_bug.cgi?id=30416

NOTE: This is a candidate for the 7.9 branch.
2010-09-28 23:52:41 -07:00
Tom Stellard
d40ff5510c r300/compiler: Fix segfault in error path
https://bugs.freedesktop.org/show_bug.cgi?id=30415

NOTE: This is a candidate for the 7.9 branch.
2010-09-28 23:52:41 -07:00
Zhenyu Wang
73dab75b41 i965: fallback lineloop on sandybridge for now
Until we fixed GS hang issue.
2010-09-29 14:35:19 +08:00
Zhenyu Wang
0a1910c267 i965: Always set tiling for depth buffer on sandybridge
Sandybridge only support tiling depth buffer, always set tiling bit.

Fix 'fbo_firecube' demo.
2010-09-29 14:02:37 +08:00
Dave Airlie
28b57c56e2 r600g: remove old assert from new codepath
this fixes draw-elements-base-vertex
2010-09-29 14:52:39 +10:00
Dave Airlie
914b669b08 r600g: add initial vertex translate support. 2010-09-29 14:41:16 +10:00
Kenneth Graunke
565ff67688 glsl: "Copyright", not "Constantright"
Clearly this started out as ir_copy_propagation.cpp, but the search and
replace was a bit overzealous.
2010-09-28 21:17:33 -07:00
Eric Anholt
1747aa6755 i965: Add support for builtin uniforms to the new FS backend.
Fixes 8 piglit tests.
2010-09-28 16:31:10 -07:00
Eric Anholt
daacaac3c8 mesa: Move the list of builtin uniform info from ir_to_mesa to shared code.
I'm still not pleased with how builtin uniforms are handled, but as
long as we're relying on the prog_statevar stuff this seems about as
good as it'll get.
2010-09-28 16:26:58 -07:00
Eric Anholt
9ac910cfcd i965: Clean up obsolete FINISHME comment. 2010-09-28 16:26:58 -07:00
Eric Anholt
ff0eb45f47 i965: Fix array indexing of arrays of matrices.
The deleted code was meant to be handling indexing of a matrix, which
would have been a noop if it had been correct.
2010-09-28 16:26:49 -07:00
Dave Airlie
301ab49605 r600g: move radeon.h members around to add back map flushing. 2010-09-29 09:19:22 +10:00
Dave Airlie
53b3933ce6 r600g: add evergreen texture border support to new path 2010-09-29 09:19:22 +10:00
Dave Airlie
23be883c9b r600g: add back evergreen name. 2010-09-29 09:19:22 +10:00
Eric Anholt
17f3b8097d i965: Don't try to emit interpolation for unused varying slots.
Fixes:
glsl-fs-varying-array
glsl-texcoord-array
glsl-texcoord-array-2
glsl-vs-varying-array
2010-09-28 14:53:36 -07:00
Eric Anholt
5272c6a7a2 i965: Do interpolation for varying matrices and arrays in the FS backend.
Fixes:
glsl-array-varying-01
glsl-vs-mat-add-1
glsl-vs-mat-div-1
glsl-vs-mat-div-2
glsl-vs-mat-mul-2
glsl-vs-mat-mul-3
2010-09-28 14:50:59 -07:00
Eric Anholt
586b4b500f glsl: Also update implicit sizes of varyings at link time.
Otherwise, we'll often end up with gl_TexCoord being 0 length, for
example.  With ir_to_mesa, things ended up working out anyway, as long
as multiple implicitly-sized arrays weren't involved.
2010-09-28 14:37:26 -07:00
Eric Anholt
b9a59f0358 i965: Add support for ARB_fragment_coord_conventions to the new FS backend.
Fixes:
glsl-arb-frag-coord-conventions
glsl-fs-fragcoord
2010-09-28 13:42:52 -07:00
Eric Anholt
701c5f11c9 i965: Add support for ir_loop counters to the new FS backend.
Fixes:
glsl1-discard statement in for loop
glsl-fs-loop-two-counter-02
glsl-fs-loop-two-counter-04
2010-09-28 13:31:01 -07:00
Tilman Sauerbeck
35f94b1942 r600g: Cleaned up index buffer reference handling in the draw module.
This fixes a buffer leak.

Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-28 22:12:23 +02:00
Eric Anholt
89f6783d17 i965: Add support for MRT to the new FS backend.
Fixes these tests using gl_FragData or just gl_FragDepth:
glsl1-Preprocessor test (extension test 1)
glsl1-Preprocessor test (extension test 2)
glsl-bug-22603
2010-09-28 12:37:21 -07:00
Eric Anholt
86fd11262c i965: Add support for non-color render target write data to new FS backend.
This is the first time these payload bits have made sense to me,
outside of brw_wm_pass* structure.

Fixes: glsl1-gl_FragDepth writing
2010-09-28 12:37:21 -07:00
Vinson Lee
f46a61554f scons: Add program/sampler.cpp to SCons build.
This is a follow-up to commit a32893221c.

Fixes MinGW SCons build.
2010-09-28 12:03:45 -07:00
Eric Anholt
2999a44968 i965: Set up sampler numbers in the FS backend.
+10 piglits
2010-09-28 11:37:08 -07:00
Eric Anholt
a32893221c mesa: Pull ir_to_mesa's sampler number fetcher out to shared code. 2010-09-28 11:37:08 -07:00
Jerome Glisse
723a655ed3 r600g: avoid rebuilding the vertex shader if no change to input format
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-28 14:34:25 -04:00
Jerome Glisse
fe790a3c34 r600g: suspend/resume occlusion query around clear/copy
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-28 14:24:18 -04:00
Marek Olšák
11eb422a16 configure.ac: do not build xorg-r300g by default
NOTE: This is a candidate for the 7.9 branch.
2010-09-28 19:38:40 +02:00
Marek Olšák
a1aec2e2be configure.ac: look for libdrm_radeon before building gallium/r300,r600
NOTE: This is a candidate for the 7.9 branch.
2010-09-28 19:38:39 +02:00
Eric Anholt
9e96c737f8 i965: Subtract instead of adding when computing y delta in new FS backend.
Fixes 7 piglit cases.
2010-09-28 10:19:54 -07:00
Eric Anholt
5f7bd68149 i965: Add support for gl_FrontFacing to the new FS backend.
Fixes:
glsl1-gl_FrontFacing var (1)
glsl1-gl_FrontFacing var (2)
2010-09-28 10:10:44 -07:00
Eric Anholt
ef8e002c75 i965: Fix up part of my Sandybridge attributes support patch.
I confused the array sizing for number of files for the number of regs
in a file.
2010-09-28 10:10:42 -07:00
Eric Anholt
f1dba03056 i965: Fix all non-snb regression in the snb attribute interpolation commit.
This apparently had never been tested elsewhere before being merged to
master.
2010-09-28 10:10:42 -07:00
Eric Anholt
6bf12c8b73 i965: Add support for struct, array, and matrix uniforms to FS backend.
Fixes 16 piglit cases.
2010-09-28 09:33:31 -07:00
Eric Anholt
ba481f2046 i965: Add support for dereferencing structs to the new FS backend.
Fixes: glsl1-struct(2)
2010-09-28 09:33:31 -07:00
Eric Anholt
07fc8eed8f i965: Set the variable type when dereferencing an array.
We don't set the type on the array virtual reg as a whole, so here's
the right place.

Fixes:
glsl1-GLSL 1.20 arrays
glsl1-temp array with constant indexing, fragment shader
glsl1-temp array with swizzled variable indexing
2010-09-28 09:33:31 -07:00
Eric Anholt
719f84d9ab i965: Fix up the FS backend for the variable array indexing pass.
We need to re-run channel expressions afterwards as it generates new
vector expressions, and we need to successfully support conditional
assignment (brw_CMP takes 2 operands, not 1).
2010-09-28 09:33:30 -07:00
Eric Anholt
57edd7c5c1 i965: Fix valgrind complaint about base_ir for new FS debugging. 2010-09-28 09:33:30 -07:00
Eric Anholt
1723fdb3f0 i965: Apply the same set of lowering passes to new FS as to Mesa IR.
While much of this we will want to support natively, this should make
the task of reaching the Mesa IR backend's quality easier.

Fixes:
glsl-fs-main-return.
2010-09-28 09:33:30 -07:00
Eric Anholt
e10508812a i965: Actually track the "if" depth in loop in the new FS backend.
Fixes:
glsl-fs-if-nested-loop.
2010-09-28 09:33:30 -07:00
Eric Anholt
fceb78e3cc i965: Fix negation in the new FS backend.
Fixes:
glsl1-Negation
glsl1-Negation2
2010-09-28 09:33:30 -07:00
Jerome Glisse
7ee8fa0421 r600g: switch to new design
New design seems to be on parity according to piglit,
make it default to get more exposure and see if there
is any show stopper in the coming days.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-28 11:37:30 -04:00
Jerome Glisse
b534eb16a2 r600g: fix remaining piglit issue in new design
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-28 11:12:03 -04:00
Jerome Glisse
5a38cec7c8 r600g: use ptr for blit depth uncompress function
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-28 09:51:08 -04:00
Christoph Bumiller
e0b93c5beb nv50: fix GP state bind and validate 2010-09-28 11:22:59 +02:00
Dave Airlie
175261a1f1 r600g: on evergreen the centroid isn't set in this register. 2010-09-28 19:02:46 +10:00
Zhenyu Wang
45b37c4b12 i965: fallback bitmap operation on sandybridge
Need to bring back correct fb write with header to set pixel
write mask. Fallback for now.
2010-09-28 15:58:21 +08:00
Zhenyu Wang
3074b61f64 i965: fix occlusion query on sandybridge
Fix pipe control command for depth stall and PS_DEPTH_COUNT write.
2010-09-28 15:58:21 +08:00
Zhenyu Wang
ec99833e92 i965: fix point sprite on sandybridge
Need to set point sprite function in fixed SF state now on sandybridge.
2010-09-28 15:58:21 +08:00
Zhenyu Wang
4b6b0bf24a i965: fix scissor state on sandybridge
Fix incorrect scissor rect struct and missed scissor state pointer
setting for sandybridge.
2010-09-28 15:58:21 +08:00
Zhenyu Wang
3f3059fcc0 i965: enable polygon offset on sandybridge
Depth offset function is moved to SF stage on sandybridge.
2010-09-28 15:58:21 +08:00
Zhenyu Wang
15a8e7ec90 i965: fix pixel w interpolation on sandybridge 2010-09-28 15:58:21 +08:00
Zhenyu Wang
85fa900b93 i965: don't do calculation for delta_xy on sandybridge
Sandybridge doesn't have Xstart/Ystart in payload header.
2010-09-28 15:58:21 +08:00
Zhenyu Wang
c58bf2cee5 i965: only allow SIMD8 kernel on sandybridge now
Until we fixed SIMD16 kernel, force to SIMD8 on sandybridge now.
2010-09-28 15:58:21 +08:00
Zhenyu Wang
18c3b754f9 i965: sandybridge pipe control workaround before write cache flush
Must issue a pipe control with any non-zero post sync op before
write cache flush = 1 pipe control.
2010-09-28 15:58:21 +08:00
Zhenyu Wang
c8033f1b1e i965: Add all device ids for sandybridge 2010-09-28 15:58:20 +08:00
Zhenyu Wang
81aae67e58 i965: fix const register count for sandybridge
Sandybridge's PS constant buffer payload size is decided from
push const buffer command, incorrect size would cause wrong data
in payload for position and vertex attributes. This fixes coefficients
for tex2d/tex3d.
2010-09-28 15:58:20 +08:00
Zhenyu Wang
956f866030 i965: Fix sampler on sandybridge
Sandybridge has not much change on texture sampler with Ironlake.
2010-09-28 15:58:20 +08:00
Zhenyu Wang
c5a3b25bb9 i965: fix jump count on sandybridge
Jump count is for 64bit long each, so one instruction requires 2
like on Ironlake.
2010-09-28 15:58:20 +08:00
Zhenyu Wang
9c39a9fcb2 i965: VS use SPF mode on sandybridge for now
Until conditional instructions were fixed, use SPF mode instead for now.
2010-09-28 15:58:20 +08:00
Zhenyu Wang
7401a98e29 i965: add sandybridge viewport state bo into validation list 2010-09-28 15:58:20 +08:00
Zhenyu Wang
a0b1d7b2b8 i965: ignore quads for GS kernel on sandybridge
Sandybridge's VF would convert quads to polygon which not required
for GS then. Current GS state still would cause hang on lineloop.
2010-09-28 15:58:20 +08:00
Zhenyu Wang
67dafa4b56 i965: ff sync message change for sandybridge 2010-09-28 15:58:20 +08:00
Zhenyu Wang
fa589770e8 i965: fix point size setting in header on sandybridge 2010-09-28 15:58:20 +08:00
Zhenyu Wang
03218a0093 i965: force zero in clipper to ignore RTAIndex on sandybridge 2010-09-28 15:58:20 +08:00
Zhenyu Wang
41c31c2ebd i965: Fix color interpolation on sandybridge
Don't double store position in vertex attribute. This makes color
interpolation right by using barycentric coordinates.
2010-09-28 15:58:20 +08:00
Zhenyu Wang
8c31a4c3cf i965: enable accumulator update in PS kernel too on sandybridge
Accumulator update flag must be set for implicit update on sandybridge.
2010-09-28 15:58:19 +08:00
Zhenyu Wang
b016a78b98 i965: new state dump for sandybridge
Dump new state object on sandybridge for cc viewport, clip viewport,
depth stencil, cc and blend state.
2010-09-28 15:58:19 +08:00
Zhenyu Wang
bf60f35934 i965: disasm quarter and write enable instruction control on sandybridge 2010-09-28 15:58:19 +08:00
Eric Anholt
fe2d4a5ea0 i965: Add support for POW in gen6 FS.
Fixes glsl-algebraic-pow-2 in brw_wm_glsl.c mode.
2010-09-28 15:58:19 +08:00
Eric Anholt
2f914053bc i965: Set up inputs to the fragment shader according to FP InputsRead.
Sending down data that doesn't get read doesn't make any sense, and
would make handling things like gl_FrontFacing and gl_PointCoord
harder.
2010-09-28 15:58:19 +08:00
Eric Anholt
a66e9a4d86 i965: Add support for attribute interpolation on Sandybridge.
Things are simpler these days thanks to barycentric interpolation
parameters being handed in in the payload.
2010-09-28 15:58:19 +08:00
Vinson Lee
79d5657770 dri: Add GET_PROGRAM_NAME definition for Mac OS X. 2010-09-28 00:27:31 -07:00
Tom Stellard
b3e95dc45c r300/compiler: Use rc_for_all_reads_src() in "dead constants" pass 2010-09-27 23:17:11 -07:00
Tom Stellard
40d256295c r300/compiler: radeon_remove_constants.c: fix indentation 2010-09-27 23:17:11 -07:00
Tom Stellard
a716952184 r300/compiler: Print immediate values after "dead constants" pass 2010-09-27 23:17:11 -07:00
Tom Stellard
798355d429 r300/compiler: Add more helper functions for iterating through sources
rc_for_all_reads_src() and rc_pair_for_all_reads_arg() pass references to
instruction sources to the callback so they can be modified directly.
2010-09-27 23:17:11 -07:00
Dave Airlie
34dba5f05a r600g: fix db flush breaking config state 2010-09-28 14:32:13 +10:00
Marek Olšák
e4fd65e9d7 r300g: fix swizzling of texture border color
NOTE: This is a candidate for the 7.9 branch.
2010-09-28 05:34:51 +02:00
Marek Olšák
13359e6a4b r300g: add support for 3D NPOT textures without mipmapping
The driver actually creates a 3D texture aligned to POT and does all
the magic with texture coordinates in the fragment shader. It first
emulates REPEAT and MIRRORED wrap modes in the fragment shader to get
the coordinates into the range [0, 1]. (already done for 2D NPOT)
Then it scales them to get the coordinates of the NPOT subtexture.

NPOT textures are now less of a lie and we can at least display
something meaningful even for the 3D ones.

Supported wrap modes:
- REPEAT
- MIRRORED_REPEAT
- CLAMP_TO_EDGE (NEAREST filtering only)
- MIRROR_CLAMP_TO_EDGE (NEAREST filtering only)
- The behavior of other CLAMP modes is undefined on borders, but they usually
  give results very close to CLAMP_TO_EDGE with mirroring working perfectly.

This fixes:
- piglit/fbo-3d
- piglit/tex3d-npot
2010-09-28 05:34:51 +02:00
Marek Olšák
7128e1625b r300/compiler: fix shadow sampling with swizzled coords
Taking the W component from coords directly ignores swizzling. Instead,
take the component which is mapped to W in the TEX instruction parameter.
The same for Z.

NOTE: This is a candidate for the 7.9 branch.
2010-09-28 05:34:51 +02:00
Marek Olšák
c2ea7ffb0a r300/compiler: do not use copy propagation if SaturateMode is used
NOTE: This is a candidate for the 7.9 branch.
2010-09-28 05:34:51 +02:00
Marek Olšák
6f747567ec r300/compiler: fix projective mapping of 2D NPOT textures
NOTE: This is a candidate for the 7.9 branch.
2010-09-28 05:34:51 +02:00
Marek Olšák
82f8e43bfa r300g: code cleanups
Some random stuff I had here.

1) Fixed some misleading comments.
2) Removed fake_npot, since it's redundant.
3) lower_texture_rect -> scale_texcoords
4) Reordered and reindented some TEX transform code.
2010-09-28 05:34:51 +02:00
Eric Anholt
94d44c33c0 i965: Add support for dFdx()/dFdy() to the FS backend.
Fixes:
glsl-fwidth
glsl-derivs-swizzle
2010-09-27 18:31:53 -07:00
Eric Anholt
3610e0c1a0 i965: Fix vector splitting RHS channel selection with sparse writemasks.
Fixes:
glsl-fs-all-02
glsl-fs-dot-vec2
2010-09-27 18:29:15 -07:00
Eric Anholt
169ff0cc9d i965: Handle all_equal/any_nequal in the new FS.
These are generated for scalar operands instead of plain equal/nequal.
But for scalars, they're the same anyway.  +30 piglits.
2010-09-27 16:12:18 -07:00
Eric Anholt
a5c6c8a31b i965: Remove swizzling of assignment to vector-splitting single-channel LHS.
We'd end up reading some non-x component of the float RHS.  +53 piglits.
2010-09-27 16:09:50 -07:00
Eric Anholt
11ba8bafdb i965: Fix up writemasked assignments in the new FS.
Not sure how I managed to get tests to succeed without this.  +54 piglits.
2010-09-27 16:07:42 -07:00
Eric Anholt
5e8ed7a79b glsl: Add validation that a swizzle only references valid channels.
Caught the bug in the previous commit.
2010-09-27 15:52:56 -07:00
Eric Anholt
668cdbe129 glsl: Fix broadcast_index of lower_variable_index_to_cond_assign.
It's trying to get an int smeared across all channels, not trying to
get a 1:1 mapping of a subset of a vector's channels.  This usually
ended up not mattering with ir_to_mesa, since it just smears floats
into every chan of a vec4.

Fixes:
glsl1-temp array with swizzled variable indexing
2010-09-27 15:52:56 -07:00
Ian Romanick
8b2d5f431f Remove unnescessary initializations of UpdateTexturePalette
This is already NULL'ed in _mesa_init_driver_functions.
2010-09-27 15:23:14 -07:00
Ian Romanick
78db8c8b66 Regenerate files changed by previous commit 2010-09-27 15:23:14 -07:00
Ian Romanick
02984e3536 Remove GL_EXT_cull_vertex
This is only used in the i915 driver where it provides little benefit
for very few applications that use it with fixed function TNL.
2010-09-27 15:23:14 -07:00
Ian Romanick
4b1f98241f Remove GL_MESA_packed_depth_stencil
This extension was never enabled in any driver.
2010-09-27 15:23:14 -07:00
Ian Romanick
7f11d471e6 mesa: Force GL_SGIS_generate_mipmap to always be enabled
As per discussions at XDS.
2010-09-27 15:23:13 -07:00
Ian Romanick
4da5f1b7c5 mesa: Force GL_ARB_copy_buffer to always be enabled
As per discussions at XDS.
2010-09-27 15:23:13 -07:00
Luca Barbieri
a73c6ce67b d3d1x: work around crash in widl 2010-09-28 00:18:25 +02:00
Luca Barbieri
9126826594 d3d11: fix reference counting so devices get freed 2010-09-27 23:43:53 +02:00
Ian Romanick
923c3334fb dri: Ensure that DRI driver cpp files are in tarballs 2010-09-27 14:16:16 -07:00
Brian Paul
de2dfce0d9 softpipe: fix swizzling of texture border color
We ask the texture tile cache to swizzle the color for us since that's
where the view/swizzling info is available.
2010-09-27 15:06:23 -06:00
Brian Paul
3446af0179 llvmpipe: fix swizzling of texture border color
The pipe_sampler_view's swizzle terms also apply to the texture border
color.  Simply move the apply_sampler_swizzle() call after we fetch
the border color.

Fixes many piglit texwrap failures.
2010-09-27 15:06:23 -06:00
Jerome Glisse
0282682e98 r600g: fix occlusion query after change to block structure
block->reg point to register value not block->pm4 which point
to packet.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-27 17:00:07 -04:00
Brian Paul
029c099b54 softpipe: allocate tile data on demand
Changes in v2:
- Invalidate last_tile_addr on any change, fixing regressions
- Correct coding style

Currently softpipe ends up allocating more than 200 MB of memory
for each context due to the tile caches.

Even worse, this memory is all explicitly cleared, which means that the
kernel must actually back it with physical RAM right away.

This change allocates tile memory on demand.

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-27 14:32:05 -06:00
Luca Barbieri
a359eb80c5 d3d1x: fix Map 2010-09-27 22:20:53 +02:00
Luca Barbieri
f976cd0c9e d3d1x: rework DXGI for occlusion testing and default width/height 2010-09-27 22:20:53 +02:00
Luca Barbieri
e01e2e1883 d3d1x: put proper calling convention in headers, fixes 64-bit builds 2010-09-27 22:20:53 +02:00
Luca Barbieri
b821fdd563 d3d1x: properly support specifying MipLevels as 0 2010-09-27 22:20:53 +02:00
Luca Barbieri
db6f1d0436 d3d1x: support centroid interpolation 2010-09-27 22:20:53 +02:00
Luca Barbieri
ff531c5b05 ureg: support centroid interpolation 2010-09-27 22:20:52 +02:00
Luca Barbieri
94c2be73f4 d3d1x: link to libdrm for X11 platform too
Thanks to Xavier Chantry.
2010-09-27 22:20:52 +02:00
Luca Barbieri
f1afa8794e d3d11: ignore StructureByteStride
D3D11 applications are allowed to pass a random value if the buffer
is not structured
2010-09-27 22:20:52 +02:00
Luca Barbieri
dfc546c047 d3d11: advertise IDXGIDevice1, not just IDXGIDevice
Fixes failure to create device in DirectX SDK samples.
2010-09-27 22:20:52 +02:00
Vinson Lee
a6e642be5c scons: Add MinGW-w64 prefixes for MinGW build. 2010-09-27 13:13:25 -07:00
Hui Qi Tay
75d22e71a8 llvmpipe: minor changes in llvm coefficient calcs 2010-09-27 20:46:46 +01:00
Jerome Glisse
5e07483ed9 r600g: fix routing btw vertex & pixel shader
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-27 15:13:14 -04:00
Jerome Glisse
1617daaf49 r600g: fix pointsprite & resource unbinding
When asking to bind NULL resource assume it's unbinding
so free resource and unreference assoicated buffer.
Also fix pointsprite parameter.

Fix glsl-fs-pointcoord & fp-fragment-position

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-27 15:00:17 -04:00
Jerome Glisse
99c422ef5a r600g: build packet header once
Build packet header once and allow to add fake register support so
we can handle things like indexed set of register (evergreen sampler
border registers for instance.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-27 11:53:34 -04:00
Jerome Glisse
58a31758e3 r600g: fix index buffer drawing
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-27 09:59:52 -04:00
Luca Barbieri
99486bfc5b d3d1x: link progs with CXXFLAGS 2010-09-27 14:26:12 +02:00
Luca Barbieri
31d8f64f3f d3d1x: fix progs linking if not all EGL platforms are enabled 2010-09-27 14:24:33 +02:00
Luca Barbieri
9ba4b30eae d3d1x: add private gitignore file 2010-09-27 14:24:33 +02:00
Luca Barbieri
8d0ed47d94 d3d1x: fix parallel build 2010-09-27 14:11:12 +02:00
Luca Barbieri
e507e4ec05 gallium: add $(PROGS_DEPS) as dependencies for $(PROGS)
Commit 80ee3a440c added a PROGS_DEPS
definition, but no uses, even though it seems clearly intended
to be a set of additional dependencies for $(PROGS).

Correct this.
2010-09-27 14:11:12 +02:00
Luca Barbieri
f762f7b85d mesa: make makedepend an hard requirement
Currently makedepend is used by the Mesa Makefile-based build system,
but not required.

Unfortunately, not having it makes dependency resolution non-existent,
which is a source of subtle bugs, and is a rarely tested
configuration, since all Mesa developers likely have it installed.

Furthermore some idioms require dependency resolution to work at all,
such as making headers depend on generated files.
2010-09-27 14:10:18 +02:00
Tilman Sauerbeck
4c6344f569 r600g: Fixed two texture surface leaks in r600_blit_uncompress_depth().
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-27 08:37:12 +02:00
Dave Airlie
7eab5ef425 r600g: add evergreen texture resource properly.
adding sampler border looks impossible with current design, another day, another corner case not worked out.
2010-09-27 14:35:41 +10:00
Vinson Lee
84b2773f00 r600g: Silence uninitialized variable warnings.
Fixes these GCC warnings.
r600_shader.c: In function 'tgsi_tex':
r600_shader.c:1611: warning: 'src2_chan' may be used uninitialized in this function
r600_shader.c:1611: warning: 'src_chan' may be used uninitialized in this function
2010-09-26 14:34:05 -07:00
Marek Olšák
311ab3d468 r300g: fix macrotiling on R350
MACRO_SWITCH on R350 appears to use the RV350 mode by default. Who knew?

NOTE: This is a candidate for the 7.9 branch.
2010-09-26 22:38:52 +02:00
Jerome Glisse
d2f24c4d75 r600g: use depth decompression in new path
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-26 16:29:33 -04:00
Jerome Glisse
4ca1a92b7f r600g: move around variables to share depth uncompression code
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-26 16:29:33 -04:00
Joakim Sindholt
16baa465a2 radeong: fix leaks 2010-09-26 19:39:05 +02:00
Joakim Sindholt
b51f6e7c23 util/u_blitter: fix leak 2010-09-26 19:03:02 +02:00
Bas Nieuwenhuizen
bc8b8d06b6 r600g: set ENABLE_KILL on evergreen too 2010-09-26 12:23:41 -04:00
Bas Nieuwenhuizen
c622174f73 r600g: set ENABLE_KILL in the shader state in the new design 2010-09-26 12:21:02 -04:00
Jerome Glisse
a852615946 r600g: disable early cull optimization when occlusion query running
When occlusion query are running we want to have accurate
fragment count thus disable any early culling optimization
GPU has.

Based on work from Bas Nieuwenhuizen <bas@basnieuwenhuizen.nl>

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-26 12:06:46 -04:00
Vinson Lee
6f16e497af r600g: Include p_compiler.h instead of malloc.h. 2010-09-26 03:23:31 -07:00
Vinson Lee
15f16328be r600g: Remove unused variables.
Fixes these GCC warnings.
radeon.c: In function 'radeon_new':
radeon.c:59: warning: unused variable 'k'
radeon.c:59: warning: unused variable 'j'
radeon.c:59: warning: unused variable 'id'
radeon.c:59: warning: unused variable 'i'
2010-09-26 03:18:12 -07:00
Vinson Lee
51bfd4e34a r600g: Don't return a value in function returning void.
Fixes this GCC warning.
radeon_state.c: In function 'radeon_state_fini':
radeon_state.c:140: warning: 'return' with a value, in function returning void
2010-09-26 03:10:58 -07:00
Vinson Lee
4743c7fbe7 r300g: Remove unused variable.
Fixes this GCC warning.
r300_state.c: In function 'r300_create_rs_state':
r300_state.c:925: warning: unused variable 'i'
2010-09-26 03:08:14 -07:00
Dave Airlie
81b7de5bf0 r300g: fix glsl-fs-pointcoord
Move GB_ENABLE to derived rs state, and find sprite coord for the correct
generic and enable the tex coord for that generic.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-09-26 18:07:07 +10:00
Vinson Lee
048bda175b r600g: Remove unused variable.
Fixes this GCC warning.
radeon_bo_pb.c: In function 'radeon_bo_pb_create_buffer':
radeon_bo_pb.c:178: warning: unused variable 'domain'
2010-09-25 15:19:29 -07:00
Tom Stellard
522e994a22 r300/compiler: Fix two mistakes in the presubtract optimization pass.
1. We can't turn an instruction into a presubtract operation if it
writes to one of the registers it reads from.
2. If we turn an instruction into a presubtract operation, we can't
remove that intruction unless all readers can use the presubtract
operation.

This fixes fdo bug 30337.
This is a candidate for the 7.9 branch.
2010-09-25 14:53:25 -07:00
Brian Paul
1e35f6472d softpipe: minor asst. clean-ups 2010-09-25 14:25:40 -06:00
Brian Paul
63a5b7d7cc softpipe: make clip state functions static 2010-09-25 14:25:40 -06:00
Brian Paul
5b2406c0b9 softpipe: make stream out state functions static 2010-09-25 14:25:40 -06:00
Brian Paul
bd13a0d282 softpipe: make rasterizer state functions static 2010-09-25 14:25:40 -06:00
Brian Paul
eed4509b08 softpipe: make vertex state functions static 2010-09-25 14:25:40 -06:00
Brian Paul
c5dd2e40e2 softpipe: make sampler state functions static 2010-09-25 14:25:40 -06:00
Brian Paul
2739692a6e softpipe: make blend/stencil/depth functions static 2010-09-25 14:25:40 -06:00
Brian Paul
279b368dc3 softpipe: make shader-related functions static 2010-09-25 14:25:40 -06:00
Brian Paul
72c6d16f8f softpipe: rename sp_state_fs.c -> sp_state_shader.c 2010-09-25 14:25:40 -06:00
Vinson Lee
f8ee415e3c st/dri: Remove unnecessary header. 2010-09-25 12:39:08 -07:00
Brian Paul
5ba62cd413 swrast: update comments for REMAINDER() macro 2010-09-25 13:37:05 -06:00
Brian Paul
4e2f53bacb gallivm: fix repeat() function for NPOT textures
The trick of casting the coord to an unsigned value only works for POT
textures.  Add a bias instead.  This fixes a few piglit texwrap failures.
2010-09-25 13:37:05 -06:00
Brian Paul
e31f0f9965 softpipe: fix repeat() function for NPOT textures
The trick of casting the coord to an unsigned value only works for POT
textures.  Add a bias instead.  This fixes a few piglit texwrap failures.
2010-09-25 13:37:05 -06:00
Vinson Lee
f3e6a0faa9 intel: Remove unnecessary header. 2010-09-25 12:33:28 -07:00
Vinson Lee
1fa50412f1 r600g: Disable unused variables.
The variables are used only in currently disabled code.

Fixes this GCC warning.
r600_context.c: In function 'r600_flush':
r600_context.c:76: warning: unused variable 'dname'
r600_context.c:75: warning: unused variable 'dc'
2010-09-25 12:28:47 -07:00
Vinson Lee
d7065908e4 r600g: Remove unused variable.
Fixes this GCC warning.
r600_draw.c: In function 'r600_draw_common':
r600_draw.c:71: warning: unused variable 'format'
2010-09-25 12:25:44 -07:00
Vinson Lee
60ec71e8b9 r600g: Remove unused variable.
Fixes this GCC warning.
r600_screen.c: In function 'r600_screen_create':
r600_screen.c:239: warning: unused variable 'family'
2010-09-25 12:21:10 -07:00
Christoph Bumiller
86cddfb110 nv50: fix/handle a few more PIPE_CAPs 2010-09-25 19:37:09 +02:00
Christoph Bumiller
2ef1d759b3 nv50: use CLEAR_BUFFERS for surface fills
The 2D engine's fill doesn't seem suited for RGBA32F or ZS buffers.
2010-09-25 19:37:09 +02:00
Christoph Bumiller
583bbfb3ae nv50: use formats table in nv50_surface.c 2010-09-25 19:37:09 +02:00
Jerome Glisse
58c243905b r600g: fix vertex resource & polygon offset
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-25 09:26:01 -04:00
Dave Airlie
b6469a8dc7 r600g: add eg db count control register. 2010-09-25 22:14:08 +10:00
Dave Airlie
ebca23149a r600g: make index bias fix for evergreen 2010-09-25 22:14:08 +10:00
José Fonseca
a69a96d85e gallivm: Remove dead experimental code. 2010-09-25 12:40:01 +01:00
Keith Whitwell
7225838778 llvmpipe: handle up to 8 planes in triangle binner 2010-09-25 12:22:09 +01:00
Keith Whitwell
60a45b03c3 llvmpipe: handle FACING interpolants in line and point setup 2010-09-25 12:21:55 +01:00
José Fonseca
2a8d1fd3ce gallivm: Fetch the lod from the dynamic state when min_lod == max_lod. 2010-09-25 12:21:19 +01:00
José Fonseca
998cf11e13 draw: Fullfil the new min_lod/max_lod/lod_bias/border_color dynamic state 2010-09-25 12:21:16 +01:00
Roland Scheidegger
049a8cce76 gallivm: optimize yuv decoding
this is more a proof to show vector shifts on x86 with per-element shift count
are evil. Since we can avoid the shift with a single compare/select, use that
instead. Replaces more than 20 instructions (and slow ones at that) with about 3,
and cuts compiled shader size with mesa's yuvsqure demo by over 10%
(no performance measurements done - but selection is blazing fast).
Might want to revisit that for future cpus - unfortunately AVX won't have vector
shifts neither, but AMD's XOP will, but even in that case using selection here
is probably not slower.
2010-09-25 12:19:31 +01:00
Roland Scheidegger
46d05d4ef9 gallivm: don't use URem/UDiv when calculating offsets for blocks
While it's true that llvm can and will indeed replace this with bit
arithmetic (since block height/width is POT), it does so (llvm 2.7) by element
and hence extracts/shifts/reinserts each element individually.
This costs about 16 instructions (and extract is not really fast) vs. 1...
2010-09-25 12:19:31 +01:00
Roland Scheidegger
26dc60d0a3 gallivm: fix copy&paste bug
looks like pot_depth should be used, not pot_height
(found by accident, not verified)
2010-09-25 12:19:31 +01:00
Dave Airlie
16a457bba6 r600g: add eg poly mode code. 2010-09-25 19:16:36 +10:00
Dave Airlie
865cf77503 mesa/mipmap: fix warning since 1acadebd62
1acadebd62 fixed the pointer but not the cast.
2010-09-25 18:51:24 +10:00
Vinson Lee
53e6eb8dbe r600g: Silence 'control reaches end of non-void function' warning.
Fixes this GCC warning.
r600_hw_states.c: In function 'r600_translate_fill':
r600_state_inlines.h:136: warning: control reaches end of non-void function
2010-09-24 23:48:05 -07:00
Vinson Lee
95cb6d30ae r600g: Remove unused variable.
Fixes this GCC warning.
eg_hw_states.c: In function 'eg_resource':
eg_hw_states.c:525: warning: unused variable 'r'
2010-09-24 23:17:55 -07:00
Vinson Lee
68fdd5f0d9 r600g: Disable unused variables.
The variables are only used in currently disabled code.

Fixes this GCC warning.
r600_state2.c: In function 'r600_flush2':
r600_state2.c:613: warning: unused variable 'dname'
r600_state2.c:612: warning: unused variable 'dc'
2010-09-24 23:08:08 -07:00
Vinson Lee
207481fa53 r600g: Remove unused variable.
Fixes this GCC warning.
r600_buffer.c: In function 'r600_buffer_transfer_map':
r600_buffer.c:141: warning: unused variable 'rctx'
2010-09-24 22:59:46 -07:00
Vinson Lee
365da88a71 intel: Remove unnecessary headers. 2010-09-24 22:55:04 -07:00
Vinson Lee
f07ac801b9 unichrome: Remove unnecessary header. 2010-09-24 22:53:40 -07:00
Vinson Lee
80ac94af72 r600g: Remove unnecessary header. 2010-09-24 22:48:46 -07:00
Vinson Lee
c510f8eeb4 mesa: Remove unnecessary headers. 2010-09-24 22:46:14 -07:00
Vinson Lee
ef1e1261df intel: Fix implicit declaration of function '_mesa_meta_Bitmap' warning.
Fix this GCC warning.
intel_pixel_bitmap.c: In function 'intelBitmap':
intel_pixel_bitmap.c:343: warning: implicit declaration of function '_mesa_meta_Bitmap'
2010-09-24 22:20:43 -07:00
Vinson Lee
5c77b75316 r300g: Silence uninitialized variable warning.
Silence this GCC warning.
r300_state_derived.c: In function 'r300_update_derived_state':
r300_state_derived.c:578: warning: 'r' may be used uninitialized in this function
r300_state_derived.c:578: note: 'r' was declared here
2010-09-24 19:33:43 -07:00
Eric Anholt
1acadebd62 mesa: Fix type typo in glGenerateMipmap handling of GL_UNSIGNED_INT data.
Fixes ARB_depth_texture/fbo-generatemipmap-formats.
2010-09-24 18:40:24 -07:00
Eric Anholt
b917691bc0 intel: Improve some of the miptree debugging. 2010-09-24 18:25:42 -07:00
Eric Anholt
86ad797be4 intel: More reverting of the sw fallback for depth texture border color.
The rest was done with 9aec1288ee
2010-09-24 18:19:08 -07:00
Eric Anholt
2e3d22b074 intel: Add fallback debug to glGenerateMipmap. 2010-09-24 18:03:28 -07:00
Eric Anholt
934fde4f5a intel: Fix segfault on INTEL_DEBUG=fbo with unsupported framebuffers. 2010-09-24 18:03:28 -07:00
Marek Olšák
8619495790 util: fix util_pack_color for B4G4R4A4
NOTE: This is a candidate for the 7.9 branch.
2010-09-25 01:52:33 +02:00
Eric Anholt
1946b81e70 i965: Add support for rendering to SARGB8 FBOs.
Tested with fbo-generatemipmap-formats GL_EXT_texture_srgb.  The test
still fails on SLA8, though.
2010-09-24 16:12:50 -07:00
Eric Anholt
836803df79 intel: Corresponding FinishRenderTexture debug to BeginRenderTexture. 2010-09-24 16:12:50 -07:00
Jerome Glisse
6613605d79 r600g: bring over fix from old path to new path
Up to 2010-09-19:
r600g: fix tiling support for ddx supplied buffers
9b146eae25

user buffer seems to be broken... new to fix that.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-24 17:33:30 -04:00
Jerome Glisse
3ad4486bfe r600g: fix evergreen new path
glxgears seems to work, had somelockup but now they seems to have vanish.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-24 16:17:28 -04:00
Jerome Glisse
49111213e4 r600g: fix reg definition
Doesn't bother fixing old path code, just disable that reg.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-24 16:09:05 -04:00
Jerome Glisse
ba7e6ccc95 r600g: fix evergreen new path
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-24 15:02:33 -04:00
Jerome Glisse
b43480fabb r600g: fixup some evergreen register definitions
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-24 15:02:33 -04:00
Ian Romanick
e4bd50c232 egl: Fix several 'comparison between signed and unsigned integer' warnings
I hate GCC for requiring the (int) cast on sizeof.
2010-09-24 10:55:38 -07:00
Ian Romanick
66c9ac76ad egl_glx: Silence piles of 'unused variable' warnings 2010-09-24 10:55:38 -07:00
Eric Anholt
e7c8832c7f intel: Dead comment removal. 2010-09-24 10:32:57 -07:00
Alex Deucher
15861e0074 r600c: fix mipmap stride on evergreen
taken from Dave's r600g fix
2010-09-24 13:20:58 -04:00
Ian Romanick
137fce247f EGL DRI2: Silence 'missing initializer' warnings 2010-09-24 09:40:06 -07:00
Ian Romanick
eade946cbf EGL DRI2: Silence piles of 'unused variable' warnings 2010-09-24 09:40:06 -07:00
Brian Paul
d1a4dd4217 llvmpipe: make texture border_color dynamic state 2010-09-24 09:48:32 -06:00
Brian Paul
61b7da074e llvmpipe: make min/max lod and lod bias dynamic state
Before, changing any of these sampler values triggered generation
of new JIT code.  Added a new flag for the special case of
min_lod == max_lod which is hit during auto mipmap generation.
2010-09-24 09:47:37 -06:00
Jerome Glisse
7967b46e65 r600g: fix compilation after change to evergreend.h
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-24 10:43:57 -04:00
Jerome Glisse
eff1af65af r600g: evergreen fix for new design
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-24 10:41:01 -04:00
Jerome Glisse
cb3aed80db r600g: move use_mem_constants flags for new designs structure alignment
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-24 10:41:01 -04:00
Jerome Glisse
3672bc14af r600g: fix typo in evergreen define (resource are in [0x30000;0x34000] range)
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-24 10:41:01 -04:00
Brian Paul
f5c810c42f st/mesa: use the wrapped renderbuffer in CopyPixels()
Fixes assertion failures when copying stencil pixels.

NOTE: this is a candidate for the 7.9 branch.
2010-09-24 08:27:06 -06:00
Brian Paul
10dcc989ab st/mesa: add missing MESA_FORMAT_S8 case in st_mesa_format_to_pipe_format()
NOTE: this is a candidate for the 7.9 branch.
2010-09-24 08:24:43 -06:00
Brian Paul
9f7c8053e0 mesa: fix assertions to handle srgb formats
http://bugs.freedesktop.org/show_bug.cgi?id=30333

NOTE: This is a candidate for the 7.9 branch.
2010-09-24 07:55:49 -06:00
Luca Barbieri
1154765429 d3d1x: CRLF -> LF in progs 2010-09-24 15:12:20 +02:00
Luca Barbieri
7e81c67c8b d3d1x: stop using GLX in demos, just use the default visual 2010-09-24 15:12:19 +02:00
Luca Barbieri
db1fbb1efc d3d1x: assert if X visual is not among enumerated visuals 2010-09-24 15:12:19 +02:00
Luca Barbieri
f1063cfee2 d3d1x: don't crash on drivers not supporting vertex or geometry sampling 2010-09-24 15:12:19 +02:00
Luca Barbieri
b632d9fce3 nvfx: add RGB framebuffer format support in addition to BGR 2010-09-24 15:12:19 +02:00
Luca Barbieri
d0ee833dee nvfx: allow setting NULL constant buffers 2010-09-24 15:12:19 +02:00
Andre Maasikas
8b63ed4e6c r600g: break alu clause earlier
we still have constants to add and next int may need also 6 slots
2010-09-24 13:26:19 +03:00
Luca Barbieri
c7a064b4d5 d3d1x: fix linking of dxbc2tgsi 2010-09-24 09:51:15 +02:00
Luca Barbieri
54ee7721a1 d3d1x: draw to the correct buffer 2010-09-24 09:15:49 +02:00
Luca Barbieri
0f4ec3f72c d3d1x: fix CheckMultisampleQualityLevels 2010-09-24 09:15:49 +02:00
Luca Barbieri
0e40b41cee d3d1x: don't assert on unsupported resource types 2010-09-24 09:15:49 +02:00
Luca Barbieri
4babdc7844 d3d1x: add untested support for geometry shader translation 2010-09-24 09:15:49 +02:00
Luca Barbieri
f71f8c7d18 d3d1x: add shader dumping 2010-09-24 09:15:49 +02:00
Dave Airlie
11cd1612a1 r600g: fix polygon mode
this fixes glean'pointSprite test.
2010-09-24 18:58:16 +10:00
Dave Airlie
efa111a6cb r600g: fixup sprite coord enable.
this fixes piglit glsl-fs-pointcoord
2010-09-24 16:36:54 +10:00
Dave Airlie
428b101af9 r600g: fix typo in r700 alu emit 2010-09-24 16:12:02 +10:00
Dave Airlie
59276b8541 r600g: fixup VP->FP output->input routing.
We need to map the TGSI semantics to each other using the hw semantic ids.

this fixes glsl-kwin-blur and glsl-routing.
2010-09-24 14:59:19 +10:00
Dave Airlie
e74d26d82a r600g: fixup tex wrapping.
the clamp edge/clamp cases were reversed.
2010-09-24 13:51:54 +10:00
Dave Airlie
4e27e935ca r600g: drop index_offset parameter to index buffer translate.
r600 doesn't need this as we always have working index bias
2010-09-24 12:38:14 +10:00
Dave Airlie
cf0162be13 r600g: fix draw-elements and draw-elements-base-vertex 2010-09-24 12:34:43 +10:00
Dave Airlie
95e04c3d74 r600g: some more vertex formats 2010-09-24 12:34:43 +10:00
Dave Airlie
b7ab9ee84e r600g: add some more vertex format support.
adds the sscaled formats, this passes some more of the draw-vertices tests.
2010-09-24 12:34:43 +10:00
Dave Airlie
4388087f19 r600g: add vert support for 16/16 and 16/16/16 floats.
makes draw-vertices-half-float pass
2010-09-24 12:34:43 +10:00
Marek Olšák
85a45dcd5d Build r300g by default
NOTE: This will go to 7.9 as well.
2010-09-24 02:58:50 +02:00
Marek Olšák
9f35dcd24c r300g: fix the border color for every format other than PIPE_FORMAT_B8G8R8A8
TX_BORDER_COLOR should be formatted according to the texture format.
Also the interaction with ARB_texture_swizzle should be fixed too.

NOTE: This is a candidate for the 7.9 branch.
2010-09-24 02:57:36 +02:00
Marek Olšák
7d28ec8500 r300g: fix a copy-paste typo for logging 2010-09-24 02:33:34 +02:00
Marek Olšák
a333485386 r300g: make accessing map_list and buffer_handles thread-safe
NOTE: This is a candidate for the 7.9 branch.
2010-09-24 02:29:05 +02:00
Marek Olšák
206d92912c r300g: fixup long-lived BO maps being incorrectly unmapped when flushing
Based on commit 3ddc714b20 by Dave Airlie.

NOTE: This is a candidate for the 7.9 branch.
2010-09-24 02:29:04 +02:00
Marek Olšák
68afbe89c7 util: make calling remove_from_list multiple times in a row safe
This commit fixes an infinite loop in foreach_s if remove_from_list is used
more than once on the same item with other list operations in between.

NOTE: This is a candidate for the 7.9 branch because the commit
"r300g: fixup long-lived BO maps being incorrectly unmapped when flushing"
depends on it.
2010-09-24 02:29:04 +02:00
Eric Anholt
f46523e0bc i915: Remove a dead if (0) block. 2010-09-23 16:34:10 -07:00
Eric Anholt
64ff468d6f intel: Remove dead intelIsTextureResident().
It always returned 1 (GL_TRUE), which is the same thing that happens when
the driver hook isn't present.
2010-09-23 16:30:58 -07:00
Eric Anholt
f9e6f401e1 unichrome: Mostly revert my convolution removal changes.
For this driver, the minimum pitch alignment stuff does appear to be
necessary, so leave the separate munged width/height variable in
place.
2010-09-23 16:20:33 -07:00
Eric Anholt
1c0646a826 radeon: Remove copied minimum pitch alignment code.
This is already covered by radeon_mipmap_tree.c, and my convolution
cleanups broke in the presence of this code.  Thanks to Marek Olšák
for tracking down the relevant miptree code for me.
2010-09-23 16:20:25 -07:00
Eric Anholt
fae1855946 intel: Replace my intel_texture_bitmap code with _mesa_meta_Bitmap.
The meta code is more general than mine, and appears to pass the same
sets of tests (piglit + some oglconform).
2010-09-23 16:04:55 -07:00
Eric Anholt
2337f364b1 intel: Remove unnecessary minimum pitch alignment to 32 bytes.
This broke with the cleanup I did in convolution removal.  It's
unnecessary anyway since region_alloc_tiled adjusts pitches for us (64
byte alignment)
2010-09-23 16:04:55 -07:00
Tom Stellard
92762842a0 r300g: Always try to build libr300compiler.a
Make libr300compiler.a a PHONY target so that this library will always be
built.  This fixes the problem of libr300compiler.a not being updated
when r300g is being built and r300c is not.

This is a candidate for the Mesa 7.9 branch.
2010-09-23 15:04:35 -07:00
Eric Anholt
d26211e499 intel: Remove disabled stencil drawpixels acceleration.
We still retain the fallback override for GL_STENCIL_INDEX, because
the metaops version fails at oglconform.
2010-09-23 14:58:37 -07:00
Dave Airlie
c0c0c4b96b r300g: fix point sprite coord.
handled elsewhere now.

thanks to Droste on irc for pointing out the fix
2010-09-24 07:46:59 +10:00
Jerome Glisse
b360c050b6 r600g: initial evergreen support in new path
This doesn't work yet.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-23 17:10:28 -04:00
Tilman Sauerbeck
ce8c71817b r600g: Destroy the blitter.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-23 22:36:00 +02:00
Eric Anholt
a62efdf82c mesa: Remove EXT_convolution.
More optional code.
2010-09-23 13:25:45 -07:00
Eric Anholt
73578ba9c4 mesa: Remove SGI_color_matrix.
Another optional ARB_imaging subset extension.
2010-09-23 13:25:45 -07:00
Eric Anholt
6c227e57e6 mesa: Remove SGI_color_table.
Another optional ARB_imaging subset extension.
2010-09-23 13:25:45 -07:00
Eric Anholt
7126e38d90 mesa: Remove EXT_histogram.
This has always been optional, and not useful.
2010-09-23 13:25:45 -07:00
Eric Anholt
907a6734fc mesa: Remove the non-required ARB_imaging extension.
Many of the EXT_ extensions in the subset have significant code
overhead with no users.  It is not a required part of GL -- though
text describing the extension is part of the core spec since 1.2, it
is always conditional on the ARB_imaging extension.
2010-09-23 13:25:45 -07:00
Luca Barbieri
96da9b28c8 d3d1x: obliterate IDL parameter names from d3d10.idl from Wine too 2010-09-23 16:29:29 +02:00
Luca Barbieri
bccd4eb824 d3d1x: add autogenerated files as prerequisites, so make builds them 2010-09-23 16:21:14 +02:00
Luca Barbieri
36a64bfe54 d3d1x: fix build without system EGL/egl.h 2010-09-23 16:18:52 +02:00
Luca Barbieri
eaf8fe8461 d3d1x: add missing guid.cpp 2010-09-23 16:17:36 +02:00
Luca Barbieri
1734a78538 d3d1x: flush properly 2010-09-23 16:08:37 +02:00
Luca Barbieri
206c4cc878 d3d1x: remove another include specstrings.h 2010-09-23 16:07:33 +02:00
Luca Barbieri
681f87e09b d3d1x: flush the pipe context when presenting 2010-09-23 16:06:03 +02:00
Luca Barbieri
9a97b9af68 d3d1x: remove specstrings.h include 2010-09-23 16:06:03 +02:00
Luca Barbieri
b6b3fbcdb1 d3d11: obliterate IDL parameter names 2010-09-23 16:06:03 +02:00
Luca Barbieri
0525384c11 d3d1x: rename parameters in dxgi 2010-09-23 16:06:03 +02:00
Luca Barbieri
9cd0e624b4 d3d1x: rename params in misc and objects 2010-09-23 16:06:03 +02:00
Luca Barbieri
4f700d23fd d3d11: rename screen params 2010-09-23 16:06:03 +02:00
Luca Barbieri
3e0f57b640 d3d1x: rename context params 2010-09-23 16:06:03 +02:00
Luca Barbieri
6b485d8518 d3d1x: minifix 2010-09-23 16:06:02 +02:00
Luca Barbieri
8224256946 d3d1x: remove specstrings 2010-09-23 16:06:02 +02:00
Luca Barbieri
6c598c78bd d3d1x: normalize whitespace 2010-09-23 16:06:02 +02:00
Luca Barbieri
e5ae4588d1 d3d1x: s/tpf/sm4/g 2010-09-23 16:06:02 +02:00
Luca Barbieri
75c29fe1c8 d3d1x: autogenerate shader enums and text from def files
This avoids the duplication in tpf.h and tpf_text.cpp
2010-09-23 16:06:02 +02:00
Luca Barbieri
22762012d1 d3d1x: initialize the mutex 2010-09-23 16:06:02 +02:00
José Fonseca
440129521c draw: Prevent clipped vertices overflow.
Some pathological triangles cause a theoritically impossible number of
clipped vertices.

The clipper will still assert, but at least release builds will not
crash, while this problem is further investigated.
2010-09-23 16:47:36 +01:00
Keith Whitwell
8b597b4ea4 draw: don't apply flatshading to clipped tris with <3 verts
If a triangle was completely culled by clipping, we would still try to
fix up its provoking vertex.
2010-09-23 16:11:17 +01:00
Luca Barbieri
1b15a3cafd d3d1x: bind NULL CSOs before destroying default CSOs on context dtor
Otherwise softpipe and llvmpipe assert.
2010-09-23 11:23:08 +02:00
Luca Barbieri
17ad9972f4 d3d1x: fix deadlocks on non-recursive mutex 2010-09-23 11:23:08 +02:00
Dave Airlie
ada1d91c15 egl: fix build since 17eace581d
looks like mesa st didn't get updated.
2010-09-23 16:12:23 +10:00
Dave Airlie
6547a82df1 r600g: fix warnings since last commit. 2010-09-23 16:02:54 +10:00
Dave Airlie
2f8453eea3 r600g: use blitter to do db->cb flushing.
use the blitter + custom stage to avoid doing a whole lot of state
setup by hand. This makes life a lot easier for doing this on evergreen
it also keeps all the state setup in one place.

We setup a custom context state at the start with a flag to denote
its for the flush, when it gets generated we generate the correct state
for the flush and no longer have to do it all by hand.

this should also make adding texture *to* depth easier.
2010-09-23 16:00:16 +10:00
Dave Airlie
c262c4a2ff u_blitter: add a custom blitter call passing a dsa cso
reimplement the flush stage added for r300 to allow a custom DSA stage
to be used in the pipeline, this allows for r600 hw DB->CB flushes.
2010-09-23 16:00:16 +10:00
Luca Barbieri
881c05aa1e d3d1x: properly reference count the backend 2010-09-23 03:13:52 +02:00
Kristian Høgsberg
17eace581d dri: Pass the __DRIscreen and the __DRIscreen private back to image lookup
We will typically have a current context when we need to lookup the image,
but the lookup implementation don't need it so drop it.
2010-09-22 22:02:05 -04:00
Zack Rusin
1c2423999e rbug: fix rbug when contexts are being destroyed 2010-09-22 20:41:23 -04:00
Dave Airlie
fa11c400d0 r600g: fix typo in evergreen register list
pointed out by glisse on irc.
2010-09-23 10:30:35 +10:00
Dave Airlie
8078e58795 r600g: fix depth readback on rv610 and other quirky variants.
at least zreaddraw works for me here now on my rv610
2010-09-23 10:20:56 +10:00
Dave Airlie
fb5ef05dc5 r600g: use floats instead of hex for blit vbo
once I go past 0x3f80000, I can't translate hex to float in-brain anymore.
2010-09-23 10:01:48 +10:00
Eric Anholt
03923ff95e i965: Warning fix for vector result any_nequal/all_equal change. 2010-09-22 14:58:29 -07:00
Eric Anholt
bb70bd5559 i965: Update expression splitting for the vector-result change to compares.
Fixes:
glsl1-precision exp2
glsl1-precision log2
2010-09-22 14:55:58 -07:00
Eric Anholt
ac3d5beb0b i965: When splitting vector variable assignment, ignore unset channels.
The new checks for sanity in ir_assignment creation got angry about
this write_mask == 0.  Fixes:
glsl-fs-dot-vec2.
glsl-fs-atan-2
glsl-fs-dot-vec2
2010-09-22 14:55:58 -07:00
Kristian Høgsberg
86a1938aa5 glx: Invalidate buffers after binding a drawable
If the server doesn't send invalidate events, we may miss a
resize before the rendering starts.  Invalidate the buffers now
so the driver will recheck before rendering starts.

https://bugs.freedesktop.org/show_bug.cgi?id=29984
https://bugs.freedesktop.org/show_bug.cgi?id=30155
2010-09-22 17:36:19 -04:00
Eric Anholt
d74bab1fb6 i965: Fix the vector/expression splitting for the write_mask change.
+113 piglits.
2010-09-22 14:15:27 -07:00
Jakob Bornecrantz
4bb42a4f7e tgsi: Fix missing test before check
As introduced with commit d21301675c

NOTE: This is a candidate for the 7.9 branch.
2010-09-22 22:56:54 +02:00
Eric Anholt
eaa6bf59db ir_to_mesa: Only compare vector_elements present for any_nequal/all_equal
Fixes: glsl-mat-from-int-ctor-03
2010-09-22 13:09:51 -07:00
Eric Anholt
3ffab36768 glsl: Fix copy'n'wasted ir_noop_swizzle conditions.
It considered .xyyy a noop for vec4 instead of .xyzw, and similar for vec3.
2010-09-22 13:09:51 -07:00
Eric Anholt
b39e6f33b6 glsl: Rework assignments with write_masks to have LHS chan count match RHS.
It turns out that most people new to this IR are surprised when an
assignment to (say) 3 components on the LHS takes 4 components on the
RHS.  It also makes for quite strange IR output:

(assign (constant bool (1)) (x) (var_ref color) (swiz x (var_ref v) ))
(assign (constant bool (1)) (y) (var_ref color) (swiz yy (var_ref v) ))
(assign (constant bool (1)) (z) (var_ref color) (swiz zzz (var_ref v) ))

But even worse, even we get it wrong, as shown by this line of our
current step(float, vec4):

(assign (constant bool (1)) (w)
	(var_ref t)
	(expression float b2f (expression bool >=
		    (swiz w (var_ref x))(var_ref edge))))

where we try to assign a float to the writemasked-out x channel and
don't supply anything for the actual w channel we're writing.  Drivers
right now just get lucky since ir_to_mesa spams the float value across
all the source channels of a vec4.

Instead, the RHS will now have a number of components equal to the
number of components actually being written.  Hopefully this confuses
everyone less, and it also makes codegen for a scalar target simpler.

Reviewed-by: Kenneth Graunke <kenneth@whitecape.org>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
2010-09-22 13:09:51 -07:00
Luca Barbieri
38da5c9cb6 d3d1x: add Wine dlls (tri, tex working, but no other testing) 2010-09-22 19:59:14 +02:00
Luca Barbieri
ab5e9a726d d3d1x: define GUIDs in the normal way 2010-09-22 19:44:58 +02:00
Luca Barbieri
3d4a15dfab d3d1x: fix API name 2010-09-22 19:44:57 +02:00
Luca Barbieri
e7624e23a3 d3d1x: redesign the HWND resolver interface
This one should be powerful enough to hook up Wine.
2010-09-22 19:44:57 +02:00
Luca Barbieri
4f8e38dab8 d3d1x: fix GUID declarations 2010-09-22 19:36:27 +02:00
Luca Barbieri
6ce098631a d3d1x: destroy native_display on adapter destruction 2010-09-22 19:36:27 +02:00
Kristian Høgsberg
9ec0b2a45e dri2: Make createImageFromName() take a __DRIscreen instead of __DRIcontext
We can't expect to have a context when this is called, and we don't need one
so just require a __DRIscreen instead.

Reported by Yu Dai <yu.dai@intel.com>
2010-09-22 15:08:22 -04:00
Jerome Glisse
f060ae9ab6 r600g: fix multiple occlusion query on same id
When calling query begin using same query id we need to discard
previous query results.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-22 14:59:09 -04:00
Jerome Glisse
b8835a3992 r600g: disable shader rebuild optimization & account cb flush packet
Shader rebuild should be more clever, we should store along each
shader all the value that change shader program rather than using
flags in context (ie change sequence like : change vs buffer, draw,
change vs buffer, switch shader will trigger useless shader rebuild).

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-22 14:19:05 -04:00
Brian Paul
516ac2bd50 llvmpipe: fix sprite texcoord setup for non-projective texturing
Normally the Mesa state tracker uses TXP instructions for texturing.
But if a fragment shader uses texture2D() that's a TEX instruction.
In that case we were incorrectly computing the texcoord coefficients
in the point sprite setup code.  Some new comments in the code explain
things.
2010-09-22 11:25:18 -06:00
Brian Paul
bd6b8107ad configs: remove egl-swrast target from linux-dri config 2010-09-22 09:30:16 -06:00
Kristian Høgsberg
b91dba49e0 intel: Fix GL_ARB_shading_language_120 commit
Fix commit e7087175f8.  Move the reference to
GL_VERSION_2_1_functions to intel_extensions.c where it's available,
don't try to enable a non-existing extension and advertise 1.20 for all
intel chipsets, not just GEN4 and up.
2010-09-22 11:01:45 -04:00
Jerome Glisse
1abe48afbe r600g: flush color buffer after draw command
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-22 10:35:14 -04:00
José Fonseca
87267c71f6 llvmpipe: Make rgb/alpha bland func/factors match, when there is no alpha.
Makes AoS blending easier, and state more canonical.
2010-09-22 15:02:39 +01:00
José Fonseca
9a8e9f4595 llvmpipe: Special case complementary and identify blend factors in SoA.
One multiplication instead of two.

Also fix floating point random number generation and verification.

TODO: Do the same for AoS blending.
2010-09-22 15:02:39 +01:00
José Fonseca
162b0efff6 gallivm: Add unorm support to lp_build_lerp()
Unfortunately this can cause segfault with LLVM 2.6, if x is a constant.
2010-09-22 15:02:39 +01:00
José Fonseca
256b9d99fb util: Flush stdout on util_format. 2010-09-22 15:02:39 +01:00
Luca Barbieri
cac1565b98 d3d1x: fix segfault when hashing 2010-09-22 13:54:07 +02:00
Luca Barbieri
d83b7a69a0 d3d1x: fix warning 2010-09-22 13:25:45 +02:00
Luca Barbieri
1aed6f42e9 d3d1x: fix cf analysis 2010-09-22 13:24:55 +02:00
Luca Barbieri
12044e4c99 d3d1x: link with CXXFLAGS
Otherwise, -m32 doesn't make it there.
2010-09-22 13:22:00 +02:00
Luca Barbieri
d092c0c60d d3d1x: add missing memory barrier 2010-09-22 13:21:13 +02:00
Luca Barbieri
6d0c39ce36 d3d1x: don't build progs automatically
progs requires winsys, which hasn't yet been built by the time we
go into state_trackers.

It may be a good idea to also move it into tests.

After a normal build, run make in src/gallium/state_trackers/d3d1x/progs
to build them.
2010-09-22 11:36:35 +02:00
Luca Barbieri
feb9c8c510 winsys: automatically build sw winsys needed by EGL and d3d1x
A cleaner solution would be preferable, but this does no harm and works.
2010-09-22 09:37:23 +02:00
Luca Barbieri
a0e5103200 glx: decouple dri2.c and GLX, fixing Gallium EGL and d3d1x build
The Gallium EGL state tracker reuses dri2.c but not the GLX code.

Currently there is a bit of code in dri2.c that is incorrectly tied
to GLX: instead, make it call an helper that both GLX and Gallium EGL
implement, like dri2InvalidateBuffers.

This avoids a link error complaining that dri2GetGlxDrawableFromXDrawableId
is undefined.

Note that we might want to move the whole event translation elsewhere,
and probably stop using non-XCB DRI2 altogether, but this seems to be
the minimal fix.
2010-09-22 08:01:49 +02:00
Luca Barbieri
e1e7c8df7f nvfx: remove gl_PointCoord hack
Now Gallium has the proper fix, thanks to Brian Paul.
2010-09-22 08:00:20 +02:00
Luca Barbieri
86bb64f889 d3d1x: attempt to fix/workaround bug #30322
This may just be hiding some other bug though, since the types are supposed
to be the same (and it compiles for me).

Anyway, this interface will likely need to changed, since it seems Wine needs
a more powerful one capable of expressing window subregions and called at
every Present.
2010-09-22 08:00:19 +02:00
Dave Airlie
2b1ea90342 r600g: disable dirty handling on texture from depth code.
nothing was every dirtying the object again, the mesa-demos
reflect test was just stalling.

this fixes glean readPixSanity.
2010-09-22 14:27:58 +10:00
Dave Airlie
d18f3accb0 r600g: make stencil readback work
need to write two components to get stencil components as well
2010-09-22 14:19:16 +10:00
Dave Airlie
41ef78c5af r600g: cleanup some of the DB blit code
add cb/db flush states to the blit code.
add support for the rv6xx that need special treatment.
according to R6xx_7xx_3D.pdf

set r700 CB_SHADER_CONTROL reg in blit code
docs say dual export should be disabled for DB->CB
2010-09-22 13:33:57 +10:00
Dave Airlie
6e901e330a r600g: fix typo in struct member name 2010-09-22 12:57:08 +10:00
Jerome Glisse
ca35292a44 r600g: occlusion query for new design
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-21 20:25:39 -04:00
Brian Paul
e7087175f8 mesa: don't advertise bogus GL_ARB_shading_language_120 extension
Instead of using the invalid GL_ARB_shading_language_120 extension to
determine the GLSL version, use a new ctx->Const.GLSLVersion field.
Updated the intel and r600 drivers, but untested.

See fd.o bug 29910

NOTE: This is a candidate for the 7.9 branch (but let's wait and see if
there's any regressions).
2010-09-21 18:13:04 -06:00
Vinson Lee
3642ca2f66 glut: Define eventParser for non-Windows only.
Fixes this GCC warning on MinGW build.
glut_input.c:295: warning: 'eventParser' defined but not used
2010-09-21 15:17:52 -07:00
Vinson Lee
13cd131b0f glut: Define markWindowHidden for non-Windows only.
Fixes this GCC warning on MinGW build.
glut_event.c:255: warning: 'markWindowHidden' defined but not used
2010-09-21 15:11:00 -07:00
Brian Paul
9e8d9f456f softpipe: add missing calls to set draw vertex samplers/views
Part of the fix for running softpipe w/ LLVM-enabled draw module.
2010-09-21 15:31:33 -06:00
Brian Paul
ffa2d203fb gallivm: fix lp_build_sample_compare()
The old code didn't really make sense.  We only need to compare the
X channel of the texture (depth) against the texcoord.

For (bi)linear sampling we should move the calls to this function
and compute the final result as (s1+s2+s3+s4) * 0.25.  Someday.

This fixes the glean glsl1 shadow2D() tests.  See fd.o bug 29307.
2010-09-21 15:31:32 -06:00
Luca Barbieri
83ea4878db d3d1x: ignore errors while building docs
Some versions of dot apparently lack pdf output.
2010-09-21 23:26:47 +02:00
Jerome Glisse
45d10c7d59 r600g: fix multi buffer rendering
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-21 16:57:55 -04:00
Brian Paul
2b95525429 glsl2: fix typo in error msg 2010-09-21 14:57:10 -06:00
Luca Barbieri
c02bf81629 d3d1x: fix GCC 4.1/4.2 build 2010-09-21 22:47:09 +02:00
Luca Barbieri
b4b2091655 d3d1x: add template parameters to base class ctor calls for GCC 4.4
GCC 4.5 is fine without them, but GCC 4.4 requires them.
Should fully fix the build on GCC 4.4
2010-09-21 22:35:01 +02:00
Luca Barbieri
82c346673a d3d1x: fix build with compilers other than GCC 4.5
There was some libstdc++-specific code that would only build with GCC 4.5
Now it should be much more compatible, at the price of reimplementing
the generic hash function.
2010-09-21 22:16:52 +02:00
Tilman Sauerbeck
1bcdc504d1 gallium/docs: The RET opcode may appear anywhere in a subroutine.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-21 21:59:57 +02:00
Eric Anholt
dd9a88f4dd i965: Track the windowizer's dispatch for kill pixel, promoted, and OQ
Looks like the problem was we weren't passing the depth to the render
target as expected, so the chip would wedge.  Fixes GPU hang in
occlusion-query-discard.

Bug #30097
2010-09-21 12:29:57 -07:00
Eric Anholt
4a0bc4716d i965: Also enable CC statistics when doing OQs.
This is required by the spec, so respect that.
2010-09-21 12:29:57 -07:00
Eric Anholt
23c507f135 i965: Share the KIL_NV implementation between glsl and non-glsl. 2010-09-21 12:29:57 -07:00
Jerome Glisse
6048be8969 r600g: directly allocate bo for user buffer
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-21 14:37:38 -04:00
Eric Anholt
b5bb215629 glsl: Add definition of gl_TextureMatrix inverse/transpose builtins.
Fixes glsl2/builtin-texturematrix.
Bug #30196.
2010-09-21 10:09:46 -07:00
José Fonseca
b556bb7c44 llvmpipe: When failing free fs shader too. 2010-09-21 17:51:29 +01:00
José Fonseca
388c94195a llvmpipe: Describe how to profile llvmpipe. 2010-09-21 17:51:29 +01:00
Brian Paul
b3a647276e draw: new draw_fs.[ch] files 2010-09-21 10:07:52 -06:00
Brian Paul
d49f153ab3 Merge branch 'sprite-coord' 2010-09-21 09:57:25 -06:00
Kristian Høgsberg
441344ba7e glx: Hold on to drawables if we're just switching to another context
https://bugs.freedesktop.org/show_bug.cgi?id=30234
2010-09-21 10:20:23 -04:00
Luca Barbieri
bb26272bea d3d1x: actually enable and fix blob apis 2010-09-21 16:01:26 +02:00
Luca Barbieri
f815b57b88 d3d1x: add missing file 2010-09-21 15:51:02 +02:00
Luca Barbieri
cb7cc36fff d3d1x: fix compilation with recent Wine versions installed
Recent Wine versions provide a d3d11shader.h, which is however empty
and was getting used instead of our non-empty one.

Correct the include path order to fix this.
2010-09-21 15:44:41 +02:00
Luca Barbieri
70fed0b0ec d3d1x: add blob and signature extraction APIs
NOTE: untested, needs a testing tool!
2010-09-21 15:44:41 +02:00
Keith Whitwell
2ec86793bd llvmpipe: fix flatshading in new line code
Calculate interpolants before rearranging the vertices.
2010-09-21 14:36:55 +01:00
Luca Barbieri
92617aeac1 d3d1x: add new Direct3D 10/11 COM state tracker for Gallium
This is a new implementation of the Direct3D 11 COM API for Gallium.

Direct3D 10 and 10.1 implementations are also provided, which are
automatically generated with s/D3D11/D3D10/g plus a bunch of #ifs.

While this is an initial version, most of the code is there (limited
to what Gallium can express), and tri, gears and texturing demos
are working.

The primary goal is to realize Gallium's promise of multiple API
support, and provide an API that can be easily implemented with just
a very thin wrapper over Gallium, instead of the enormous amount of
complex code needed for OpenGL.

The secondary goal is to run Windows Direct3D 10/11 games on Linux
using Wine.
Wine dlls are currently not provided, but adding them should be
quite easy.

Fglrx and nvidia drivers can also be supported by writing a Gallium
driver that talks to them using OpenGL, which is a relatively easy
task.
Thanks to the great design of Direct3D 10/11 and closeness to Gallium,
this approach should not result in detectable overhead, and is the
most maintainable way to do it, providing a path to switch to the
open Gallium drivers once they are on par with the proprietary ones.

Currently Wine has a very limited Direct3D 10 implementation, and
completely lacks a Direct3D 11 implementation.

Note that Direct3D 10/11 are completely different from Direct3D 9
and earlier, and thus warrant a fully separate implementation.

The third goal is to provide a superior alternative to OpenGL for
graphics programming on non-Windows systems, particularly Linux
and other free and open systems.

Thanks to a very clean and well-though design done from scratch,
the Direct3D 10/11 APIs are vastly better than OpenGL and can be
supported with orders of magnitude less code and development time,
as you can see by comparing the lines of code of this commit and
those in the existing Mesa OpenGL implementation.

This would have been true for the Longs Peak proposal as well, but
unfortunately it was abandoned by Khronos, leaving the OpenGL
ecosystem without a graphics API with a modern design.

A binding of Direct3D 10/11 to EGL would solve this issue in the
most economical way possible, and this would be great to provide
in Mesa, since DXGI, the API used to bind Direct3D 10/11 to Windows,
is a bit suboptimal, especially on non-Windows platforms.

Finally, a mature Direct3D 10/11 implementation is intrinsically going
to be faster and more reliable than an OpenGL implementation, thanks
to the dramatically smaller API and the segregation of all nontrivial
work to object creation that the application must perform ahead of
time.

Currently, this commit contains:
- Independently created headers for Direct3D 10, 10.1, 11 and DXGI 1.1,
  partially based on the existing Wine headers for D3D10 and DXGI 1.0
- A parser for Direct3D 10/11 DXBC and TokenizedProgramFormat (TPF)
- A shader translator from TokenizedProgramFormat to TGSI
- Implementation of the Direct3D 11 core interfaces
- Automatically generated implementation of Direct3D 10 and 10.1
- Implementation of DXGI using the "native" framework of the EGL st
- Demos, usable either on Windows or on this implementation
  - d3d11tri, a clone of tri
  - d3d11tex, a (multi)texturing demo
  - d3d11gears, an improved version of glxgears
  - d3d11spikysphere, a D3D11 tessellation demo (currently Windows-only)
- A downloader for the Microsoft HLSL compiler, needed to recompile
  the shaders (compiled shader bytecode is also included)

To compile this, configure at least with these options:
--with-state-trackers=egl,d3d1x --with-egl-platforms=x11
plus some gallium drivers (such as softpipe with --enable-gallium-swrast)

The Wine headers (usually from a wine-dev or wine-devel package) must
be installed.
Only x86-32 has been tested.

You may need to run "make" in the subdirectories of src/gallium/winsys/sw
and you may need to manually run "sudo make install" in
src/gallium/targets/egl

To test it, run the demos in the "progs" directory.
Windows binaries are included to find out how demos should work, and to
test Wine integration when it will be done.

Enjoy, and let me know if you manage to compile and run this, or
which issues you are facing if not.

Using softpipe is recommended for now, and your mileage with hardware
drivers may vary.
However, getting this to work on hardware drivers is also obviously very
important.

Note that currently llvmpipe is buggy and causes all 3 gears to be
drawn with the same color.
Use export GALLIUM_DRIVER=softpipe to avoid this.

Thanks to all the Gallium contributors and especially the VMware
team, whose work made it possible to implement Direct3D 10/11 much
more easily than it would have been otherwise.
2010-09-21 10:58:17 +02:00
Tilman Sauerbeck
894a307a91 r600g: Removed debug code.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-21 08:13:35 +02:00
Dave Airlie
8893427377 r600g: fix eg texture borders.
texture border regs are indexed on evergreen.
2010-09-21 20:53:09 +10:00
Dave Airlie
b6ced8ee7b r600g: fixup evergreen miptree setup.
eg seems to have a higher pitch aligmment requirement and uses r700 cube setup

this fixes a couple of piglit tests here.
2010-09-21 20:53:09 +10:00
Tom Stellard
610aed81db r300/compiler: Refactor the pair instruction data structures
Use rc_pair_ prefix for all pair instruction structs

Create a named struct for pair instruction args

Replace structs radeon_pair_instruction_{rgb,alpha} with struct
radeon_pair_sub_instruction.  These two structs were nearly identical
and were creating a lot of cut and paste code.  These changes are the
first step towards removing some of that code.
2010-09-20 18:48:47 -07:00
Dave Airlie
84997cd566 r600g: set back to correct codepaths.
Jerome please use git diff and git show before pushing.
2010-09-21 11:32:15 +10:00
Dave Airlie
8e8b60588b r600g: deal with overflow of VTX/TEX CF clauses.
running piglit's texrect-many caused the vtx to overflow.
2010-09-21 11:26:01 +10:00
Vinson Lee
2491258436 tgsi: Remove duplicate case value. 2010-09-20 18:20:04 -07:00
Francisco Jerez
bf8f24c1c8 dri/nouveau: Fix software mipmap generation on 1x1 textures. 2010-09-21 03:04:04 +02:00
Francisco Jerez
98add55fff dri/nv10-nv20: Fix texturing in some cases after a base level change. 2010-09-21 03:03:39 +02:00
Francisco Jerez
22c83ac47a dri/nouveau: Cleanup more references to old FBOs and VBOs. 2010-09-21 03:03:01 +02:00
Francisco Jerez
13c246bcea dri/nouveau: Remove unnecessary assertion. 2010-09-21 02:43:12 +02:00
Francisco Jerez
72e5fd5c02 dri/nv04: Use nvgl_wrap_mode(). 2010-09-21 02:43:11 +02:00
Jakob Bornecrantz
d21301675c tgsi: Actually care what check_soa_dependencies says
Thanks to José for the more complete list of supported opcodes.

NOTE: This is a candidate for the 7.9 branch.
2010-09-21 02:19:09 +02:00
José Fonseca
c66f0c4629 tgsi: Don't ignore indirect registers in tgsi_check_soa_dependencies
NOTE: This is a candidate for the 7.9 branch.
2010-09-21 02:18:43 +02:00
Timo Wiren
99907303f6 Fix typos in comments and debug output strings.
Bug #30208.
2010-09-20 15:28:32 -07:00
Brian Paul
77af109554 draw: check bitshift against PIPE_MAX_SHADER_OUTPUS 2010-09-20 15:34:02 -06:00
Brian Paul
1662c31703 llvmpipe: check bitshift against PIPE_MAX_SHADER_OUTPUTS 2010-09-20 15:33:49 -06:00
Jerome Glisse
4fc5050f82 r600g: add back reference check when mapping buffer
Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-20 17:21:37 -04:00
Brian Paul
a7ea4d11fb draw: fix test for using the wide-point stage
As it was, we weren't obeying the draw->pipeline.point_sprite state.
Fixes point sprites in llvmpipe driver.
2010-09-20 14:07:41 -06:00
Jerome Glisse
0f099f2906 r600g: use pipe context for flushing inside map
This allow to share code path btw old & new, also
remove check on reference this might make things
a little slower but new design doesn't use reference
stuff.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-20 16:02:13 -04:00
Brian Paul
61fcd9aaa2 llvmpipe: implement sprite coord origin modes 2010-09-20 13:48:02 -06:00
Tilman Sauerbeck
021e68b2cd python/tests: Fixed tri.py for API and TGSI syntax changes.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-20 21:43:01 +02:00
Brian Paul
c3982c6bcd llvmpipe: rename sprite field, add sprite_coord_origin 2010-09-20 13:37:39 -06:00
Tilman Sauerbeck
ef419599d9 r600g: Implemented the Z and W component write for the SCS opcode.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-20 21:27:59 +02:00
Brian Paul
b7a5eac1f3 llvmpipe: clean-up, comments in setup_point_coefficient() 2010-09-20 13:26:27 -06:00
Tilman Sauerbeck
57bf96b43b r600g: Honour destination operand's writemask in the SCS implementation.
If we are not going to write to the X or Y components of the destination
vector we also don't need to prepare to compute SIN or COS.

Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-20 21:22:48 +02:00
Brian Paul
924c18da95 llvmpipe: reformatting, remove trailing whitespace, etc 2010-09-20 13:18:41 -06:00
Brian Paul
ebba92875a llvmpipe: indentation fix 2010-09-20 13:18:41 -06:00
Brian Paul
955d76c3d2 llvmpipe: maintain fragment shader state for draw module 2010-09-20 12:52:16 -06:00
Luca Barbieri
86d5ec70d1 softpipe: fix whitespace 2010-09-20 20:49:48 +02:00
Luca Barbieri
de71e7a4c9 tgsi: add switch/case opcodes to tgsi_opcode_tmp.h 2010-09-20 20:23:35 +02:00
Luca Barbieri
2e7d1c2c86 softpipe: make z/s test always pass if no zsbuf, instead of crashing
D3D10 specifies this.
2010-09-20 20:23:35 +02:00
Luca Barbieri
6d0b695fa7 gallium: avoid the C++ keyword "template" in sw_winsys.h 2010-09-20 20:23:34 +02:00
Brian Paul
b2ad8b5c22 gallivm: remove debug code 2010-09-20 11:21:44 -06:00
Brian Paul
7888a2f822 llvmpipe: fix query bug when no there's no scene 2010-09-20 10:50:35 -06:00
Marek Olšák
168554904b st/mesa: fix assertion failure in GetTexImage for cubemaps
Can be reproduced with mesa/demos/src/tests/blitfb.

NOTE: This is a candidate for the 7.9 branch.
2010-09-20 18:14:23 +02:00
Jerome Glisse
363dfb83f1 r600g: move chip class to radeon common structure
So texture code can be shared btw new state design
& old one.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-20 11:59:20 -04:00
Kenneth Graunke
6ea16b6c51 glsl: Fix broken handling of ir_binop_equal and ir_binop_nequal.
When ir_binop_all_equal and ir_binop_any_nequal were introduced, the
meaning of these two opcodes changed to return vectors rather than a
single scalar, but the constant expression handling code was incorrectly
written and only worked for scalars.  As a result, only the first
component of the returned vector would be properly initialized.
2010-09-20 17:33:13 +02:00
Kenneth Graunke
14eea26828 glsl: Add comments to clarify the types of comparison binops. 2010-09-20 17:31:16 +02:00
Brian Paul
0bc3e1f4f4 docs: mark as obsolete, remove dead links 2010-09-20 08:59:04 -06:00
Brian Paul
a8fde1ba4d docs: remove old broken link 2010-09-20 08:59:01 -06:00
Brian Paul
1739124159 glsl2: silence compiler warnings in printf() calls
Such as: "ir_validate.cpp:143: warning: format ‘%p’ expects type ‘void*’,
but argument 2 has type ‘ir_variable*’"
2010-09-20 08:22:54 -06:00
Brian Paul
5522887842 mesa: don't call valid_texture_object() in non-debug builds
This reverts commit c32bac57ed
and silences the warning differently.

The _mesa_reference_texobj() function is called quite a bit and
we don't want to call valid_texture_object() all the time in non-
debug builds.
2010-09-20 08:21:00 -06:00
Ian Romanick
e053d62aa5 glsl: Add doxygen comments 2010-09-20 07:09:03 -07:00
Jakob Bornecrantz
208f1f3810 i915g: Link with wrapper sw winsys with scons 2010-09-20 15:33:20 +02:00
Michal Krol
279492386f svga: Integer constant register file has a separate namespace.
Count int and float constants independently. Since there are only
few i# constants available and hundreds of c# constants, it would
be too easy to end up with an i# declaration out of its range.
2010-09-20 09:26:49 +01:00
Michal Krol
0742e0b376 svga: Fix relative addressing translation for pixel shaders.
Pixel shaders do not have address registers a#, only one
loop register aL. Our only hope is to assume the address
register is in fact a loop counter and replace it with aL.

Do not translate ARL instruction for pixel shaders -- MOVA
instruction is only valid for vertex saders.

Make it more explicit relative addressing of inputs is only valid
for pixel shaders and constants for vertex shaders.
2010-09-20 09:26:17 +01:00
Corbin Simpson
0d53dfa3c5 r600g: Cleanup viewport floats. 2010-09-19 23:05:02 -07:00
Corbin Simpson
e98062673e r600g: Clean up PS setup.
I didn't do r600d according to the docs; I split EXPORT_MODE to be a bit more
useful and obvious. Hope this is okay.
2010-09-19 23:05:02 -07:00
Dave Airlie
f4020c66fd r600g: only flush for the correct colorbuffer, not all of them. 2010-09-20 15:39:03 +10:00
Dave Airlie
7e5173d065 r600g: add missing BC_INST wrapper for evergreen 2010-09-20 15:38:40 +10:00
Dave Airlie
b110ddd9a9 r600g: fixup r700 CB_SHADER_CONTROL register.
r600c emits this with a mask of each written output.
2010-09-20 15:36:52 +10:00
Dave Airlie
d172ef3138 r600g: fix r700 cube map sizing.
this fixes fbo-cubemap on r700.
2010-09-20 15:30:52 +10:00
Dave Airlie
3a1defa5e8 r600g: add color/texture support for more depth formats. 2010-09-20 12:21:35 +10:00
Dave Airlie
2cabbb290f r600g: add z16 to color setup 2010-09-20 12:04:52 +10:00
Dave Airlie
9b146eae25 r600g: fix tiling support for ddx supplied buffers
needed to emit some more relocs to the kernel.
2010-09-20 11:40:33 +10:00
Corbin Simpson
c2ba729321 r600g: "tmp" is such a bad name for a texture. 2010-09-19 18:25:02 -07:00
Corbin Simpson
07b9e22a1f r600g: Fix false and true. 2010-09-19 18:25:02 -07:00
Corbin Simpson
eb347c7ef0 r600g: Clean up some indentation and |= vs. | usage. 2010-09-19 18:25:01 -07:00
Corbin Simpson
7ee9b0b951 r600g: Deobfuscate and comment a few more functions in r600_hw_states. 2010-09-19 18:25:01 -07:00
Corbin Simpson
f76b81423e r600g: Trivially deobfuscate r600_hw_states. 2010-09-19 18:25:01 -07:00
Corbin Simpson
5f5bf25af5 r600g: Use align() instead of handrolled code. 2010-09-19 18:25:01 -07:00
Dave Airlie
8d1ec80319 r600g: drop debugging that snuck in 2010-09-20 10:45:18 +10:00
Dave Airlie
040411de26 r600g: clean up valgrind issues on maxtargets test. 2010-09-20 10:44:44 +10:00
Dave Airlie
4af55364cc r600g: fix fbo-drawbuffers-maxtargets
we were leaking buffers since the flush code was added, it wasn't dropping references.
move setting up flush to the set_framebuffer_state.
clean up the flush state object.
make more space in the BOs array for flushing.
2010-09-20 10:35:38 +10:00
Dave Airlie
3d12c207d7 r600g: send correct surface base update for multi-cbufs 2010-09-20 10:15:26 +10:00
Dave Airlie
f59fe9671f r600g: modify index buffers for sizes the hw can't deal with.
this just uses the common code from r300g now in util to do translations on r600g.
2010-09-20 09:57:47 +10:00
Dave Airlie
91b70d8408 util/r300g: split the r300 index buffer modifier functions out to util
These can be used by other drivers, like r600g.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2010-09-20 09:38:18 +10:00
Henri Verbeet
f1cf04dbc0 r600g: fix exports_ps to export a number not a mask. 2010-09-20 09:30:21 +10:00
Jakob Bornecrantz
b83156d42f scons: Link against talloc in the Gallium DRI drivers 2010-09-20 00:03:58 +02:00
Jakob Bornecrantz
00272e9e09 rbug: Add function to get opcode name string 2010-09-20 00:03:58 +02:00
Jakob Bornecrantz
7faa37adf8 rbug: Cast opcode to corrent int size 2010-09-20 00:03:58 +02:00
Henri Verbeet
1934ade183 Revert "r600g: Flush upload buffers before draws instead of before flushes."
This reverts commit a1d9a58b82.
Flushing the upload buffers on draw is wrong, uploads aren't supposed to
cause flushes in the first place. The real issue was
radeon_bo_pb_map_internal() not respecting PB_USAGE_UNSYNCHRONIZED.
2010-09-19 23:03:03 +02:00
Henri Verbeet
0f9181811f r600g: Respect PB_USAGE_UNSYNCHRONIZED in radeon_bo_pb_map_internal(). 2010-09-19 23:03:03 +02:00
Tilman Sauerbeck
d323118c3e gallium/docs: Fixed a typo in the SCS opcode description.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-19 22:13:42 +02:00
Luca Barbieri
a01578c84f auxiliary: fix depth-only and stencil-only clears
Depth-only and stencil-only clears should mask out depth/stencil from the
output, mask out stencil/input from input, and OR or ADD them together.

However, due to a typo they were being ANDed, resulting in zeroing the buffer.
2010-09-19 21:52:02 +02:00
Henri Verbeet
affd46cc2b r600g: Buffer object maps imply a wait.
Unless e.g. PB_USAGE_DONTBLOCK or PB_USAGE_UNSYNCHRONIZED would be specified.
2010-09-19 19:43:05 +02:00
Henri Verbeet
de9c8015eb r600g: Remove a redundant flush in r600_texture_transfer_map().
radeon_ws_bo_map() will already take care of that if needed.
2010-09-19 19:43:05 +02:00
Henri Verbeet
b68030e9f8 r600g: Check for other references before checking for existing mappings in radeon_bo_pb_map_internal().
Having a non-NULL data pointer doesn't imply it's safe to reuse that mapping,
it may have been unmapped but not flushed yet.
2010-09-19 19:43:05 +02:00
Henri Verbeet
a1d9a58b82 r600g: Flush upload buffers before draws instead of before flushes.
If a upload buffer is used by a previous draw that's still in the CS,
accessing it would need a context flush. However, doing a context flush when
mapping the upload buffer would then flush/destroy the same buffer we're trying
to map there. Flushing the upload buffers before a draw avoids both the CS
flush and the upload buffer going away while it's being used. Note that
u_upload_data() could e.g. use a pool of buffers instead of allocating new
ones all the time if that turns out to be a significant issue.
2010-09-19 19:43:05 +02:00
Chia-I Wu
2a910b3396 egl: Enable drm platform by default.
This enables EGL_MESA_drm_display for st/egl in the default setup.
2010-09-19 17:35:04 +08:00
Chia-I Wu
e4513e7fb9 st/egl: s/kms/drm/ on the drm backend.
s/kms/drm/, s/kdpy/drmdpy/, and so forth.
2010-09-19 17:19:40 +08:00
Chia-I Wu
e7424d7240 st/egl: Rename kms backend to drm.
The main use of the backend is to support EGL_MESA_drm_display.  drm
should be a better name.
2010-09-19 17:19:03 +08:00
Chia-I Wu
c7c2e7d0ce st/egl: Split modeset code support to modeset.c.
The modeset code supports now obsolete EGL_MESA_screen_surface.  Move it
to a file of its own.
2010-09-19 16:37:48 +08:00
Dave Airlie
ed4f740127 r600g: only emit uses waterfall on r6xx hw. 2010-09-19 17:25:50 +10:00
Dave Airlie
c5edfcc410 r600g; add uses waterfall to asm cf for r6xx.
On r6xx if an MOVA instruction is emitted we should set this bit.
2010-09-19 17:20:15 +10:00
Tilman Sauerbeck
8861727c91 r600g: Added support for TGSI_SEMANTIC_FACE.
This makes the 'glsl1-gl_FrontFacing var (1)' piglit test pass.

Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-19 09:21:41 +02:00
Vinson Lee
fa10561908 nv50: Remove dead initialization. 2010-09-18 23:07:41 -07:00
Vinson Lee
03cf572598 nv50: Remove dead initialization. 2010-09-18 23:06:29 -07:00
Vinson Lee
ef715b866b nv50: Silence missing initializer warning.
Fixes this GCC warning.
nv50_state_validate.c:336: warning: missing initializer
nv50_state_validate.c:336: error: (near initialization for 'validate_list[20].func')
2010-09-18 15:59:00 -07:00
Christoph Bumiller
613c3901c3 nv50: fix typo in fifo packet length limit 2010-09-18 20:53:53 +02:00
Kenneth Graunke
dbd2480507 glsl/builtins: Switch comparison functions to just return an expression. 2010-09-18 16:23:48 +02:00
Kenneth Graunke
52f9156e88 glsl/builtins: Fix equal and notEqual builtins.
Commit 309cd4115b incorrectly converted
these to all_equal and any_nequal, which is the wrong operation.
2010-09-18 16:23:48 +02:00
Christoph Bumiller
4c1e7d931d nv50: emit constbuf relocs before uploading constants 2010-09-18 15:22:05 +02:00
Christoph Bumiller
275a81af13 nv50: add relocs for stack and local mem buffers 2010-09-18 15:21:59 +02:00
Kenneth Graunke
ca92ae2699 glsl: Properly handle nested structure types.
Fixes piglit test CorrectFull.frag.
2010-09-18 11:21:34 +02:00
Keith Whitwell
7ef3d171a0 graw: add frag-face shader 2010-09-18 09:15:14 +01:00
Vinson Lee
cef42f925c r600g: Remove unused variable. 2010-09-18 00:59:16 -07:00
Vinson Lee
b1a5c63467 nvfx: Silence uninitialized variable warnings. 2010-09-18 00:51:07 -07:00
Vinson Lee
013e4cca9f nvfx: Remove const qualifer from nvfx_vertprog_translate.
Silences this GCC warning.
nvfx_vertprog.c: In function 'nvfx_vertprog_translate':
nvfx_vertprog.c:998: warning: assignment discards qualifiers from pointer target type
2010-09-18 00:47:36 -07:00
Keith Whitwell
5b4c43d985 llvmpipe: use llvm for attribute interpolant calculation
Basically no change relative to hard-coded version, but this will
be useful for other changes later.
2010-09-18 08:40:17 +01:00
Tilman Sauerbeck
3894fddccc glsl2: Fixed cloning of ir_call error instructions.
Those have the callee field set to the null pointer, so
calling the public constructor will segfault.

Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-18 09:19:57 +02:00
Vinson Lee
a822ae3f1a glsl: Fix 'control reaches end of non-void function' warning.
Fixes this GCC warning.

lower_variable_index_to_cond_assign.cpp:
In member function
'bool variable_index_to_cond_assign_visitor::needs_lowering(ir_dereference_array*) const':

lower_variable_index_to_cond_assign.cpp:261:
warning: control reaches end of non-void function
2010-09-18 00:14:20 -07:00
Vinson Lee
9ea2a3af9c x86: Silence unused variable warning on Mac OS X.
Silences the following GCC warning on Mac OS X.
x86/common_x86.c:58: warning: 'detection_debug' defined but not used
2010-09-17 23:59:23 -07:00
Vinson Lee
c32bac57ed mesa: Silence "'valid_texture_object' defined but not used" warning. 2010-09-17 23:43:38 -07:00
Vinson Lee
ff78d6dcc0 ir_to_mesa: Remove unused member array_indexed from struct statevar_element.
Fixes this GCC warning.
warning: missing initializer for member 'statevar_element::array_indexed'
2010-09-17 23:35:09 -07:00
Vinson Lee
3c9653c3a0 mesa: bump version to 7.10 2010-09-17 17:52:13 -07:00
Brian Paul
f964f92bcc gallium/docs: added new pipeline.txt diagram
This diagram shows the rendering pipeline with an emphasis on
the inputs/outputs for each stage.  Some stages emit new vertex
attributes and others consume some attributes.
2010-09-17 18:50:47 -06:00
Brian Paul
e22e3927b0 gallium: rework handling of sprite_coord_enable state
Implement the pipe_rasterizer_state::sprite_coord_enable field
in the draw module (and softpipe) according to what's specified
in the documentation.

The draw module can now add any number of extra vertex attributes
to a post-transformed vertex and generate texcoords for those
attributes per sprite_coord_enable.  Auto-generated texcoords
for sprites only worked for one texcoord unit before.

The frag shader gl_PointCoord input is now implemented like any
other generic/texcoord attribute.

The draw module now needs to be informed about fragment shaders
since we need to look at the fragment shader's inputs to know
which ones need auto-generated texcoords.

Only softpipe has been updated so far.
2010-09-17 18:45:13 -06:00
Brian Paul
49cb978aa4 gallium: better docs for pipe_rasterizer_state::sprite_coord_enable 2010-09-17 18:41:05 -06:00
Tilman Sauerbeck
19f8f32a96 glsl2: Empty functions can be inlined.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
Signed-off-by: Kenneth Graunke <kenneth@whitecape.org>
2010-09-18 01:28:47 +02:00
Vinson Lee
da3db66c08 r600g: Silence unused variable warnings.
The variables are used in code that is currently ifdef'ed out.
2010-09-17 14:27:39 -07:00
Vinson Lee
d74a8da2cb r600g: Silence uninitialized variable warning. 2010-09-17 14:21:32 -07:00
Vinson Lee
2da4694955 r600g: Fix memory leak on error path. 2010-09-17 14:17:26 -07:00
Vinson Lee
d56e46577e r600g: Fix implicit declaration warning.
Fixes this GCC warning.
r600_state2.c: In function 'r600_context_flush':
r600_state2.c:946: error: implicit declaration of function 'drmCommandWriteRead'
2010-09-17 14:06:23 -07:00
Vinson Lee
36033a6446 r600g: Remove unnecessary headers. 2010-09-17 12:40:54 -07:00
Vinson Lee
694b1883ee r600g: Remove unnecessary header. 2010-09-17 12:38:29 -07:00
José Fonseca
65822eba94 llvmpipe: Default to no threading on single processor systems. 2010-09-17 19:18:43 +01:00
José Fonseca
903a66abaf util: linearized sRGB values don't fit into 8bits
Fixes glean texture_srgb test.
2010-09-17 19:18:42 +01:00
Brian Paul
c70d539e24 gallivm: added missing case for PIPE_TEXTURE_RECT
Fixes fd.o bug 30245
2010-09-17 12:16:45 -06:00
Jerome Glisse
fd266ec62c r600g: alternative command stream building from context
Winsys context build a list of register block a register block is
a set of consecutive register that will be emited together in the
same pm4 packet (the various r600_block* are there to provide basic
grouping that try to take advantage of states that are linked together)
Some consecutive register are emited each in a different block,
for instance the various cb[0-7]_base. At winsys context creation,
the list of block is created & an index into the list of block. So
to find into which block a register is in you simply use the register
offset and lookup the block index. Block are grouped together into
group which are the various pkt3 group of config, context, resource,

Pipe state build a list of register each state want to modify,
beside register value it also give a register mask so only subpart
of a register can be updated by a given pipe state (the oring is
in the winsys) There is no prebuild register list or define for
each pipe state. Once pipe state are built they are bound to
the winsys context.

Each of this functions will go through the list of register and
will find into which block each reg falls and will update the
value of the block with proper masking (vs/ps resource/constant
are specialized variant with somewhat limited capabilities).

Each block modified by r600_context_pipe_state_set* is marked as
dirty and we update a count of dwords needed to emit all dirty
state so far.

r600_context_pipe_state_set* should be call only when pipe context
change some of the state (thus when pipe bind state or set state)

Then to draw primitive you make a call to r600_context_draw
void r600_context_draw(struct r600_context *ctx, struct r600_draw *draw)
It will check if there is enough dwords in current cs buffer and
if not will flush. Once there is enough room it will copy packet
from dirty block and then add the draw packet3 to initiate the draw.

The flush will send the current cs, reset the count of dwords to
0 and remark all states that are enabled as dirty and recompute
the number of dwords needed to send the current context.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-17 10:49:05 -04:00
Tilman Sauerbeck
d80bed1566 r600g: Fixed the shift in S_02880C_KILL_ENABLE.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-17 14:08:54 +02:00
Tilman Sauerbeck
54d688f148 r600g: Enable PIPE_SHADER_CAP_TGSI_CONT_SUPPORTED.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-17 12:49:51 +02:00
Tilman Sauerbeck
70a85c39a9 r600g: Only set PA_SC_EDGERULE on rv770 and greater.
This is what xf86-video-ati and r600c do.

Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-17 12:17:48 +02:00
Tilman Sauerbeck
5f97d0a218 r600g: Added DB_SHADER_CONTROL defines.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-17 12:06:07 +02:00
Tilman Sauerbeck
5edb778c1b r600g: Formatting fixes.
Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-17 12:06:07 +02:00
Ian Romanick
a6ecd1c372 glsl2: Add flags to enable variable index lowering 2010-09-17 11:00:24 +02:00
Ian Romanick
6e4fe39da2 glsl2: Refactor testing for whether a deref is of a matrix or array 2010-09-17 11:00:24 +02:00
Luca Barbieri
a47539c7a1 glsl: add pass to lower variable array indexing to conditional assignments
Currenly GLSL happily generates indirect addressing of any kind of
arrays.

Unfortunately DirectX 9 GPUs are not guaranteed to support any of them in
general.

This pass fixes that by lowering such constructs to a binary search on the
values, followed at the end by vectorized generation of equality masks, and
4 conditional assignments for each mask generation.

Note that this requires the ir_binop_equal change so that we can emit SEQ
to generate the boolean masks.

Unfortunately, ir_structure_splitting is too dumb to turn the resulting
constant array references to individual variables, so this will need to
be added too before this pass can actually be effective for temps.

Several patches in the glsl2-lower-variable-indexing were squashed
into this commit.  These patches fix bugs in Luca's original
implementation, and the individual patches can be seen in that branch.
This was done to aid bisecting in the future.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2010-09-17 10:58:58 +02:00
Dave Airlie
dab2a7660a r600g: oops got the use_mem_constant the wrong way around.
this fixes evergreen gears again.
2010-09-18 00:28:06 +10:00
Dave Airlie
d0502297e0 r600g: use calloc for ctx bo allocations
since the reference code relies on these being NULL.
2010-09-17 15:29:32 +10:00
Dave Airlie
3ddc714b20 r600g: fixup map flushing.
long lived maps were getting removed when they shouldn't this
tries to avoid that problem by only adding to the flush list
on unmap.
2010-09-17 15:29:32 +10:00
Dave Airlie
0d76bb5d4c r600g: add upload manager support.
this add support for the upload manager for uploading user vbo/index buffers.

this provides a considerable speedup in q3 type games.
2010-09-17 15:29:31 +10:00
Dave Airlie
a927d0477a r600g: add winsys bo caching.
this adds the bo caching layer and uses it for vertex/index/constant bos.

ctx needs to take references on hw bos so the flushing works okay, also
needs to flush the maps.
2010-09-17 15:29:31 +10:00
Dave Airlie
da96313afe r600g: add support for kernel bo
this moves to using a pb bufmgr instead of kernel bos directly.
2010-09-17 15:29:31 +10:00
Dave Airlie
189a597513 r600g: use malloc bufmgr for constant buffers 2010-09-17 15:29:31 +10:00
Dave Airlie
7c1fcc41be r600g: move constant buffer creation behind winsys abstraction.
this paves the way for moving to pb bufmgrs now.
2010-09-17 15:29:31 +10:00
Chia-I Wu
0dbcf3b014 libgl-xlib: Remove unused st_api_create_OpenGL.
st/egl no longer relies on libGL for OpenGL support.
2010-09-17 12:54:26 +08:00
Chia-I Wu
cadc4ad963 targets/egl: Use C++ compiler to link GL/ES state trackers.
Otherwise, applications compiled with C compiler might have trouble
using them.
2010-09-17 12:54:03 +08:00
Francisco Jerez
82c4af33b0 dri/nv10: Fix the CLAMP texture wrap mode. 2010-09-17 05:34:32 +02:00
Brian Paul
4b27c614cf tgsi/sse: fix aos_to_soa() loop to handle num_inputs==0
Basically, change the loop from:
  do {...} while (--num_inputs != 0)
into:
  while (num_inputs != 0) { ... --num_inputs; }

Fixes fd.o bug 29987.
2010-09-16 19:05:09 -06:00
Dave Airlie
f70f79f6f6 r600g: attempt to abstract kernel bos from pipe driver.
introduce an abstraction layer between kernel bos and the winsys BOs.

this is to allow plugging in pb manager with minimal disruption to pipe driver.
2010-09-17 10:57:49 +10:00
Dave Airlie
ec9d838aa5 r600g: hide radeon_ctx inside winsys.
no need for this info to be exported to pipe driver.
2010-09-17 10:57:44 +10:00
Vinson Lee
b54d10b62e gallivm: Remove unnecessary header. 2010-09-16 15:34:24 -07:00
Brian Paul
7aadd5ecb5 gallivm: fix wrong return value in bitwise functions 2010-09-16 20:20:49 +01:00
José Fonseca
6d173da5c8 gallivm: Clamp indirect register indices to file_max.
Prevents crashes with bogus data, or bad shader translation.
2010-09-16 20:20:49 +01:00
José Fonseca
795eb3d64a gallivm: Start collecting bitwise arithmetic helpers in a new module. 2010-09-16 20:20:49 +01:00
José Fonseca
3d5b9c1f2d gallivm: Fix address register swizzle.
We're actually doing a double swizzling:

  indirect_reg->Swizzle[indirect_reg->SwizzleX]

instead of simply

  indirect_reg->SwizzleX
2010-09-16 20:20:49 +01:00
Francisco Jerez
50ac56bf98 meta: Don't bind the created texture object in init_temp_texture().
This function is executed outside _mesa_meta_begin/end(), that means
that e.g. _mesa_meta_Bitmap() clobbers the texturing state because it
changes the currently active texture object.

There's no need to bind the new texture when it's created, it's done
again later anyway (from setup_drawpix/copypix_texture()).

Signed-off-by: Brian Paul <brianp@vmware.com>
2010-09-16 13:00:57 -06:00
Brian Paul
3a6f9d0f47 mesa: include mfeatures.h in formats.c
Otherwise, FEATURE_EXT_texture_sRGB was undefined.
This is (part of?) the fix for fd.o bug 30177.
2010-09-16 12:41:51 -06:00
Marek Olšák
d4b2de13bc r300g/swtcl: fix CS overrun
https://bugs.freedesktop.org/show_bug.cgi?id=29901
2010-09-16 20:33:43 +02:00
Francisco Jerez
db94a2a5be dri/nouveau: Cleanup references to the old FBOs on glMakeCurrent(). 2010-09-16 19:44:22 +02:00
Francisco Jerez
d4d81ed02e dri/nouveau: Don't reemit the BO state in nouveau_state_emit(). 2010-09-16 19:44:22 +02:00
Francisco Jerez
bfc7518ab9 dri/nouveau: Don't request a fake front unnecessarily. 2010-09-16 19:44:22 +02:00
Francisco Jerez
39658f32ea dri/nouveau: Fix glRenderbufferStorage with DEPTH_COMPONENT as internal format. 2010-09-16 19:44:22 +02:00
Francisco Jerez
cbe0dd0f5a dri/nouveau: Add some more extensions. 2010-09-16 19:44:22 +02:00
Francisco Jerez
aad06c8524 dri/nouveau: Update nouveau_class.h. 2010-09-16 19:44:21 +02:00
Francisco Jerez
8f1051dca2 dri/nv04: Fix provoking vertex. 2010-09-16 19:44:21 +02:00
Francisco Jerez
286d8f2877 dri/nv04: Fix maximum texture size. 2010-09-16 19:44:21 +02:00
Francisco Jerez
7b06fdbd33 dri/nv04: Fix up color mask. 2010-09-16 19:44:21 +02:00
Francisco Jerez
0a6cfa1668 dri/nv04: Align SIFM transfer dimensions. 2010-09-16 19:44:21 +02:00
Francisco Jerez
bec626ff63 dri/nv04: Mipmapping fixes. 2010-09-16 19:44:21 +02:00
Francisco Jerez
aa317a40ce dri/nv04: Fix PGRAPH_ERRORs when running OA. 2010-09-16 19:44:21 +02:00
Andrew Randrianasulu
c344f27539 dri/nv04: Enable eng3dm for A8/L8 textures.
Signed-off-by: Francisco Jerez <currojerez@riseup.net>
2010-09-16 19:44:20 +02:00
Andrew Randrianasulu
a27bfb991c dri/nv04: Don't expose ARB_texture_env_combine/dot3.
Signed-off-by: Francisco Jerez <currojerez@riseup.net>
2010-09-16 19:44:20 +02:00
Keith Whitwell
0986355425 llvmpipe: add DEBUG_FS to dump variant information 2010-09-16 17:34:58 +01:00
Keith Whitwell
5f00819cb3 llvmpipe: add LP_PERF flag to disable various aspects of rasterization
Allows disabling various operations (mainly texture-related, but
will grow) to try & identify bottlenecks.

Unlike LP_DEBUG, this is active even in release builds - which is
necessary for performance investigation.
2010-09-16 17:34:19 +01:00
Keith Whitwell
045ee46011 gallivm: make lp_build_sample_nop public 2010-09-16 17:04:01 +01:00
Brian Paul
7640151c3d gallivm: move i32_vec_type inside the #ifdef 2010-09-16 09:00:54 -06:00
Brian Paul
3c9f4c7b75 gallivm: fix incorrect vector shuffle datatype
The permutation vector must always be a vector of int32 values.
2010-09-16 08:56:34 -06:00
Christoph Bumiller
3a62365f40 nv50: get shader fixups/relocations into working state 2010-09-16 14:49:23 +02:00
Christoph Bumiller
e0aa7e0438 nv50: don't segfault on shaders with 0 instructions 2010-09-16 14:49:20 +02:00
Kenneth Graunke
8fbe968a62 glsl: Don't print blank (function ...) headers for built-ins.
Fixes a regression caused when I added my GLSL ES support.
2010-09-16 03:09:25 -07:00
Kenneth Graunke
81f0339398 glsl: Change from has_builtin_signature to has_user_signature.
The print visitor needs this, and the only existing user can work with
has_user_signature just as well.
2010-09-16 02:52:25 -07:00
Tilman Sauerbeck
df62338c49 r600g: Use clamped math for RCP and RSQ.
This is likely only correct for OpenGL and not other state trackers.

Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-16 11:08:00 +02:00
Tilman Sauerbeck
2108caac25 r600g: Fixed a bo leak in r600_blit_state_ps_shader().
We would leak the newly created bo if it cannot be mapped.

Signed-off-by: Tilman Sauerbeck <tilman@code-monkey.de>
2010-09-16 11:07:32 +02:00
Chia-I Wu
03224f492d st/xlib: Notify the context when the front/back buffers are swapped.
The current context should be notified when the the front/back buffers
of the current drawable are swapped.  The notification was skipped when
xmesa_strict_invalidate is false (the default).

This fixes fdo bug #29774.
2010-09-16 13:09:48 +08:00
Chia-I Wu
9ca59b2427 mesa: Update ES APIspec.xml.
Enable some extensions now that the needed tokens are defined in
GLES/glext.h and GLES2/glext.h.  Update the prototype of MultiDrawArrays
now that the prototype of _mesa_MultiDrawArraysEXT has been updated.
2010-09-16 13:09:01 +08:00
Dave Airlie
ef2808f56f r600g: fix texture bos and avoid doing depth blit on evergreen
since the depth blit code is hardcoded hex yay \o/
2010-09-16 21:48:02 +10:00
Dave Airlie
9a589961a2 r600g: fixup texture state on evergreen.
This whole set of state just seems wrong, another cut-n-paste nightmare.
2010-09-16 21:29:08 +10:00
Vinson Lee
9f7f7b3ff8 mesa/st: Silence uninitialized variable warning. 2010-09-15 18:47:17 -07:00
Vinson Lee
0d2561a562 nv50: Fix 'control reaches end of non-void function' warning. 2010-09-15 18:26:06 -07:00
Vinson Lee
b09af4c391 nv50: Silence uninitialized variable warnings. 2010-09-15 18:24:28 -07:00
Vinson Lee
00118c4077 draw: Remove unnecessary header. 2010-09-15 18:17:51 -07:00
Vinson Lee
d94c7841b2 gallivm: Remove unnecessary headers. 2010-09-15 18:14:18 -07:00
Vinson Lee
84e41b738b nv50: Silence uninitialized variable warning. 2010-09-15 17:27:50 -07:00
Vinson Lee
b533bb7d86 nv50: Silence uninitialized variable warning. 2010-09-15 17:24:50 -07:00
Vinson Lee
cbc6748795 nv50: Silence uninitialized variable warning. 2010-09-15 17:09:59 -07:00
Vinson Lee
4d4278675e nv50: Remove unnecessary headers. 2010-09-15 16:51:39 -07:00
Vinson Lee
a64e3d2e6c nv50: Update files in SConscript to match Makefile. 2010-09-15 16:46:04 -07:00
Dave Airlie
1a20aae581 r600g: add vgt dma src defines 2010-09-16 09:41:43 +10:00
Dave Airlie
3ead528bbb r600g: use index min/max + index buffer offset.
more prep work for fixing up buffer handling
2010-09-16 09:40:42 +10:00
Dave Airlie
05433f20b6 r600g: pull r600_draw struct out into header
we need this for future buffer rework, it also makes the vtbl easier
2010-09-16 09:40:42 +10:00
Brian Paul
0a7824862e gallivm: expand AoS sampling to cover all filtering modes
...and all texture targets (1D/2D/3D/CUBE).
2010-09-15 17:04:31 -06:00
Brian Paul
95254bbd2d tgsi: fix incorrect usage_mask for shadow tex instructions
The shadow versions of the texture targets use an extra component
(Z) to express distance from light source to the fragment.
Fixes the shadowtex demo with llvmpipe.
2010-09-15 13:56:02 -06:00
Brian Paul
68cfc8e996 nv50: use unsigned int for bitfields to silence warnings 2010-09-15 12:51:09 -06:00
Brian Paul
3085efabb1 llvmpipe: s/boolean/unsigned/ in bitfield to silence warning
Using non-int types for bitfields is a gcc extension.
The size of the struct is not effected by this change.
2010-09-15 12:49:13 -06:00
Brian Paul
29289b43b7 llvmpipe: cast to silence warning 2010-09-15 12:48:29 -06:00
Brian Paul
7545514fb6 glsl2: fix signed/unsigned comparison warning 2010-09-15 12:47:32 -06:00
John Doe
e0b6df4fcc r600g: misc cleanup
Avoid using r600_screen structure to get ptr to radeon
winsys structure.

Signed-off-by: Jerome Glisse <jglisse@redhat.com>
2010-09-15 11:48:34 -04:00
Christoph Bumiller
26fe16a99b Merge remote branch 'origin/nv50-compiler'
Conflicts:
	src/gallium/drivers/nouveau/nouveau_class.h
	src/gallium/drivers/nv50/nv50_screen.c
2010-09-15 17:34:40 +02:00
Keith Whitwell
59ca1ae84b llvmpipe: return zero from floor_pot(zero) 2010-09-15 16:28:49 +01:00
Christoph Bumiller
84d170bbce nv50: put low limit on REG_ALLOC_TEMP and FP_RESULT_COUNT 2010-09-15 15:35:14 +02:00
Christoph Bumiller
c46e7a05e5 nv50: improve and fix modifier folding optimization
Execute before folding loads, because we don't check if it's legal
in lower_mods.
Ensure that a value's insn pointer is updated when transferring it
to a different instruction.
2010-09-15 15:35:14 +02:00
Christoph Bumiller
16d8f5fee5 nv50: consider address register in reload elimination 2010-09-15 15:35:14 +02:00
Keith Whitwell
be2fb11f10 llvmpipe: remove duplicate code
Bad rebase presumably.
2010-09-15 14:30:01 +01:00
Keith Whitwell
cc2ed02c0a llvmpipe: brackets around macro arg 2010-09-15 14:30:01 +01:00
Chia-I Wu
e3c46cf586 glapi: Fix ES build errors again.
This fixes an error in GLAPI ES.  My build is ok with or without this
patch, and the error affects others' setups.

[Patch from Francesco Marella]
2010-09-15 21:19:44 +08:00
Vinson Lee
efab1c8642 r600g: Silence unused variable warning.
The code that uses dname is currently ifdef'ed out.
2010-09-15 06:14:02 -07:00
Vinson Lee
1ce4f86803 r600g: Silence uninitialized variable warning. 2010-09-15 06:09:28 -07:00
Vinson Lee
a712e193a3 r600g: Silence uninitialized variable warning. 2010-09-15 05:52:16 -07:00
Vinson Lee
76c0576101 r600g: Silence uninitialized variable warning. 2010-09-15 05:46:34 -07:00
Vinson Lee
66a146dd05 nvfx: Silence uninitialized variable warnings. 2010-09-15 05:43:50 -07:00
Vinson Lee
9aee4be5e0 r600g: Silence uninitialized variable warning. 2010-09-15 05:34:29 -07:00
Vinson Lee
7290c5982c r600g: Silence uninitialized variable warning. 2010-09-15 05:31:31 -07:00
Vinson Lee
f20f2cc330 glsl: Fix 'format not a string literal and no format arguments' warning.
Fix the following GCC warning.
loop_controls.cpp: In function 'int calculate_iterations(ir_rvalue*, ir_rvalue*, ir_rvalue*, ir_expression_operation)':
loop_controls.cpp:88: warning: format not a string literal and no format arguments
2010-09-15 05:17:57 -07:00
Dave Airlie
09ef8e9283 r300g: fix buffer reuse issue caused by previous commit
caused by 0b9eb5c9bb

test run glxgears, resize.
2010-09-15 13:26:04 +02:00
Chia-I Wu
cad87ebc3a glapi: Fix build errors for ES.
The latest glext.h defines GL_FIXED.  Test GL_OES_fixed_point instead to
decide whether to define GLfixed and GLclampx.

This fixes fdo bug #30205.
2010-09-15 17:45:26 +08:00
Andre Maasikas
84f7b5d974 r600c: fix buffer height setting in dri2 case
fbHeight is 0 in this case

uncovered by changes in b0bc026c and should fix kernel rejecting command
streams after that commit
2010-09-15 11:32:18 +03:00
Marek Olšák
0b9eb5c9bb r300g: prevent creating multiple winsys BOs for the same handle
This fixes a DRM deadlock in the cubestorm xscreensaver, because somehow
there must not be 2 different BOs relocated in one CS if both BOs back
the same handle. I was told it is impossible to happen, but apparently
it is not, or there is something else wrong.
2010-09-15 04:29:18 +02:00
Vinson Lee
fd7f70af48 mesa: Include missing header in program.h.
Include compiler.h for ASSERT symbol.
2010-09-14 17:54:46 -07:00
Vinson Lee
6a8a506158 r600g: Remove unnecessary headers. 2010-09-14 17:42:47 -07:00
Luca Barbieri
ccb5e65bc9 auxiliary: fix unintended fallthrough 2010-09-14 21:45:01 +02:00
Vinson Lee
cdf74a1ab9 llvmpipe: Remove unnecessary header. 2010-09-14 14:23:17 -07:00
Brian Paul
4cd751bcc4 glx: add const qualifiers to __indirect_glMultiDrawArraysEXT() 2010-09-14 11:01:03 -06:00
Christoph Bumiller
60f34e9f60 nv50: fix TXP depth comparison value 2010-09-13 17:26:41 +02:00
Christoph Bumiller
0b8170103c nv50: fix indirect CONST access with large or negative offsets 2010-09-13 17:26:41 +02:00
Christoph Bumiller
3b3c20744f nv50: MOV TEMP[0], -CONST[0] must be float32 negation 2010-09-13 17:26:41 +02:00
Christoph Bumiller
1f1411f2cc nv50: interp cannot write flags reg 2010-09-13 17:26:41 +02:00
Christoph Bumiller
cca3906a9b nv50: check for immediates when turning MUL ADD into MAD 2010-09-13 17:26:41 +02:00
Christoph Bumiller
98c87c382d nv50: handle TGSI EXP and LOG again 2010-09-13 17:26:41 +02:00
Christoph Bumiller
1fa812d84a nv50: match TEMP limit with nv50 ir builder
Mesa doesn't respect it anyway, but this makes it assert rather
than threads access areas of l[] that don't belong to them.
2010-09-12 11:41:57 +02:00
Christoph Bumiller
fdb00ac1ef nv50: newlines in shader bincode printing 2010-09-12 11:41:57 +02:00
Christoph Bumiller
d4fd11a628 nv50: cannot move from local mem to output reg directly 2010-09-12 11:41:57 +02:00
Xavier Chantry
9b39fb1b61 nv50: fix size of outputs_written array 2010-09-12 00:59:50 +02:00
Christoph Bumiller
fc31a25afa nv50: minor compiler fixes and cleanups 2010-09-12 00:59:49 +02:00
Christoph Bumiller
7a4a537be1 nv50: reduce bb_reachable_by runtime from pot to linear
As a by-product, remove the memory leak of nv_basic_blocks.
2010-09-12 00:59:49 +02:00
Christoph Bumiller
6997da9f3c nv50: fix can_load check for 3rd source 2010-09-09 19:21:35 +02:00
Christoph Bumiller
6b14a3eb19 nv50: address regs are 16 bit 2010-09-09 19:21:34 +02:00
Christoph Bumiller
246ebd7df1 nv50: duplicate interps in load_proj_tex_coords
Otherwise we might clobber the origin interpolation result or
use the result of the RCP before its definition.
2010-09-09 19:21:34 +02:00
Christoph Bumiller
9cc80e25db nv50: create value references with the right type
Since atm our OPs aren't typed but instead values are, we need to
take care if they're used as different types (e.g. a load makes a
value u32 by default).

Maybe this should be changed (also to match TGSI), but it should
work as well if done properly.
2010-09-09 19:21:34 +02:00
Christoph Bumiller
f30810cb68 nv50: use actual loads/stores if TEMPs are accessed indirectly 2010-09-09 19:21:34 +02:00
Christoph Bumiller
d8dcff7970 nv50: don't parse again in tgsi_2_nc 2010-09-09 19:21:34 +02:00
Christoph Bumiller
d91b8865ec nv50: prepare for having multiple functions
At some point we'll want to support real subroutines instead of
just inlining them into the main shader.

Since recursive calls are forbidden, we can just save all used
registers to a fixed local memory region and restore them on a
return, no need for a stack pointer.
2010-09-09 19:21:34 +02:00
Christoph Bumiller
217542a061 nv50: save tgsi instructions 2010-09-09 19:21:34 +02:00
Christoph Bumiller
9e4901402c nv50: load address register before using it, not after 2010-09-03 14:27:23 +02:00
Christoph Bumiller
222d2f2ac2 Merge remote branch 'origin/master' into nv50-compiler
Conflicts:
	src/gallium/drivers/nv50/nv50_program.c
2010-09-02 18:31:49 +02:00
Christoph Bumiller
443abc80db nv50: fix build-predicate function 2010-09-02 18:28:47 +02:00
Christoph Bumiller
9f9ae4eee1 nv50: fix find_dom_frontier 2010-09-02 18:28:39 +02:00
Christoph Bumiller
a79da61a4b nv50: fix XPD, was negated 2010-09-01 18:02:51 +02:00
Christoph Bumiller
8e6ba3c8cc nv50: must join SELECT inputs before MOV inputs 2010-09-01 18:02:50 +02:00
Christoph Bumiller
e08f70a41d nv50: make use of TGSI immediate type 2010-09-01 18:02:50 +02:00
Christoph Bumiller
6f9978050e nv50: re-add proper TEXBIAS sequence 2010-09-01 18:02:50 +02:00
Christoph Bumiller
07fe7c2f02 nv50: make FrontFacing -1 or +1 2010-09-01 18:02:50 +02:00
Christoph Bumiller
917c79b384 nv50: SSG 2010-09-01 18:02:50 +02:00
Ben Skeggs
e02c63bc10 nv50: DPH 2010-09-01 18:02:50 +02:00
Ben Skeggs
7145ab214f nv50: DST 2010-09-01 18:02:50 +02:00
Christoph Bumiller
0a8292e096 nv50: attempt at making more complicated loops work
Nested loops, and loops with multiple exits (BREAK, CONT).
2010-09-01 18:02:50 +02:00
Christoph Bumiller
d90502b2b4 nv50: turn off verbose debug output by default 2010-09-01 18:02:50 +02:00
Christoph Bumiller
3844c36594 nv50: set the FragDepth output index 2010-09-01 18:02:50 +02:00
Christoph Bumiller
db1874272c nv50: handle TEXTURE_SWIZZLE and GEOMETRY_SHADER4 caps
GP support will probably be re-added soon.
2010-09-01 18:02:50 +02:00
Christoph Bumiller
bae181f78d nv50: fix check for sprite/point coord enable 2010-08-23 14:25:57 +02:00
Christoph Bumiller
0df5e84b01 nv50: yet another case we need a nop.exit 2010-08-23 14:25:53 +02:00
Christoph Bumiller
33f45c5a8a nv50: DP2, fix ARL 2010-08-23 14:25:51 +02:00
Christoph Bumiller
3e54d63429 Merge remote branch 'origin/master' into nv50-compiler 2010-08-18 14:37:47 +02:00
Christoph Bumiller
eaab764578 nv50: emit predicate for interp 2010-08-18 14:37:10 +02:00
Christoph Bumiller
1bbbc8e0c8 nv50: initialize edgeflag input index 2010-08-17 19:03:48 +02:00
Christoph Bumiller
3e27785f3e nv50: check dst compatibility in CSE 2010-08-17 15:30:35 +02:00
Christoph Bumiller
cb75082768 nv50: fix PSIZ and PRIMID mapping
Initializing map to 0x40 (0x80) instead of 0 now, so need to clear
it first.
2010-08-17 13:08:59 +02:00
Christoph Bumiller
ce1629564d nv50: more TGSI opcodes (SIN, SCS, ARL, RET, KILP) 2010-08-17 13:08:52 +02:00
Christoph Bumiller
62f933a6f6 nv50: generate JOINs for outermost IF clauses 2010-08-17 00:47:47 +02:00
Christoph Bumiller
6c5c55723d nv50: fix thinko in store to output reg possible check 2010-08-17 00:47:47 +02:00
Christoph Bumiller
e7a0bfa69a nv50: flatten simple IF/ELSE/ENDIF constructs
Less branching means less instructions and less thread divergence.
2010-08-17 00:47:46 +02:00
Christoph Bumiller
4de293bb9a nv50: loops part 2
At least the mesa demo glsl/mandelbrot should work now.
2010-08-15 21:40:00 +02:00
Christoph Bumiller
34e0db4c50 nv50: more constant folding 2010-08-15 21:39:57 +02:00
Christoph Bumiller
3a68fcfb6b nv50: begin implementing loops 2010-08-10 17:36:25 +02:00
Christoph Bumiller
fc1d72d15d nv50: fix reg count 2010-08-10 17:35:26 +02:00
Christoph Bumiller
aaa8802a22 nv50: build proper phi functions in the first place 2010-08-05 00:50:00 +02:00
Christoph Bumiller
720e0c430d nv50: fix constbuf validation
We only uploaded up to the highest offset a program would use,
and if the constant buffer isn't changed when a new program is
used, the new program is missing the rest of them.

Might want to introduce a "fill state" for user mem constbufs.
2010-08-05 00:50:00 +02:00
Christoph Bumiller
2c695d38e6 nv50: don't eliminate loads to dedicated values 2010-08-05 00:50:00 +02:00
Christoph Bumiller
fa67cabe7a nv50: fixes for nested IFs 2010-07-31 18:32:35 +02:00
Christoph Bumiller
5705b45b6a nv50: explicitly set src type for SET ops
Need to do this more nicely for all ops.
2010-07-31 18:32:35 +02:00
Christoph Bumiller
5de5e4fd5c nv50: insert MOVs also for PHI sources from dominating block
Otherwise we get live range conflicts for operands that are written
only in e.g. an ELSE block but not the IF block.
2010-07-31 18:32:35 +02:00
Christoph Bumiller
582311ca97 nv50: fix for empty BBs 2010-07-31 18:32:34 +02:00
Christoph Bumiller
28ded2585c nv50: add signed RGTC1 to format table, allow 2_10_10_10 for vbufs 2010-07-31 18:32:34 +02:00
Christoph Bumiller
7d34e79e44 nv50: add missing 2nd source for POW multiplication 2010-07-26 11:21:05 +02:00
Christoph Bumiller
e1ad3bd2f2 nv50: permit usage of undefined TGSI TEMPs 2010-07-26 11:20:52 +02:00
Christoph Bumiller
a3ba99b303 nv50: fix constant_operand opt mul by 2 case 2010-07-26 11:20:39 +02:00
Christoph Bumiller
5811c69264 nv50: simple reload elimination and local CSE 2010-07-26 11:20:28 +02:00
Christoph Bumiller
bb9d634730 nv50: add/fix some license headers 2010-07-24 22:16:40 +02:00
Christoph Bumiller
4baaf1d4c3 nv50: change back accidentally swapped UNORM,SNORM vertex type 2010-07-24 21:20:46 +02:00
Christoph Bumiller
1d1bb20612 nv50: don't produce MOV immediate to output reg in store opt 2010-07-24 21:20:40 +02:00
Christoph Bumiller
d7aac107e6 nv50: introduce the big formats table 2010-07-24 14:48:19 +02:00
Christoph Bumiller
f3af1201c5 nouveau: update nouveau_class.h
Adds nvc0, new vertex formats, and dual source blending values.
2010-07-24 14:48:15 +02:00
Christoph Bumiller
633f5ac612 nv50: import new compiler 2010-07-23 21:35:00 +02:00
2558 changed files with 291287 additions and 126318 deletions

3
Android.mk Normal file
View File

@@ -0,0 +1,3 @@
ifneq ($(TARGET_SIMULATOR),true)
include $(call all-subdir-makefiles)
endif

View File

@@ -180,7 +180,7 @@ ultrix-gcc:
# Rules for making release tarballs
VERSION=7.9-rc2
VERSION=7.11-devel
DIRECTORY = Mesa-$(VERSION)
LIB_NAME = MesaLib-$(VERSION)
GLUT_NAME = MesaGLUT-$(VERSION)
@@ -209,7 +209,6 @@ MAIN_FILES = \
$(DIRECTORY)/docs/README.* \
$(DIRECTORY)/docs/RELNOTES* \
$(DIRECTORY)/docs/*.spec \
$(DIRECTORY)/include/GL/internal/glcore.h \
$(DIRECTORY)/include/GL/gl.h \
$(DIRECTORY)/include/GL/glext.h \
$(DIRECTORY)/include/GL/gl_mangle.h \
@@ -232,6 +231,7 @@ MAIN_FILES = \
$(DIRECTORY)/src/glsl/README \
$(DIRECTORY)/src/glsl/glcpp/*.[chly] \
$(DIRECTORY)/src/glsl/glcpp/README \
$(DIRECTORY)/src/glsl/builtins \
$(DIRECTORY)/src/Makefile \
$(DIRECTORY)/src/mesa/Makefile* \
$(DIRECTORY)/src/mesa/sources.mak \
@@ -283,8 +283,7 @@ MAIN_FILES = \
$(DIRECTORY)/src/mesa/x86/*.S \
$(DIRECTORY)/src/mesa/x86/rtasm/*.[ch] \
$(DIRECTORY)/src/mesa/x86-64/*.[chS] \
$(DIRECTORY)/src/mesa/x86-64/Makefile \
$(DIRECTORY)/windows/VC8/
$(DIRECTORY)/src/mesa/x86-64/Makefile
MAPI_FILES = \
$(DIRECTORY)/include/GLES/*.h \
@@ -308,8 +307,7 @@ MAPI_FILES = \
$(DIRECTORY)/src/mapi/mapi/*.[ch] \
$(DIRECTORY)/src/mapi/vgapi/Makefile \
$(DIRECTORY)/src/mapi/vgapi/vgapi.csv \
$(DIRECTORY)/src/mapi/vgapi/vg.pc.in \
$(DIRECTORY)/src/mapi/vgapi/*.h
$(DIRECTORY)/src/mapi/vgapi/vg.pc.in
EGL_FILES = \
$(DIRECTORY)/include/KHR/*.h \
@@ -329,6 +327,8 @@ GALLIUM_FILES = \
$(DIRECTORY)/src/gallium/Makefile.template \
$(DIRECTORY)/src/gallium/SConscript \
$(DIRECTORY)/src/gallium/targets/Makefile.dri \
$(DIRECTORY)/src/gallium/targets/Makefile.xorg \
$(DIRECTORY)/src/gallium/targets/SConscript.dri \
$(DIRECTORY)/src/gallium/*/Makefile \
$(DIRECTORY)/src/gallium/*/SConscript \
$(DIRECTORY)/src/gallium/*/*/Makefile \
@@ -345,23 +345,19 @@ GALLIUM_FILES = \
DRI_FILES = \
$(DIRECTORY)/include/GL/internal/dri_interface.h \
$(DIRECTORY)/include/GL/internal/glcore.h \
$(DIRECTORY)/include/GL/internal/sarea.h \
$(DIRECTORY)/src/glx/Makefile \
$(DIRECTORY)/src/glx/Makefile \
$(DIRECTORY)/src/glx/*.[ch] \
$(DIRECTORY)/src/mesa/drivers/dri/Makefile \
$(DIRECTORY)/src/mesa/drivers/dri/Makefile.template \
$(DIRECTORY)/src/mesa/drivers/dri/dri.pc.in \
$(DIRECTORY)/src/mesa/drivers/dri/common/xmlpool/*.[ch] \
$(DIRECTORY)/src/mesa/drivers/dri/common/xmlpool/*.po \
$(DIRECTORY)/src/mesa/drivers/dri/*/*.[chS] \
$(DIRECTORY)/src/mesa/drivers/dri/*/*.cpp \
$(DIRECTORY)/src/mesa/drivers/dri/*/*/*.[chS] \
$(DIRECTORY)/src/mesa/drivers/dri/*/Makefile \
$(DIRECTORY)/src/mesa/drivers/dri/*/*/Makefile \
$(DIRECTORY)/src/mesa/drivers/dri/*/Doxyfile \
$(DIRECTORY)/src/mesa/drivers/dri/*/server/*.[ch]
$(DIRECTORY)/src/mesa/drivers/dri/*/Doxyfile
SGI_GLU_FILES = \
$(DIRECTORY)/src/glu/Makefile \
@@ -424,10 +420,22 @@ LIB_FILES = \
$(GLW_FILES)
# Everything for new a Mesa release:
tarballs: rm_depend configure aclocal.m4 lib_gz glut_gz \
lib_bz2 glut_bz2 lib_zip glut_zip md5
parsers: configure
-@touch $(TOP)/configs/current
$(MAKE) -C src/glsl glsl_parser.cpp glsl_parser.h glsl_lexer.cpp
$(MAKE) -C src/glsl/glcpp glcpp-lex.c glcpp-parse.c glcpp-parse.h
$(MAKE) -C src/mesa/program lex.yy.c program_parse.tab.c program_parse.tab.h
# Everything for new a Mesa release:
ARCHIVES = $(LIB_NAME).tar.gz \
$(LIB_NAME).tar.bz2 \
$(LIB_NAME).zip \
$(GLUT_NAME).tar.gz \
$(GLUT_NAME).tar.bz2 \
$(GLUT_NAME).zip
tarballs: md5
rm -f ../$(LIB_NAME).tar
# Helper for autoconf builds
ACLOCAL = aclocal
@@ -436,7 +444,7 @@ AUTOCONF = autoconf
AC_FLAGS =
aclocal.m4: configure.ac acinclude.m4
$(ACLOCAL) $(ACLOCAL_FLAGS)
configure: configure.ac aclocal.m4 acinclude.m4
configure: rm_depend configure.ac aclocal.m4 acinclude.m4
$(AUTOCONF) $(AC_FLAGS)
rm_depend:
@@ -445,47 +453,41 @@ rm_depend:
touch $$dep ; \
done
rm_config:
rm_config: parsers
rm -f configs/current
rm -f configs/autoconf
lib_gz: rm_config
cd .. ; \
tar -cf $(LIB_NAME).tar $(LIB_FILES) ; \
gzip $(LIB_NAME).tar ; \
mv $(LIB_NAME).tar.gz $(DIRECTORY)
$(LIB_NAME).tar: rm_config
cd .. ; tar -cf $(DIRECTORY)/$(LIB_NAME).tar $(LIB_FILES)
glut_gz:
cd .. ; \
tar -cf $(GLUT_NAME).tar $(GLUT_FILES) ; \
gzip $(GLUT_NAME).tar ; \
mv $(GLUT_NAME).tar.gz $(DIRECTORY)
$(LIB_NAME).tar.gz: $(LIB_NAME).tar
gzip --stdout --best $(LIB_NAME).tar > $(LIB_NAME).tar.gz
lib_bz2: rm_config
cd .. ; \
tar -cf $(LIB_NAME).tar $(LIB_FILES) ; \
bzip2 $(LIB_NAME).tar ; \
mv $(LIB_NAME).tar.bz2 $(DIRECTORY)
$(GLUT_NAME).tar: rm_depend
cd .. ; tar -cf $(DIRECTORY)/$(GLUT_NAME).tar $(GLUT_FILES)
glut_bz2:
cd .. ; \
tar -cf $(GLUT_NAME).tar $(GLUT_FILES) ; \
bzip2 $(GLUT_NAME).tar ; \
mv $(GLUT_NAME).tar.bz2 $(DIRECTORY)
$(GLUT_NAME).tar.gz: $(GLUT_NAME).tar
gzip --stdout --best $(GLUT_NAME).tar > $(GLUT_NAME).tar.gz
lib_zip: rm_config
$(LIB_NAME).tar.bz2: $(LIB_NAME).tar
bzip2 --stdout --best $(LIB_NAME).tar > $(LIB_NAME).tar.bz2
$(GLUT_NAME).tar.bz2: $(GLUT_NAME).tar
bzip2 --stdout --best $(GLUT_NAME).tar > $(GLUT_NAME).tar.bz2
$(LIB_NAME).zip: rm_config
rm -f $(LIB_NAME).zip ; \
cd .. ; \
zip -qr $(LIB_NAME).zip $(LIB_FILES) ; \
mv $(LIB_NAME).zip $(DIRECTORY)
glut_zip:
$(GLUT_NAME).zip:
rm -f $(GLUT_NAME).zip ; \
cd .. ; \
zip -qr $(GLUT_NAME).zip $(GLUT_FILES) ; \
mv $(GLUT_NAME).zip $(DIRECTORY)
md5:
md5: $(ARCHIVES)
@-md5sum $(LIB_NAME).tar.gz
@-md5sum $(LIB_NAME).tar.bz2
@-md5sum $(LIB_NAME).zip
@@ -493,7 +495,4 @@ md5:
@-md5sum $(GLUT_NAME).tar.bz2
@-md5sum $(GLUT_NAME).zip
.PHONY: tarballs rm_depend rm_config md5 \
lib_gz glut_gz \
lib_bz2 glut_bz2 \
lib_zip glut_zip
.PHONY: tarballs rm_depend rm_config md5

View File

@@ -3,14 +3,14 @@
#
# For example, invoke scons as
#
# scons debug=1 dri=0 machine=x86
# scons build=debug llvm=yes machine=x86
#
# to set configuration variables. Or you can write those options to a file
# named config.py:
#
# # config.py
# debug=1
# dri=0
# build='debug'
# llvm=True
# machine='x86'
#
# Invoke
@@ -30,55 +30,8 @@ import common
#######################################################################
# Configuration options
default_statetrackers = 'mesa'
default_targets = 'graw-null'
if common.default_platform in ('linux', 'freebsd', 'darwin'):
default_drivers = 'softpipe,galahad,failover,svga,i915,i965,trace,identity,llvmpipe'
default_winsys = 'xlib'
elif common.default_platform in ('winddk',):
default_drivers = 'softpipe,svga,i915,i965,trace,identity'
default_winsys = 'all'
elif common.default_platform in ('embedded',):
default_drivers = 'softpipe,llvmpipe'
default_winsys = 'xlib'
else:
default_drivers = 'all'
default_winsys = 'all'
opts = Variables('config.py')
common.AddOptions(opts)
opts.Add(ListVariable('statetrackers', 'state trackers to build', default_statetrackers,
['mesa', 'python', 'xorg', 'egl']))
opts.Add(ListVariable('drivers', 'pipe drivers to build', default_drivers,
['softpipe', 'galahad', 'failover', 'svga', 'i915', 'i965', 'trace', 'r300', 'r600', 'identity', 'llvmpipe', 'nouveau', 'nv50', 'nvfx']))
opts.Add(ListVariable('winsys', 'winsys drivers to build', default_winsys,
['xlib', 'vmware', 'i915', 'i965', 'gdi', 'radeon', 'r600', 'graw-xlib']))
opts.Add(ListVariable('targets', 'driver targets to build', default_targets,
['dri-i915',
'dri-i965',
'dri-nouveau',
'dri-radeong',
'dri-swrast',
'dri-vmwgfx',
'egl-i915',
'egl-i965',
'egl-nouveau',
'egl-radeon',
'egl-swrast',
'egl-vmwgfx',
'graw-xlib',
'graw-null',
'libgl-gdi',
'libgl-xlib',
'xorg-i915',
'xorg-i965',
'xorg-nouveau',
'xorg-radeon',
'xorg-vmwgfx']))
opts.Add(EnumVariable('MSVS_VERSION', 'MS Visual C++ version', None, allowed_values=('7.1', '8.0', '9.0')))
env = Environment(
options = opts,
@@ -87,61 +40,32 @@ env = Environment(
ENV = os.environ,
)
if os.environ.has_key('CC'):
env['CC'] = os.environ['CC']
if os.environ.has_key('CFLAGS'):
env['CCFLAGS'] += SCons.Util.CLVar(os.environ['CFLAGS'])
if os.environ.has_key('CXX'):
env['CXX'] = os.environ['CXX']
if os.environ.has_key('CXXFLAGS'):
env['CXXFLAGS'] += SCons.Util.CLVar(os.environ['CXXFLAGS'])
if os.environ.has_key('LDFLAGS'):
env['LINKFLAGS'] += SCons.Util.CLVar(os.environ['LDFLAGS'])
# Backwards compatability with old target configuration variable
try:
targets = ARGUMENTS['targets']
except KeyError:
pass
else:
targets = targets.split(',')
print 'scons: warning: targets option is deprecated; pass the targets on their own such as'
print
print ' scons %s' % ' '.join(targets)
print
COMMAND_LINE_TARGETS.append(targets)
Help(opts.GenerateHelpText(env))
# replicate options values in local variables
debug = env['debug']
dri = env['dri']
machine = env['machine']
platform = env['platform']
# derived options
x86 = machine == 'x86'
ppc = machine == 'ppc'
gcc = platform in ('linux', 'freebsd', 'darwin', 'embedded')
msvc = platform in ('windows', 'winddk')
Export([
'debug',
'x86',
'ppc',
'dri',
'platform',
'gcc',
'msvc',
])
# fail early for a common error on windows
if env['gles']:
try:
import libxml2
except ImportError:
raise SCons.Errors.UserError, "GLES requires libxml2-python to build"
#######################################################################
# Environment setup
# Always build trace, rbug, identity, softpipe, and llvmpipe (where possible)
if 'trace' not in env['drivers']:
env['drivers'].append('trace')
if 'rbug' not in env['drivers']:
env['drivers'].append('rbug')
if 'galahad' not in env['drivers']:
env['drivers'].append('galahad')
if 'identity' not in env['drivers']:
env['drivers'].append('identity')
if 'softpipe' not in env['drivers']:
env['drivers'].append('softpipe')
if env['llvm'] and 'llvmpipe' not in env['drivers']:
env['drivers'].append('llvmpipe')
if 'sw' not in env['drivers']:
env['drivers'].append('sw')
# Includes
env.Prepend(CPPPATH = [
'#/include',
@@ -157,7 +81,7 @@ if env['msvc']:
env.Append(CPPPATH = ['#include/c99'])
# Embedded
if platform == 'embedded':
if env['platform'] == 'embedded':
env.Append(CPPDEFINES = [
'_POSIX_SOURCE',
('_POSIX_C_SOURCE', '199309L'),
@@ -174,7 +98,7 @@ if platform == 'embedded':
])
# Posix
if platform in ('posix', 'linux', 'freebsd', 'darwin'):
if env['platform'] in ('posix', 'linux', 'freebsd', 'darwin'):
env.Append(CPPDEFINES = [
'_POSIX_SOURCE',
('_POSIX_C_SOURCE', '199309L'),
@@ -184,9 +108,9 @@ if platform in ('posix', 'linux', 'freebsd', 'darwin'):
'PTHREADS',
'HAVE_POSIX_MEMALIGN',
])
if gcc:
if env['gcc']:
env.Append(CFLAGS = ['-fvisibility=hidden'])
if platform == 'darwin':
if env['platform'] == 'darwin':
env.Append(CPPDEFINES = ['_DARWIN_C_SOURCE'])
env.Append(LIBS = [
'm',
@@ -197,8 +121,51 @@ if platform in ('posix', 'linux', 'freebsd', 'darwin'):
# for debugging
#print env.Dump()
Export('env')
#######################################################################
# Invoke host SConscripts
#
# For things that are meant to be run on the native host build machine, instead
# of the target machine.
#
# Create host environent
if env['crosscompile'] and env['platform'] != 'embedded':
host_env = Environment(
options = opts,
# no tool used
tools = [],
toolpath = ['#scons'],
ENV = os.environ,
)
# Override options
host_env['platform'] = common.host_platform
host_env['machine'] = common.host_machine
host_env['toolchain'] = 'default'
host_env['llvm'] = False
host_env.Tool('gallium')
host_env['hostonly'] = True
assert host_env['crosscompile'] == False
if host_env['msvc']:
host_env.Append(CPPPATH = ['#include/c99'])
target_env = env
env = host_env
Export('env')
SConscript(
'src/SConscript',
variant_dir = host_env['build_dir'],
duplicate = 0, # http://www.scons.org/doc/0.97/HTML/scons-user/x2261.html
)
env = target_env
Export('env')
#######################################################################
# Invoke SConscripts
@@ -208,9 +175,7 @@ Export('env')
SConscript(
'src/SConscript',
variant_dir = env['build'],
variant_dir = env['build_dir'],
duplicate = 0 # http://www.scons.org/doc/0.97/HTML/scons-user/x2261.html
)
env.Default('src')

View File

@@ -307,7 +307,7 @@ fi
#
case $ARCH in
'Linux' | 'OpenBSD' | 'DragonFly' | 'GNU' | GNU/*)
'Linux' | 'OpenBSD' | 'DragonFly' | 'GNU' | GNU/* | 'NetBSD')
# we assume gcc
if [ "x$LINK" = "x" ] ; then
@@ -574,20 +574,6 @@ case $ARCH in
fi
;;
'NetBSD')
if [ $STATIC = 1 ] ; then
LIBNAME="lib${LIBNAME}_pic.a"
echo "mklib: Making NetBSD PIC static library: " ${LIBNAME}
FINAL_LIBS=`make_ar_static_lib cq 1 ${LIBNAME} ${OBJECTS}`
else
LIBNAME="lib${LIBNAME}.so.${MAJOR}.${MINOR}"
echo "mklib: Making NetBSD PIC shared library: " ${LIBNAME}
rm -f ${LIBNAME}
ld -x -Bshareable -Bforcearchive -o ${LIBNAME} ${OBJECTS}
FINAL_LIBS=${LIBNAME}
fi
;;
'IRIX' | 'IRIX64')
if [ $STATIC = 1 ] ; then
LIBNAME="lib${LIBNAME}.a"

View File

@@ -8,17 +8,22 @@ import subprocess
import sys
import platform as _platform
import SCons.Script.SConscript
#######################################################################
# Defaults
_platform_map = {
'linux2': 'linux',
'win32': 'windows',
}
host_platform = _platform.system().lower()
if host_platform.startswith('cygwin'):
host_platform = 'cygwin'
default_platform = sys.platform
default_platform = _platform_map.get(default_platform, default_platform)
# Search sys.argv[] for a "platform=foo" argument since we don't have
# an 'env' variable at this point.
if 'platform' in SCons.Script.ARGUMENTS:
target_platform = SCons.Script.ARGUMENTS['platform']
else:
target_platform = host_platform
_machine_map = {
'x86': 'x86',
@@ -27,48 +32,39 @@ _machine_map = {
'i586': 'x86',
'i686': 'x86',
'ppc' : 'ppc',
'AMD64': 'x86_64',
'x86_64': 'x86_64',
}
# find default_machine value
# find host_machine value
if 'PROCESSOR_ARCHITECTURE' in os.environ:
default_machine = os.environ['PROCESSOR_ARCHITECTURE']
host_machine = os.environ['PROCESSOR_ARCHITECTURE']
else:
default_machine = _platform.machine()
default_machine = _machine_map.get(default_machine, 'generic')
host_machine = _platform.machine()
host_machine = _machine_map.get(host_machine, 'generic')
default_machine = host_machine
default_toolchain = 'default'
if target_platform == 'windows' and host_platform != 'windows':
default_machine = 'x86'
default_toolchain = 'crossmingw'
# find default_llvm value
if 'LLVM' in os.environ:
default_llvm = 'yes'
else:
# Search sys.argv[] for a "platform=foo" argument since we don't have
# an 'env' variable at this point.
platform = default_platform
pattern = re.compile("(platform=)(.*)")
for arg in sys.argv:
m = pattern.match(arg)
if m:
platform = m.group(2)
default_llvm = 'no'
try:
if platform != 'windows' and subprocess.call(['llvm-config', '--version'], stdout=subprocess.PIPE) == 0:
if target_platform != 'windows' and \
subprocess.call(['llvm-config', '--version'], stdout=subprocess.PIPE) == 0:
default_llvm = 'yes'
except:
pass
# find default_dri value
if default_platform in ('linux', 'freebsd'):
default_dri = 'yes'
elif default_platform in ('winddk', 'windows', 'wince', 'darwin'):
default_dri = 'no'
else:
default_dri = 'no'
#######################################################################
# Common options
@@ -81,13 +77,16 @@ def AddOptions(opts):
from SCons.Variables.EnumVariable import EnumVariable as EnumOption
except ImportError:
from SCons.Options.EnumOption import EnumOption
opts.Add(BoolOption('debug', 'debug build', 'yes'))
opts.Add(BoolOption('profile', 'profile build', 'no'))
opts.Add(EnumOption('build', 'build type', 'debug',
allowed_values=('debug', 'checked', 'profile', 'release')))
opts.Add(BoolOption('quiet', 'quiet command lines', 'yes'))
opts.Add(EnumOption('machine', 'use machine-specific assembly code', default_machine,
allowed_values=('generic', 'ppc', 'x86', 'x86_64')))
opts.Add(EnumOption('platform', 'target platform', default_platform,
allowed_values=('linux', 'cell', 'windows', 'winddk', 'wince', 'darwin', 'embedded', 'cygwin', 'sunos5', 'freebsd8')))
opts.Add('toolchain', 'compiler toolchain', 'default')
opts.Add(EnumOption('platform', 'target platform', host_platform,
allowed_values=('linux', 'cell', 'windows', 'winddk', 'wince', 'darwin', 'embedded', 'cygwin', 'sunos', 'freebsd8')))
opts.Add('toolchain', 'compiler toolchain', default_toolchain)
opts.Add(BoolOption('gles', 'EXPERIMENTAL: enable OpenGL ES support', 'no'))
opts.Add(BoolOption('llvm', 'use LLVM', default_llvm))
opts.Add(BoolOption('dri', 'build DRI drivers', default_dri))
opts.Add(BoolOption('debug', 'DEPRECATED: debug build', 'yes'))
opts.Add(BoolOption('profile', 'DEPRECATED: profile build', 'no'))
opts.Add(EnumOption('MSVS_VERSION', 'MS Visual C++ version', None, allowed_values=('7.1', '8.0', '9.0')))

View File

@@ -15,11 +15,13 @@ ASM_FLAGS = @ASM_FLAGS@
PIC_FLAGS = @PIC_FLAGS@
DEFINES = @DEFINES@
API_DEFINES = @API_DEFINES@
GLES_OVERLAY = @GLES_OVERLAY@
CFLAGS = @CPPFLAGS@ @CFLAGS@ \
SHARED_GLAPI = @SHARED_GLAPI@
CFLAGS_NOVISIBILITY = @CPPFLAGS@ @CFLAGS@ \
$(OPT_FLAGS) $(PIC_FLAGS) $(ARCH_FLAGS) $(ASM_FLAGS) $(DEFINES)
CXXFLAGS = @CPPFLAGS@ @CXXFLAGS@ \
CXXFLAGS_NOVISIBILITY = @CPPFLAGS@ @CXXFLAGS@ \
$(OPT_FLAGS) $(PIC_FLAGS) $(ARCH_FLAGS) $(DEFINES)
CFLAGS = $(CFLAGS_NOVISIBILITY) @VISIBILITY_CFLAGS@
CXXFLAGS = $(CXXFLAGS_NOVISIBILITY) @VISIBILITY_CXXFLAGS@
LDFLAGS = @LDFLAGS@
EXTRA_LIB_PATH = @EXTRA_LIB_PATH@
RADEON_CFLAGS = @RADEON_CFLAGS@
@@ -33,9 +35,9 @@ LLVM_LDFLAGS = @LLVM_LDFLAGS@
LLVM_LIBS = @LLVM_LIBS@
GLW_CFLAGS = @GLW_CFLAGS@
GLUT_CFLAGS = @GLUT_CFLAGS@
TALLOC_LIBS = @TALLOC_LIBS@
TALLOC_CFLAGS = @TALLOC_CFLAGS@
GLX_TLS = @GLX_TLS@
DRI_CFLAGS = @DRI_CFLAGS@
DRI_CXXFLAGS = @DRI_CXXFLAGS@
# dlopen
DLOPEN_LIBS = @DLOPEN_LIBS@
@@ -53,7 +55,7 @@ MKDEP_OPTIONS = @MKDEP_OPTIONS@
INSTALL = @INSTALL@
# Python and flags (generally only needed by the developers)
PYTHON2 = python
PYTHON2 = @PYTHON2@
PYTHON_FLAGS = -t -O -O
# Library names (base name)
@@ -65,6 +67,8 @@ OSMESA_LIB = @OSMESA_LIB@
GLESv1_CM_LIB = GLESv1_CM
GLESv2_LIB = GLESv2
VG_LIB = OpenVG
GLAPI_LIB = glapi
WAYLAND_EGL_LIB = wayland-egl
# Library names (actual file names)
GL_LIB_NAME = @GL_LIB_NAME@
@@ -76,6 +80,8 @@ EGL_LIB_NAME = @EGL_LIB_NAME@
GLESv1_CM_LIB_NAME = @GLESv1_CM_LIB_NAME@
GLESv2_LIB_NAME = @GLESv2_LIB_NAME@
VG_LIB_NAME = @VG_LIB_NAME@
GLAPI_LIB_NAME = @GLAPI_LIB_NAME@
WAYLAND_EGL_LIB_NAME = @WAYLAND_EGL_LIB_NAME@
# Globs used to install the lib and all symlinks
GL_LIB_GLOB = @GL_LIB_GLOB@
@@ -87,6 +93,8 @@ EGL_LIB_GLOB = @EGL_LIB_GLOB@
GLESv1_CM_LIB_GLOB = @GLESv1_CM_LIB_GLOB@
GLESv2_LIB_GLOB = @GLESv2_LIB_GLOB@
VG_LIB_GLOB = @VG_LIB_GLOB@
GLAPI_LIB_GLOB = @GLAPI_LIB_GLOB@
WAYLAND_EGL_LIB_GLOB = @WAYLAND_EGL_LIB_GLOB@
# Directories to build
LIB_DIR = @LIB_DIR@
@@ -103,7 +111,10 @@ GALLIUM_AUXILIARIES = $(TOP)/src/gallium/auxiliary/libgallium.a
GALLIUM_DRIVERS = $(foreach DIR,$(GALLIUM_DRIVERS_DIRS),$(TOP)/src/gallium/drivers/$(DIR)/lib$(DIR).a)
# Driver specific build vars
DRI_DIRS = @DRI_DIRS@
DRI_DIRS = @DRI_DIRS@
DRICORE_GLSL_LIBS = @DRICORE_GLSL_LIBS@
DRICORE_LIBS = @DRICORE_LIBS@
DRICORE_LIB_DEPS = @DRICORE_LIB_DEPS@
EGL_PLATFORMS = @EGL_PLATFORMS@
EGL_CLIENT_APIS = @EGL_CLIENT_APIS@
@@ -129,12 +140,16 @@ APP_LIB_DEPS = $(EXTRA_LIB_PATH) @APP_LIB_DEPS@
GLESv1_CM_LIB_DEPS = $(EXTRA_LIB_PATH) @GLESv1_CM_LIB_DEPS@
GLESv2_LIB_DEPS = $(EXTRA_LIB_PATH) @GLESv2_LIB_DEPS@
VG_LIB_DEPS = $(EXTRA_LIB_PATH) @VG_LIB_DEPS@
GLAPI_LIB_DEPS = $(EXTRA_LIB_PATH) @GLAPI_LIB_DEPS@
WAYLAND_EGL_LIB_DEPS = $(EXTRA_LIBPATH) @WAYLAND_EGL_LIB_DEPS@
# DRI dependencies
MESA_MODULES = @MESA_MODULES@
DRI_LIB_DEPS = $(EXTRA_LIB_PATH) @DRI_LIB_DEPS@
LIBDRM_CFLAGS = @LIBDRM_CFLAGS@
LIBDRM_LIB = @LIBDRM_LIBS@
DRI2PROTO_CFLAGS = @DRI2PROTO_CFLAGS@
GLPROTO_CFLAGS = @GLPROTO_CFLAGS@
EXPAT_INCLUDES = @EXPAT_INCLUDES@
# Autoconf directories
@@ -182,11 +197,16 @@ GLESv2_PC_LIB_PRIV = @GLESv2_PC_LIB_PRIV@
EGL_PC_REQ_PRIV = @GL_PC_REQ_PRIV@
EGL_PC_LIB_PRIV = @GL_PC_LIB_PRIV@
EGL_PC_CFLAGS = @GL_PC_CFLAGS@
WAYLAND_EGL_PC_REQ_PRIV = @WAYLAND_EGL_PC_REQ_PRIV@
WAYLAND_EGL_PC_LIB_PRIV = @WAYLAND_EGL_PC_LIB_PRIV@
WAYLAND_EGL_PC_CFLAGS = @WAYLAND_EGL_PC_CFLAGS@
XCB_DRI2_CFLAGS = @XCB_DRI2_CFLAGS@
XCB_DRI2_LIBS = @XCB_DRI2_LIBS@
LIBUDEV_CFLAGS = @LIBUDEV_CFLAGS@
LIBUDEV_LIBS = @LIBUDEV_LIBS@
WAYLAND_CFLAGS = @WAYLAND_CFLAGS@
WAYLAND_LIBS = @WAYLAND_LIBS@
MESA_LLVM = @MESA_LLVM@

View File

@@ -9,7 +9,7 @@ CONFIG_NAME = default
# Version info
MESA_MAJOR=7
MESA_MINOR=9
MESA_MINOR=11
MESA_TINY=0
MESA_VERSION = $(MESA_MAJOR).$(MESA_MINOR).$(MESA_TINY)
@@ -25,6 +25,7 @@ CXXFLAGS = -O
LDFLAGS =
HOST_CFLAGS = $(CFLAGS)
GLU_CFLAGS =
GLX_TLS = no
# Compiler for building demos/tests/etc
APP_CC = $(CC)
@@ -58,6 +59,8 @@ EGL_LIB = EGL
GLESv1_CM_LIB = GLESv1_CM
GLESv2_LIB = GLESv2
VG_LIB = OpenVG
GLAPI_LIB = glapi
WAYLAND_EGL_LIB = wayland-egl
# Library names (actual file names)
@@ -70,6 +73,8 @@ EGL_LIB_NAME = lib$(EGL_LIB).so
GLESv1_CM_LIB_NAME = lib$(GLESv1_CM_LIB).so
GLESv2_LIB_NAME = lib$(GLESv2_LIB).so
VG_LIB_NAME = lib$(VG_LIB).so
GLAPI_LIB_NAME = lib$(GLAPI_LIB).so
WAYLAND_EGL_LIB_NAME = lib$(WAYLAND_EGL_LIB).so
# globs used to install the lib and all symlinks
GL_LIB_GLOB = $(GL_LIB_NAME)*
@@ -81,9 +86,11 @@ EGL_LIB_GLOB = $(EGL_LIB_NAME)*
GLESv1_CM_LIB_GLOB = $(GLESv1_CM_LIB_NAME)*
GLESv2_LIB_GLOB = $(GLESv2_LIB_NAME)*
VG_LIB_GLOB = $(VG_LIB_NAME)*
GLAPI_LIB_GLOB = $(GLAPI_LIB_NAME)*
WAYLAND_EGL_LIB_GLOB = $(WAYLAND_EGL_LIB_NAME)*
TALLOC_LIBS = `pkg-config --libs talloc`
TALLOC_CFLAGS = `pkg-config --cflags talloc`
DRI_CFLAGS = $(CFLAGS)
DRI_CXXFLAGS = $(CXXFLAGS)
# Optional assembly language optimization files for libGL
MESA_ASM_SOURCES =
@@ -107,7 +114,7 @@ EGL_DRIVERS_DIRS = glx
# Gallium directories and
GALLIUM_DIRS = auxiliary drivers state_trackers
GALLIUM_AUXILIARIES = $(TOP)/src/gallium/auxiliary/libgallium.a
GALLIUM_DRIVERS_DIRS = softpipe trace rbug identity galahad i915 i965 svga r300 nvfx nv50 failover
GALLIUM_DRIVERS_DIRS = softpipe trace rbug noop identity galahad i915 i965 svga r300 nvfx nv50 failover
GALLIUM_DRIVERS = $(foreach DIR,$(GALLIUM_DRIVERS_DIRS),$(TOP)/src/gallium/drivers/$(DIR)/lib$(DIR).a)
GALLIUM_WINSYS_DIRS = sw sw/xlib
GALLIUM_TARGET_DIRS = libgl-xlib
@@ -119,7 +126,7 @@ EGL_CLIENT_APIS = $(GL_LIB)
# Library dependencies
#EXTRA_LIB_PATH ?=
GL_LIB_DEPS = $(EXTRA_LIB_PATH) -lX11 -lXext -lm -lpthread $(TALLOC_LIBS)
GL_LIB_DEPS = $(EXTRA_LIB_PATH) -lX11 -lXext -lm -lpthread
EGL_LIB_DEPS = $(EXTRA_LIB_PATH) -ldl -lpthread
OSMESA_LIB_DEPS = $(EXTRA_LIB_PATH) -L$(TOP)/$(LIB_DIR) -l$(GL_LIB)
GLU_LIB_DEPS = $(EXTRA_LIB_PATH) -L$(TOP)/$(LIB_DIR) -l$(GL_LIB) -lm
@@ -129,6 +136,8 @@ APP_LIB_DEPS = $(EXTRA_LIB_PATH) -L$(TOP)/$(LIB_DIR) -l$(GLUT_LIB) -l$(GLU_LI
GLESv1_CM_LIB_DEPS = $(EXTRA_LIB_PATH) -lpthread
GLESv2_LIB_DEPS = $(EXTRA_LIB_PATH) -lpthread
VG_LIB_DEPS = $(EXTRA_LIB_PATH) -lpthread
GLAPI_LIB_DEPS = $(EXTRA_LIB_PATH) -lpthread
WAYLAND_EGL_LIB_DEPS = $(EXTRA_LIB_PATH) -lwayland-client -ldrm
# Program dependencies - specific GL/glut libraries added in Makefiles
APP_LIB_DEPS = -lm
@@ -177,3 +186,6 @@ GLESv2_PC_CFLAGS =
VG_PC_REQ_PRIV =
VG_PC_LIB_PRIV =
VG_PC_CFLAGS =
WAYLAND_EGL_PC_REQ_PRIV =
WAYLAND_EGL_PC_LIB_PRIV =
WAYLAND_EGL_PC_CFLAGS =

View File

@@ -30,9 +30,11 @@ ASM_SOURCES =
MESA_ASM_SOURCES =
# Library/program dependencies
MESA_MODULES = $(TOP)/src/mesa/libmesa.a
LIBDRM_CFLAGS = `pkg-config --cflags libdrm`
LIBDRM_LIB = `pkg-config --libs libdrm`
DRI_LIB_DEPS = -L/usr/local/lib -lm -pthread -lexpat $(LIBDRM_LIB)
DRI_LIB_DEPS = $(MESA_MODULES) -L/usr/local/lib -lm -pthread -lexpat $(LIBDRM_LIB)
GL_LIB_DEPS = -L/usr/local/lib -lX11 -lXext -lXxf86vm -lXdamage -lXfixes \
-lm -pthread $(LIBDRM_LIB)

View File

@@ -43,9 +43,11 @@ MESA_ASM_SOURCES =
# Library/program dependencies
EXTRA_LIB_PATH=-L/usr/X11R6/lib
MESA_MODULES = $(TOP)/src/mesa/libmesa.a
LIBDRM_CFLAGS = $(shell pkg-config --cflags libdrm)
LIBDRM_LIB = $(shell pkg-config --libs libdrm)
DRI_LIB_DEPS = $(EXTRA_LIB_PATH) -lm -lpthread -lexpat -ldl -ltalloc $(LIBDRM_LIB)
DRI_LIB_DEPS = $(MESA_MODULES) $(EXTRA_LIB_PATH) -lm -lpthread -lexpat -ldl $(LIBDRM_LIB)
GL_LIB_DEPS = $(EXTRA_LIB_PATH) -lX11 -lXext -lXxf86vm -lXdamage -lXfixes \
-lm -lpthread -ldl $(LIBDRM_LIB)
@@ -58,7 +60,7 @@ EGL_DRIVERS_DIRS = glx
DRIVER_DIRS = dri
GALLIUM_WINSYS_DIRS = sw sw/xlib drm/vmware drm/intel drm/i965
GALLIUM_TARGET_DIRS = egl-swrast
GALLIUM_TARGET_DIRS =
GALLIUM_STATE_TRACKERS_DIRS = egl
DRI_DIRS = i810 i915 i965 mach64 mga r128 r200 r300 radeon \

View File

@@ -41,9 +41,11 @@ MESA_ASM_SOURCES =
# Library/program dependencies
EXTRA_LIB_PATH=$(shell pkg-config --libs-only-L x11)
MESA_MODULES = $(TOP)/src/mesa/libmesa.a
LIBDRM_CFLAGS = $(shell pkg-config --cflags libdrm)
LIBDRM_LIB = $(shell pkg-config --libs libdrm)
DRI_LIB_DEPS = $(EXTRA_LIB_PATH) -lm -lpthread -lexpat -ldl $(LIBDRM_LIB)
DRI_LIB_DEPS = $(MESA_MODULES) $(EXTRA_LIB_PATH) -lm -lpthread -lexpat -ldl $(LIBDRM_LIB)
GL_LIB_DEPS = $(EXTRA_LIB_PATH) -lX11 -lXext -lXxf86vm -lm -lpthread -ldl \
$(LIBDRM_LIB) $(shell pkg-config --libs xcb) $(shell pkg-config --libs x11-xcb) $(shell pkg-config --libs xcb-glx)

View File

@@ -38,9 +38,11 @@ MESA_ASM_SOURCES =
# Library/program dependencies
EXTRA_LIB_PATH=-L/usr/X11R6/lib
MESA_MODULES = $(TOP)/src/mesa/libmesa.a
LIBDRM_CFLAGS = $(shell pkg-config --cflags libdrm)
LIBDRM_LIB = $(shell pkg-config --libs libdrm)
DRI_LIB_DEPS = $(EXTRA_LIB_PATH) -lm -lpthread -lexpat -ldl $(LIBDRM_LIB)
DRI_LIB_DEPS = $(MESA_MODULES) $(EXTRA_LIB_PATH) -lm -lpthread -lexpat -ldl $(LIBDRM_LIB)
GL_LIB_DEPS = $(EXTRA_LIB_PATH) -lX11 -lXext -lXxf86vm -lXdamage -lXfixes \
-lm -lpthread -ldl \
$(LIBDRM_LIB)

View File

@@ -42,7 +42,8 @@ MESA_ASM_SOURCES =
# Library/program dependencies
EXTRA_LIB_PATH=-L/usr/X11R6/lib
DRI_LIB_DEPS = $(EXTRA_LIB_PATH) -lm -lpthread -lexpat -ldl
MESA_MODULES = $(TOP)/src/mesa/libmesa.a
DRI_LIB_DEPS = $(MESA_MODULES) $(EXTRA_LIB_PATH) -lm -lpthread -lexpat -ldl
GL_LIB_DEPS = $(EXTRA_LIB_PATH) -lX11 -lXext -lXxf86vm -lm -lpthread -ldl

View File

@@ -12,10 +12,10 @@ GALLIUM_DRIVERS_DIRS += llvmpipe
OPT_FLAGS = -O3 -ansi -pedantic
ARCH_FLAGS = -mmmx -msse -msse2 -mstackrealign
DEFINES += -DNDEBUG -DGALLIUM_LLVMPIPE -DHAVE_UDIS86
DEFINES += -DNDEBUG -DGALLIUM_LLVMPIPE
# override -std=c99
CFLAGS += -std=gnu99 -D__STDC_CONSTANT_MACROS
CFLAGS += -std=gnu99
LLVM_VERSION := $(shell llvm-config --version)
@@ -30,10 +30,10 @@ else
endif
ifeq ($(MESA_LLVM),1)
# LLVM_CFLAGS=`llvm-config --cflags`
LLVM_CXXFLAGS=`llvm-config --cxxflags backend bitreader engine ipo interpreter instrumentation` -Wno-long-long
LLVM_LDFLAGS = $(shell llvm-config --ldflags backend bitreader engine ipo interpreter instrumentation)
LLVM_LIBS = $(shell llvm-config --libs backend bitwriter bitreader engine ipo interpreter instrumentation)
LLVM_CFLAGS=`llvm-config --cppflags`
LLVM_CXXFLAGS=`llvm-config --cxxflags` -Wno-long-long
LLVM_LDFLAGS = $(shell llvm-config --ldflags)
LLVM_LIBS = $(shell llvm-config --libs)
MKLIB_OPTIONS=-cplusplus
else
LLVM_CFLAGS=
@@ -41,4 +41,4 @@ else
endif
LD = g++
GL_LIB_DEPS = $(LLVM_LDFLAGS) $(LLVM_LIBS) $(EXTRA_LIB_PATH) -lX11 -lXext -lm -lpthread -ltalloc -lstdc++ -ludis86
GL_LIB_DEPS = $(LLVM_LDFLAGS) $(LLVM_LIBS) $(EXTRA_LIB_PATH) -lX11 -lXext -lm -lpthread -lstdc++

View File

@@ -18,11 +18,12 @@ AC_CONFIG_AUX_DIR([bin])
AC_CANONICAL_HOST
dnl Versions for external dependencies
LIBDRM_REQUIRED=2.4.15
LIBDRM_RADEON_REQUIRED=2.4.17
LIBDRM_REQUIRED=2.4.24
LIBDRM_RADEON_REQUIRED=2.4.24
LIBDRM_INTEL_REQUIRED=2.4.24
DRI2PROTO_REQUIRED=2.1
GLPROTO_REQUIRED=1.4.11
LIBDRM_XORG_REQUIRED=2.4.17
LIBDRM_XORG_REQUIRED=2.4.24
LIBKMS_XORG_REQUIRED=1.0.0
dnl Check for progs
@@ -30,9 +31,14 @@ AC_PROG_CPP
AC_PROG_CC
AC_PROG_CXX
AC_CHECK_PROGS([MAKE], [gmake make])
AC_CHECK_PROGS([PYTHON2], [python2 python])
AC_PATH_PROG([MKDEP], [makedepend])
AC_PATH_PROG([SED], [sed])
if test "x$MKDEP" = "x"; then
AC_MSG_ERROR([makedepend is required to build Mesa])
fi
dnl Our fallback install-sh is a symlink to minstall. Use the existing
dnl configuration in that case.
AC_PROG_INSTALL
@@ -145,9 +151,13 @@ if test "x$GCC" = xyes; then
# Enable -fvisibility=hidden if using a gcc that supports it
save_CFLAGS="$CFLAGS"
AC_MSG_CHECKING([whether $CC supports -fvisibility=hidden])
CFLAGS="$CFLAGS -fvisibility=hidden"
VISIBILITY_CFLAGS="-fvisibility=hidden"
CFLAGS="$CFLAGS $VISIBILITY_CFLAGS"
AC_LINK_IFELSE([AC_LANG_PROGRAM()], AC_MSG_RESULT([yes]),
[CFLAGS="$save_CFLAGS" ; AC_MSG_RESULT([no])]);
[VISIBILITY_CFLAGS=""; AC_MSG_RESULT([no])]);
# Restore CFLAGS; VISIBILITY_CFLAGS are added to it where needed.
CFLAGS=$save_CFLAGS
# Work around aliasing bugs - developers should comment this out
CFLAGS="$CFLAGS -fno-strict-aliasing"
@@ -158,14 +168,21 @@ if test "x$GXX" = xyes; then
# Enable -fvisibility=hidden if using a gcc that supports it
save_CXXFLAGS="$CXXFLAGS"
AC_MSG_CHECKING([whether $CXX supports -fvisibility=hidden])
CXXFLAGS="$CXXFLAGS -fvisibility=hidden"
VISIBILITY_CXXFLAGS="-fvisibility=hidden"
CXXFLAGS="$CXXFLAGS $VISIBILITY_CXXFLAGS"
AC_LINK_IFELSE([AC_LANG_PROGRAM()], AC_MSG_RESULT([yes]),
[CXXFLAGS="$save_CXXFLAGS" ; AC_MSG_RESULT([no])]);
[VISIBILITY_CXXFLAGS="" ; AC_MSG_RESULT([no])]);
# Restore CXXFLAGS; VISIBILITY_CXXFLAGS are added to it where needed.
CXXFLAGS=$save_CXXFLAGS
# Work around aliasing bugs - developers should comment this out
CXXFLAGS="$CXXFLAGS -fno-strict-aliasing"
fi
AC_SUBST([VISIBILITY_CFLAGS])
AC_SUBST([VISIBILITY_CXXFLAGS])
dnl These should be unnecessary, but let the user set them if they want
AC_ARG_VAR([OPT_FLAGS], [Additional optimization flags for the compiler.
Default is to use CFLAGS.])
@@ -311,6 +328,8 @@ EGL_LIB_NAME='lib$(EGL_LIB).'${LIB_EXTENSION}
GLESv1_CM_LIB_NAME='lib$(GLESv1_CM_LIB).'${LIB_EXTENSION}
GLESv2_LIB_NAME='lib$(GLESv2_LIB).'${LIB_EXTENSION}
VG_LIB_NAME='lib$(VG_LIB).'${LIB_EXTENSION}
GLAPI_LIB_NAME='lib$(GLAPI_LIB).'${LIB_EXTENSION}
WAYLAND_EGL_LIB_NAME='lib$(WAYLAND_EGL_LIB).'${LIB_EXTENSION}
GL_LIB_GLOB=${LIB_PREFIX_GLOB}'$(GL_LIB)'${LIB_VERSION_SEPARATOR}'*'${LIB_EXTENSION}'*'
GLU_LIB_GLOB=${LIB_PREFIX_GLOB}'$(GLU_LIB)'${LIB_VERSION_SEPARATOR}'*'${LIB_EXTENSION}'*'
@@ -322,6 +341,8 @@ EGL_LIB_GLOB=${LIB_PREFIX_GLOB}'$(EGL_LIB)'${LIB_VERSION_SEPARATOR}'*'${LIB_EXTE
GLESv1_CM_LIB_GLOB=${LIB_PREFIX_GLOB}'$(GLESv1_CM_LIB)'${LIB_VERSION_SEPARATOR}'*'${LIB_EXTENSION}'*'
GLESv2_LIB_GLOB=${LIB_PREFIX_GLOB}'$(GLESv2_LIB)'${LIB_VERSION_SEPARATOR}'*'${LIB_EXTENSION}'*'
VG_LIB_GLOB=${LIB_PREFIX_GLOB}'$(VG_LIB)'${LIB_VERSION_SEPARATOR}'*'${LIB_EXTENSION}'*'
GLAPI_LIB_GLOB=${LIB_PREFIX_GLOB}'$(GLAPI_LIB)'${LIB_VERSION_SEPARATOR}'*'${LIB_EXTENSION}'*'
WAYLAND_EGL_LIB_GLOB=${LIB_PREFIX_GLOB}'$(WAYLAND_EGL_LIB)'${LIB_VERSION_SEPARATOR}'*'${LIB_EXTENSION}'*'
AC_SUBST([GL_LIB_NAME])
AC_SUBST([GLU_LIB_NAME])
@@ -332,6 +353,8 @@ AC_SUBST([EGL_LIB_NAME])
AC_SUBST([GLESv1_CM_LIB_NAME])
AC_SUBST([GLESv2_LIB_NAME])
AC_SUBST([VG_LIB_NAME])
AC_SUBST([GLAPI_LIB_NAME])
AC_SUBST([WAYLAND_EGL_LIB_NAME])
AC_SUBST([GL_LIB_GLOB])
AC_SUBST([GLU_LIB_GLOB])
@@ -342,6 +365,8 @@ AC_SUBST([EGL_LIB_GLOB])
AC_SUBST([GLESv1_CM_LIB_GLOB])
AC_SUBST([GLESv2_LIB_GLOB])
AC_SUBST([VG_LIB_GLOB])
AC_SUBST([GLAPI_LIB_GLOB])
AC_SUBST([WAYLAND_EGL_LIB_GLOB])
dnl
dnl Arch/platform-specific settings
@@ -372,14 +397,14 @@ if test "x$enable_asm" = xyes; then
case "$host_cpu" in
i?86)
case "$host_os" in
linux* | *freebsd* | dragonfly*)
linux* | *freebsd* | dragonfly* | *netbsd*)
test "x$enable_64bit" = xyes && asm_arch=x86_64 || asm_arch=x86
;;
esac
;;
x86_64)
case "$host_os" in
linux* | *freebsd* | dragonfly*)
linux* | *freebsd* | dragonfly* | *netbsd*)
test "x$enable_32bit" = xyes && asm_arch=x86 || asm_arch=x86_64
;;
esac
@@ -460,6 +485,77 @@ if test "x$enable_selinux" = "xyes"; then
DEFINES="$DEFINES -DMESA_SELINUX"
fi
dnl Determine which APIs to support
AC_ARG_ENABLE([opengl],
[AS_HELP_STRING([--disable-opengl],
[disable support for standard OpenGL API @<:@default=no@:>@])],
[enable_opengl="$enableval"],
[enable_opengl=yes])
AC_ARG_ENABLE([gles1],
[AS_HELP_STRING([--enable-gles1],
[enable support for OpenGL ES 1.x API @<:@default=no@:>@])],
[enable_gles1="$enableval"],
[enable_gles1=no])
AC_ARG_ENABLE([gles2],
[AS_HELP_STRING([--enable-gles2],
[enable support for OpenGL ES 2.x API @<:@default=no@:>@])],
[enable_gles2="$enableval"],
[enable_gles2=no])
AC_ARG_ENABLE([gles-overlay],
[AS_HELP_STRING([--enable-gles-overlay],
[DEPRECATED. Same as --enable-gles1 and --enable-gles2])],
[enable_gles1="$enableval"; enable_gles2="$enableval"],
[])
AC_ARG_ENABLE([openvg],
[AS_HELP_STRING([--enable-openvg],
[enable support for OpenVG API @<:@default=no@:>@])],
[enable_openvg="$enableval"],
[enable_openvg=no])
dnl smooth the transition; should be removed eventually
if test "x$enable_openvg" = xno; then
case "x$with_state_trackers" in
x*vega*)
AC_MSG_WARN([vega state tracker is enabled without --enable-openvg])
enable_openvg=yes
;;
esac
fi
if test "x$enable_opengl" = xno -a \
"x$enable_gles1" = xno -a \
"x$enable_gles2" = xno -a \
"x$enable_openvg" = xno; then
AC_MSG_ERROR([at least one API should be enabled])
fi
API_DEFINES=""
if test "x$enable_opengl" = xno; then
API_DEFINES="$API_DEFINES -DFEATURE_GL=0"
else
API_DEFINES="$API_DEFINES -DFEATURE_GL=1"
fi
if test "x$enable_gles1" = xyes; then
API_DEFINES="$API_DEFINES -DFEATURE_ES1=1"
fi
if test "x$enable_gles2" = xyes; then
API_DEFINES="$API_DEFINES -DFEATURE_ES2=1"
fi
AC_SUBST([API_DEFINES])
AC_ARG_ENABLE([shared-glapi],
[AS_HELP_STRING([--enable-shared-glapi],
[EXPERIMENTAL. Enable shared glapi for OpenGL @<:@default=no@:>@])],
[enable_shared_glapi="$enableval"],
[enable_shared_glapi=no])
SHARED_GLAPI="0"
if test "x$enable_shared_glapi" = xyes; then
SHARED_GLAPI="1"
fi
AC_SUBST([SHARED_GLAPI])
dnl
dnl Driver configuration. Options are xlib, dri and osmesa right now.
dnl More later: fbdev, ...
@@ -472,13 +568,17 @@ linux*)
i*86|x86_64|powerpc*|sparc*) default_driver="dri";;
esac
;;
*freebsd* | dragonfly*)
*freebsd* | dragonfly* | *netbsd*)
case "$host_cpu" in
i*86|x86_64|powerpc*|sparc*) default_driver="dri";;
esac
;;
esac
if test "x$enable_opengl" = xno; then
default_driver="no"
fi
AC_ARG_WITH([driver],
[AS_HELP_STRING([--with-driver=DRIVER],
[driver for Mesa: xlib,dri,osmesa @<:@default=dri when available, or xlib@:>@])],
@@ -487,31 +587,66 @@ AC_ARG_WITH([driver],
dnl Check for valid option
case "x$mesa_driver" in
xxlib|xdri|xosmesa)
if test "x$enable_opengl" = xno; then
AC_MSG_ERROR([Driver '$mesa_driver' requires OpenGL enabled])
fi
;;
xno)
;;
*)
AC_MSG_ERROR([Driver '$mesa_driver' is not a valid option])
;;
esac
PKG_CHECK_MODULES([TALLOC], [talloc])
AC_SUBST([TALLOC_LIBS])
AC_SUBST([TALLOC_CFLAGS])
dnl
dnl Driver specific build directories
dnl
dnl this variable will be prepended to SRC_DIRS and is not exported
CORE_DIRS="mapi/glapi glsl mesa"
CORE_DIRS=""
SRC_DIRS=""
GLU_DIRS="sgi"
GALLIUM_DIRS="auxiliary drivers state_trackers"
GALLIUM_TARGET_DIRS=""
GALLIUM_WINSYS_DIRS="sw"
GALLIUM_DRIVERS_DIRS="softpipe failover galahad trace rbug identity"
GALLIUM_DRIVERS_DIRS="softpipe failover galahad trace rbug noop identity"
GALLIUM_STATE_TRACKERS_DIRS=""
# build shared-glapi if enabled for OpenGL or if OpenGL ES is enabled
case "x$enable_shared_glapi$enable_gles1$enable_gles2" in
x*yes*)
CORE_DIRS="$CORE_DIRS mapi/shared-glapi"
;;
esac
# build glapi if OpenGL is enabled
if test "x$enable_opengl" = xyes; then
CORE_DIRS="$CORE_DIRS mapi/glapi"
fi
# build es1api if OpenGL ES 1.x is enabled
if test "x$enable_gles1" = xyes; then
CORE_DIRS="$CORE_DIRS mapi/es1api"
fi
# build es2api if OpenGL ES 2.x is enabled
if test "x$enable_gles2" = xyes; then
CORE_DIRS="$CORE_DIRS mapi/es2api"
fi
# build vgapi if OpenVG is enabled
if test "x$enable_openvg" = xyes; then
CORE_DIRS="$CORE_DIRS mapi/vgapi"
fi
# build glsl and mesa if OpenGL or OpenGL ES is enabled
case "x$enable_opengl$enable_gles1$enable_gles2" in
x*yes*)
CORE_DIRS="$CORE_DIRS glsl mesa"
;;
esac
case "$mesa_driver" in
xlib)
DRIVER_DIRS="x11"
@@ -526,6 +661,9 @@ dri)
osmesa)
DRIVER_DIRS="osmesa"
;;
no)
DRIVER_DRIS=""
;;
esac
AC_SUBST([SRC_DIRS])
AC_SUBST([GLU_DIRS])
@@ -608,8 +746,8 @@ xlib)
GL_PC_LIB_PRIV="$GL_LIB_DEPS"
GL_PC_CFLAGS="$X11_INCLUDES"
fi
GL_LIB_DEPS="$GL_LIB_DEPS $SELINUX_LIBS -lm -lpthread $TALLOC_LIBS"
GL_PC_LIB_PRIV="$GL_PC_LIB_PRIV $SELINUX_LIBS -lm -lpthread $TALLOC_LIBS"
GL_LIB_DEPS="$GL_LIB_DEPS $SELINUX_LIBS -lm -lpthread"
GL_PC_LIB_PRIV="$GL_PC_LIB_PRIV $SELINUX_LIBS -lm -lpthread"
# if static, move the external libraries to the programs
# and empty the libraries for libGL
@@ -618,7 +756,7 @@ xlib)
GL_LIB_DEPS=""
fi
;;
dri)
dri|no) # these checks are still desired when there is no mesa_driver
# DRI must be shared, I think
if test "$enable_static" = yes; then
AC_MSG_ERROR([Can't use static libraries for DRI drivers])
@@ -689,11 +827,48 @@ AC_SUBST([GLESv1_CM_PC_LIB_PRIV])
AC_SUBST([GLESv2_LIB_DEPS])
AC_SUBST([GLESv2_PC_LIB_PRIV])
GLAPI_LIB_DEPS="-lpthread"
AC_SUBST([GLAPI_LIB_DEPS])
dnl Setup default DRI CFLAGS
DRI_CFLAGS='$(CFLAGS)'
DRI_CXXFLAGS='$(CXXFLAGS)'
DRI_LIB_DEPS='$(TOP)/src/mesa/libmesa.a'
MESA_MODULES='$(TOP)/src/mesa/libmesa.a'
AC_ARG_ENABLE([shared-dricore],
[AS_HELP_STRING([--enable-shared-dricore],
[link DRI modules with shared core DRI routines @<:@default=disabled@:>@])],
[enable_dricore="$enableval"],
[enable_dricore=no])
if test "$mesa_driver" = dri ; then
if test "$enable_dricore" = yes ; then
if test "$GCC$GXX" != yesyes ; then
AC_MSG_WARN([Shared dricore requires GCC-compatible rpath handling. Disabling shared dricore])
enable_dricore=no
else
DRICORE_GLSL_LIBS='$(TOP)/$(LIB_DIR)/libglsl.so'
DRICORE_LIBS='$(TOP)/$(LIB_DIR)/libdricore.so'
DRICORE_LIB_DEPS='-L$(TOP)/$(LIB_DIR) -Wl,-R$(DRI_DRIVER_INSTALL_DIR) -lglsl'
DRI_LIB_DEPS='-L$(TOP)/$(LIB_DIR) -Wl,-R$(DRI_DRIVER_INSTALL_DIR) -ldricore -lglsl'
DRI_CFLAGS='$(CFLAGS_NOVISIBILITY) -DUSE_DRICORE'
DRI_CXXFLAGS='$(CXXFLAGS_NOVISIBILITY) -DUSE_DRICORE'
MESA_MODULES='$(DRICORE_LIBS) $(DRICORE_GLSL_LIBS)'
fi
fi
fi
AC_SUBST([DRICORE_LIBS])
AC_SUBST([DRICORE_GLSL_LIBS])
AC_SUBST([DRICORE_LIB_DEPS])
AC_SUBST([DRI_CXXFLAGS])
AC_SUBST([DRI_CFLAGS])
AC_SUBST([MESA_MODULES])
AC_SUBST([HAVE_XF86VIDMODE])
PKG_CHECK_MODULES([LIBDRM_RADEON],
[libdrm_radeon libdrm >= $LIBDRM_RADEON_REQUIRED],
[libdrm_radeon >= $LIBDRM_RADEON_REQUIRED],
HAVE_LIBDRM_RADEON=yes,
HAVE_LIBDRM_RADEON=no)
@@ -705,13 +880,22 @@ if test "$mesa_driver" = xlib; then
fi
dnl
dnl More DRI setup
dnl TLS detection
dnl
AC_ARG_ENABLE([glx-tls],
[AS_HELP_STRING([--enable-glx-tls],
[enable TLS support in GLX @<:@default=disabled@:>@])],
[GLX_USE_TLS="$enableval"],
[GLX_USE_TLS=no])
AC_SUBST(GLX_TLS, ${GLX_USE_TLS})
AS_IF([test "x$GLX_USE_TLS" = xyes],
[DEFINES="${DEFINES} -DGLX_USE_TLS -DPTHREADS"])
dnl
dnl More DRI setup
dnl
dnl Directory for DRI drivers
AC_ARG_WITH([dri-driverdir],
[AS_HELP_STRING([--with-dri-driverdir=DIR],
@@ -743,51 +927,6 @@ if test "x$with_dri_drivers" = x; then
with_dri_drivers=no
fi
dnl Determine which APIs to support
AC_ARG_ENABLE([opengl],
[AS_HELP_STRING([--disable-opengl],
[disable support for standard OpenGL API @<:@default=no@:>@])],
[enable_opengl="$enableval"],
[enable_opengl=yes])
AC_ARG_ENABLE([gles1],
[AS_HELP_STRING([--enable-gles1],
[enable support for OpenGL ES 1.x API @<:@default=no@:>@])],
[enable_gles1="$enableval"],
[enable_gles1=no])
AC_ARG_ENABLE([gles2],
[AS_HELP_STRING([--enable-gles2],
[enable support for OpenGL ES 2.x API @<:@default=no@:>@])],
[enable_gles2="$enableval"],
[enable_gles2=no])
AC_ARG_ENABLE([gles-overlay],
[AS_HELP_STRING([--enable-gles-overlay],
[build separate OpenGL ES only libraries @<:@default=no@:>@])],
[enable_gles_overlay="$enableval"],
[enable_gles_overlay=no])
API_DEFINES=""
GLES_OVERLAY=0
if test "x$enable_opengl" = xno; then
API_DEFINES="$API_DEFINES -DFEATURE_GL=0"
else
API_DEFINES="$API_DEFINES -DFEATURE_GL=1"
fi
if test "x$enable_gles1" = xyes; then
API_DEFINES="$API_DEFINES -DFEATURE_ES1=1"
fi
if test "x$enable_gles2" = xyes; then
API_DEFINES="$API_DEFINES -DFEATURE_ES2=1"
fi
if test "x$enable_gles_overlay" = xyes -o \
"x$enable_gles1" = xyes -o "x$enable_gles2" = xyes; then
CORE_DIRS="mapi/es1api mapi/es2api $CORE_DIRS"
if test "x$enable_gles_overlay" = xyes; then
GLES_OVERLAY=1
fi
fi
AC_SUBST([API_DEFINES])
AC_SUBST([GLES_OVERLAY])
dnl If $with_dri_drivers is yes, directories will be added through
dnl platform checks
DRI_DIRS=""
@@ -808,12 +947,7 @@ yes)
esac
dnl Set DRI_DIRS, DEFINES and LIB_DEPS
if test "$mesa_driver" = dri; then
# Use TLS in GLX?
if test "x$GLX_USE_TLS" = xyes; then
DEFINES="$DEFINES -DGLX_USE_TLS -DPTHREADS"
fi
if test "$mesa_driver" = dri -o "$mesa_driver" = no; then
# Platform specific settings and drivers to build
case "$host_os" in
linux*)
@@ -848,16 +982,13 @@ if test "$mesa_driver" = dri; then
;;
esac
;;
freebsd* | dragonfly*)
freebsd* | dragonfly* | *netbsd*)
DEFINES="$DEFINES -DPTHREADS -DUSE_EXTERNAL_DXTN_LIB=1"
DEFINES="$DEFINES -DIN_DRI_DRIVER -DHAVE_ALIAS"
DEFINES="$DEFINES -DGLX_INDIRECT_RENDERING"
if test "x$driglx_direct" = xyes; then
DEFINES="$DEFINES -DGLX_DIRECT_RENDERING"
fi
if test "x$GXX" = xyes; then
CXXFLAGS="$CXXFLAGS -ansi -pedantic"
fi
if test "x$DRI_DIRS" = "xyes"; then
DRI_DIRS="i810 i915 i965 mach64 mga r128 r200 r300 r600 radeon tdfx \
@@ -886,22 +1017,24 @@ if test "$mesa_driver" = dri; then
DRI_DIRS=`echo "$DRI_DIRS" | $SED 's/ */ /g'`
# Check for expat
EXPAT_INCLUDES=""
EXPAT_LIB=-lexpat
AC_ARG_WITH([expat],
[AS_HELP_STRING([--with-expat=DIR],
[expat install directory])],[
EXPAT_INCLUDES="-I$withval/include"
CPPFLAGS="$CPPFLAGS $EXPAT_INCLUDES"
LDFLAGS="$LDFLAGS -L$withval/$LIB_DIR"
EXPAT_LIB="-L$withval/$LIB_DIR -lexpat"
])
AC_CHECK_HEADER([expat.h],[],[AC_MSG_ERROR([Expat required for DRI.])])
AC_CHECK_LIB([expat],[XML_ParserCreate],[],
[AC_MSG_ERROR([Expat required for DRI.])])
if test "$mesa_driver" = dri; then
EXPAT_INCLUDES=""
EXPAT_LIB=-lexpat
AC_ARG_WITH([expat],
[AS_HELP_STRING([--with-expat=DIR],
[expat install directory])],[
EXPAT_INCLUDES="-I$withval/include"
CPPFLAGS="$CPPFLAGS $EXPAT_INCLUDES"
LDFLAGS="$LDFLAGS -L$withval/$LIB_DIR"
EXPAT_LIB="-L$withval/$LIB_DIR -lexpat"
])
AC_CHECK_HEADER([expat.h],[],[AC_MSG_ERROR([Expat required for DRI.])])
AC_CHECK_LIB([expat],[XML_ParserCreate],[],
[AC_MSG_ERROR([Expat required for DRI.])])
fi
# put all the necessary libs together
DRI_LIB_DEPS="$SELINUX_LIBS $LIBDRM_LIBS $EXPAT_LIB -lm -lpthread $DLOPEN_LIBS $TALLOC_LIBS"
# put all the necessary libs together, including possibly libdricore
DRI_LIB_DEPS="$DRI_LIB_DEPS $SELINUX_LIBS $LIBDRM_LIBS $EXPAT_LIB -lm -lpthread $DLOPEN_LIBS"
fi
AC_SUBST([DRI_DIRS])
AC_SUBST([EXPAT_INCLUDES])
@@ -909,7 +1042,7 @@ AC_SUBST([DRI_LIB_DEPS])
case $DRI_DIRS in
*i915*|*i965*)
PKG_CHECK_MODULES([INTEL], [libdrm_intel >= 2.4.21])
PKG_CHECK_MODULES([INTEL], [libdrm_intel >= $LIBDRM_INTEL_REQUIRED])
;;
esac
@@ -939,6 +1072,9 @@ AC_ARG_ENABLE([gl-osmesa],
[gl_osmesa="$enableval"],
[gl_osmesa="$default_gl_osmesa"])
if test "x$gl_osmesa" = xyes; then
if test "x$enable_opengl" = xno; then
AC_MSG_ERROR([OpenGL is not available for OSMesa driver])
fi
if test "$mesa_driver" = osmesa; then
AC_MSG_ERROR([libGL is not available for OSMesa driver])
else
@@ -974,12 +1110,12 @@ case "$DRIVER_DIRS" in
*osmesa*)
# only link libraries with osmesa if shared
if test "$enable_static" = no; then
OSMESA_LIB_DEPS="-lm -lpthread $SELINUX_LIBS $DLOPEN_LIBS $TALLOC_LIBS"
OSMESA_LIB_DEPS="-lm -lpthread $SELINUX_LIBS $DLOPEN_LIBS"
else
OSMESA_LIB_DEPS=""
fi
OSMESA_MESA_DEPS=""
OSMESA_PC_LIB_PRIV="-lm -lpthread $SELINUX_LIBS $DLOPEN_LIBS $TALLOC_LIBS"
OSMESA_PC_LIB_PRIV="-lm -lpthread $SELINUX_LIBS $DLOPEN_LIBS"
;;
esac
AC_SUBST([OSMESA_LIB_DEPS])
@@ -995,13 +1131,21 @@ AC_ARG_ENABLE([egl],
[disable EGL library @<:@default=enabled@:>@])],
[enable_egl="$enableval"],
[enable_egl=yes])
if test "x$enable_egl" = xno; then
if test "x$mesa_driver" = xno; then
AC_MSG_ERROR([cannot disable EGL when there is no mesa driver])
fi
if test "x$enable_openvg" = xyes; then
AC_MSG_ERROR([cannot enable OpenVG without EGL])
fi
fi
if test "x$enable_egl" = xyes; then
SRC_DIRS="$SRC_DIRS egl"
EGL_LIB_DEPS="$DLOPEN_LIBS -lpthread"
EGL_DRIVERS_DIRS=""
if test "$enable_static" != yes; then
# build egl_glx when libGL is built
if test "$mesa_driver" != osmesa; then
if test "$mesa_driver" = xlib -o "$mesa_driver" = dri; then
EGL_DRIVERS_DIRS="glx"
fi
@@ -1018,6 +1162,9 @@ if test "x$enable_egl" = xyes; then
if test "$have_libudev" = yes; then
DEFINES="$DEFINES -DHAVE_LIBUDEV"
fi
# workaround a bug in xcb-dri2 generated by xcb-proto 1.6
AC_CHECK_LIB(xcb-dri2, xcb_dri2_connect_alignment_pad, [],
[DEFINES="$DEFINES -DXCB_DRI2_CONNECT_DEVICE_NAME_BROKEN"])
fi
fi
@@ -1035,6 +1182,12 @@ AC_ARG_ENABLE([glu],
[enable OpenGL Utility library @<:@default=enabled@:>@])],
[enable_glu="$enableval"],
[enable_glu=yes])
if test "x$enable_glu" = xyes -a "x$mesa_driver" = xno; then
AC_MSG_NOTICE([Disabling GLU since there is no OpenGL driver])
enable_glu=no
fi
if test "x$enable_glu" = xyes; then
SRC_DIRS="$SRC_DIRS glu"
@@ -1084,9 +1237,13 @@ AC_ARG_ENABLE([glw],
[enable_glw="$enableval"],
[enable_glw=yes])
dnl Don't build GLw on osmesa
if test "x$enable_glw" = xyes && test "$mesa_driver" = osmesa; then
AC_MSG_WARN([Disabling GLw since the driver is OSMesa])
enable_glw=no
if test "x$enable_glw" = xyes; then
case "$mesa_driver" in
osmesa|no)
AC_MSG_NOTICE([Disabling GLw since there is no OpenGL driver])
enable_glw=no
;;
esac
fi
AC_ARG_ENABLE([motif],
[AS_HELP_STRING([--enable-motif],
@@ -1160,16 +1317,20 @@ AC_ARG_ENABLE([glut],
[enable_glut="$enableval"],
[enable_glut="$default_glut"])
dnl Don't build glut on osmesa
if test "x$enable_glut" = xyes; then
case "$mesa_driver" in
osmesa|no)
AC_MSG_NOTICE([Disabling glut since there is no OpenGL driver])
enable_glut=no
;;
esac
fi
dnl Can't build glut if GLU not available
if test "x$enable_glu$enable_glut" = xnoyes; then
AC_MSG_WARN([Disabling glut since GLU is disabled])
enable_glut=no
fi
dnl Don't build glut on osmesa
if test "x$enable_glut" = xyes && test "$mesa_driver" = osmesa; then
AC_MSG_WARN([Disabling glut since the driver is OSMesa])
enable_glut=no
fi
if test "x$enable_glut" = xyes; then
SRC_DIRS="$SRC_DIRS glut/glx"
@@ -1234,10 +1395,11 @@ AC_ARG_ENABLE([gallium],
[build gallium @<:@default=enabled@:>@])],
[enable_gallium="$enableval"],
[enable_gallium=yes])
if test "x$enable_gallium" = xno -a "x$enable_openvg" = xyes; then
AC_MSG_ERROR([cannot enable OpenVG without Gallium])
fi
if test "x$enable_gallium" = xyes; then
SRC_DIRS="$SRC_DIRS gallium gallium/winsys gallium/targets"
AC_CHECK_HEADER([udis86.h], [HAS_UDIS86="yes"],
[HAS_UDIS86="no"])
AC_PATH_PROG([LLVM_CONFIG], [llvm-config], [no])
fi
@@ -1246,15 +1408,30 @@ AC_SUBST([LLVM_LIBS])
AC_SUBST([LLVM_LDFLAGS])
AC_SUBST([LLVM_VERSION])
VG_LIB_DEPS=""
EGL_CLIENT_APIS='$(GL_LIB)'
if test "x$enable_gles_overlay" = xyes; then
EGL_CLIENT_APIS="$EGL_CLIENT_APIS "'$(GLESv1_CM_LIB) $(GLESv2_LIB)'
fi
dnl
dnl Gallium state trackers configuration
dnl
AC_ARG_ENABLE([gallium-egl],
[AS_HELP_STRING([--enable-gallium-egl],
[enable gallium EGL state tracker @<:@default=auto@:>@])],
[enable_gallium_egl="$enableval"],
[enable_gallium_egl=auto])
if test "x$enable_gallium_egl" = xauto; then
case "$mesa_driver" in
dri|no)
enable_gallium_egl=$enable_egl
;;
*)
enable_gallium_egl=$enable_openvg
;;
esac
fi
case "x$enable_egl$enable_gallium_egl" in
xnoyes)
AC_MSG_ERROR([cannot build Gallium EGL state tracker without EGL])
esac
AC_ARG_WITH([state-trackers],
[AS_HELP_STRING([--with-state-trackers@<:@=DIRS...@:>@],
[comma delimited state_trackers list, e.g.
@@ -1275,16 +1452,24 @@ yes)
dri)
GALLIUM_STATE_TRACKERS_DIRS="dri"
HAVE_ST_DRI="yes"
if test "x$enable_egl" = xyes; then
GALLIUM_STATE_TRACKERS_DIRS="$GALLIUM_STATE_TRACKERS_DIRS egl"
HAVE_ST_EGL="yes"
fi
# Have only tested st/xorg on 1.6.0 servers
PKG_CHECK_MODULES(XORG, [xorg-server >= 1.6.0 libdrm >= $LIBDRM_XORG_REQUIRED libkms >= $LIBKMS_XORG_REQUIRED],
HAVE_ST_XORG="yes"; GALLIUM_STATE_TRACKERS_DIRS="$GALLIUM_STATE_TRACKERS_DIRS xorg",
HAVE_ST_XORG="no")
;;
esac
if test "x$enable_egl" = xyes; then
if test "$enable_openvg" = yes; then
GALLIUM_STATE_TRACKERS_DIRS="$GALLIUM_STATE_TRACKERS_DIRS vega"
st_egl="yes"
fi
if test "$enable_gallium_egl" = yes; then
GALLIUM_STATE_TRACKERS_DIRS="$GALLIUM_STATE_TRACKERS_DIRS egl"
HAVE_ST_EGL="yes"
fi
fi
;;
*)
# verify the requested state tracker exist
@@ -1310,22 +1495,11 @@ yes)
PKG_CHECK_MODULES([LIBKMS_XORG], [libkms >= $LIBKMS_XORG_REQUIRED])
HAVE_ST_XORG="yes"
;;
es)
AC_MSG_WARN([state tracker 'es' has been replaced by --enable-gles-overlay])
if test "x$enable_gles_overlay" != xyes; then
if test "x$enable_gles1" != xyes -a "x$enable_gles2" != xyes; then
CORE_DIRS="mapi/es1api mapi/es2api $CORE_DIRS"
fi
GLES_OVERLAY=1
EGL_CLIENT_APIS="$EGL_CLIENT_APIS "'$(GLESv1_CM_LIB) $(GLESv2_LIB)'
fi
tracker=""
;;
vega)
CORE_DIRS="$CORE_DIRS mapi/vgapi"
VG_LIB_DEPS="$VG_LIB_DEPS -lpthread"
EGL_CLIENT_APIS="$EGL_CLIENT_APIS "'$(VG_LIB)'
if test "x$enable_openvg" != xyes; then
AC_MSG_ERROR([cannot build vega state tracker without --enable-openvg])
fi
have_st_vega="yes"
;;
esac
@@ -1340,18 +1514,36 @@ yes)
fi
done
GALLIUM_STATE_TRACKERS_DIRS="$state_trackers"
# append --enable-openvg/--enable-gallium-egl to --with-state-trackers
if test "x$have_st_vega" != xyes -a "x$enable_openvg" = xyes; then
AC_MSG_ERROR([--with-state-trackers specified but vega is missing])
fi
if test "x$HAVE_ST_EGL" != xyes -a "x$enable_gallium_egl" = xyes; then
AC_MSG_ERROR([--with-state-trackers specified but egl is missing])
fi
;;
esac
EGL_CLIENT_APIS=""
VG_LIB_DEPS=""
case "x$enable_opengl$enable_gles1$enable_gles2" in
x*yes*)
EGL_CLIENT_APIS="$EGL_CLIENT_APIS "'$(GL_LIB)'
;;
esac
if test "x$enable_openvg" = xyes; then
EGL_CLIENT_APIS="$EGL_CLIENT_APIS "'$(VG_LIB)'
VG_LIB_DEPS="$VG_LIB_DEPS -lpthread"
fi
AC_SUBST([VG_LIB_DEPS])
AC_SUBST([EGL_CLIENT_APIS])
if test "x$HAVE_ST_EGL" = xyes; then
GALLIUM_TARGET_DIRS="$GALLIUM_TARGET_DIRS egl"
# define GLX_DIRECT_RENDERING even when the driver is not dri
if test "x$mesa_driver" != xdri -a "x$driglx_direct" = xyes; then
DEFINES="$DEFINES -DGLX_DIRECT_RENDERING"
fi
fi
if test "x$HAVE_ST_XORG" = xyes; then
@@ -1372,6 +1564,8 @@ AC_ARG_WITH([egl-displays],
[with_egl_platforms="$withval"])
EGL_PLATFORMS=""
WAYLAND_EGL_LIB_DEPS=""
case "$with_egl_platforms" in
yes)
if test "x$enable_egl" = xyes && test "x$mesa_driver" != xosmesa; then
@@ -1389,16 +1583,31 @@ yes)
egl_platforms=`IFS=', '; echo $with_egl_platforms`
for plat in $egl_platforms; do
test -d "$srcdir/src/gallium/state_trackers/egl/$plat" || \
AC_MSG_ERROR([EGL platform '$plat' does't exist])
AC_MSG_ERROR([EGL platform '$plat' doesn't exist])
if test "$plat" = "fbdev"; then
GALLIUM_WINSYS_DIRS="$GALLIUM_WINSYS_DIRS sw/fbdev"
fi
if test "$plat" = "wayland"; then
PKG_CHECK_MODULES([WAYLAND], [wayland-client wayland-server],, \
[AC_MSG_ERROR([cannot find libwayland-client])])
WAYLAND_EGL_LIB_DEPS="$WAYLAND_LIBS $LIBDRM_LIBS"
fi
done
EGL_PLATFORMS="$egl_platforms"
;;
esac
AC_SUBST([EGL_PLATFORMS])
AC_SUBST([WAYLAND_EGL_LIB_DEPS])
WAYLAND_EGL_PC_REQ_PRIV="wayland-client libdrm"
WAYLAND_EGL_PC_LIB_PRIV=
WAYLAND_EGL_PC_CFLAGS=
AC_SUBST([WAYLAND_EGL_PC_REQ_PRIV])
AC_SUBST([WAYLAND_EGL_PC_LIB_PRIV])
AC_SUBST([WAYLAND_EGL_PC_CFLAGS])
AC_ARG_WITH([egl-driver-dir],
[AS_HELP_STRING([--with-egl-driver-dir=DIR],
[directory for EGL drivers [[default=${libdir}/egl]]])],
@@ -1439,13 +1648,9 @@ AC_ARG_ENABLE([gallium-llvm],
if test "x$enable_gallium_llvm" = xyes; then
if test "x$LLVM_CONFIG" != xno; then
LLVM_VERSION=`$LLVM_CONFIG --version`
LLVM_CFLAGS=`$LLVM_CONFIG --cflags`
LLVM_LIBS="`$LLVM_CONFIG --libs jit interpreter nativecodegen bitwriter` -lstdc++"
LLVM_CFLAGS=`$LLVM_CONFIG --cppflags`
LLVM_LIBS="`$LLVM_CONFIG --libs` -lstdc++"
if test "x$HAS_UDIS86" != xno; then
LLVM_LIBS="$LLVM_LIBS -ludis86"
DEFINES="$DEFINES -DHAVE_UDIS86"
fi
LLVM_LDFLAGS=`$LLVM_CONFIG --ldflags`
GALLIUM_DRIVERS_DIRS="$GALLIUM_DRIVERS_DIRS llvmpipe"
DEFINES="$DEFINES -DGALLIUM_LLVMPIPE -D__STDC_CONSTANT_MACROS"
@@ -1529,20 +1734,12 @@ AC_ARG_ENABLE([gallium-radeon],
[enable_gallium_radeon="$enableval"],
[enable_gallium_radeon=auto])
if test "x$enable_gallium_radeon" = xauto; then
if test "x$HAVE_LIBDRM_RADEON" = xyes; then
GALLIUM_DRIVERS_DIRS="$GALLIUM_DRIVERS_DIRS r300"
gallium_check_st "radeon/drm" "dri-r300"
else
AC_MSG_WARN([libdrm_radeon is missing, not building gallium-radeon (r300)])
fi
GALLIUM_DRIVERS_DIRS="$GALLIUM_DRIVERS_DIRS r300"
gallium_check_st "radeon/drm" "dri-r300"
fi
if test "x$enable_gallium_radeon" = xyes; then
if test "x$HAVE_LIBDRM_RADEON" = xyes; then
GALLIUM_DRIVERS_DIRS="$GALLIUM_DRIVERS_DIRS r300"
gallium_check_st "radeon/drm" "dri-r300" "xorg-radeon"
else
AC_MSG_ERROR([libdrm_radeon is missing, cannot build gallium-radeon (r300)])
fi
GALLIUM_DRIVERS_DIRS="$GALLIUM_DRIVERS_DIRS r300"
gallium_check_st "radeon/drm" "dri-r300" "xorg-radeon"
fi
dnl
@@ -1554,12 +1751,8 @@ AC_ARG_ENABLE([gallium-r600],
[enable_gallium_r600="$enableval"],
[enable_gallium_r600=auto])
if test "x$enable_gallium_r600" = xyes; then
if test "x$HAVE_LIBDRM_RADEON" = xyes; then
GALLIUM_DRIVERS_DIRS="$GALLIUM_DRIVERS_DIRS r600"
gallium_check_st "r600/drm" "dri-r600"
else
AC_MSG_ERROR([libdrm_radeon is missing, cannot build gallium-r600])
fi
GALLIUM_DRIVERS_DIRS="$GALLIUM_DRIVERS_DIRS r600"
gallium_check_st "r600/drm" "dri-r600"
fi
dnl
@@ -1571,7 +1764,7 @@ AC_ARG_ENABLE([gallium-nouveau],
[enable_gallium_nouveau="$enableval"],
[enable_gallium_nouveau=no])
if test "x$enable_gallium_nouveau" = xyes; then
GALLIUM_DRIVERS_DIRS="$GALLIUM_DRIVERS_DIRS nouveau nvfx nv50"
GALLIUM_DRIVERS_DIRS="$GALLIUM_DRIVERS_DIRS nouveau nvfx nv50 nvc0"
gallium_check_st "nouveau/drm" "dri-nouveau" "xorg-nouveau"
fi
@@ -1618,25 +1811,56 @@ echo " exec_prefix: $exec_prefix"
echo " libdir: $libdir"
echo " includedir: $includedir"
dnl API info
echo ""
echo " OpenGL: $enable_opengl (ES1: $enable_gles1 ES2: $enable_gles2)"
echo " OpenVG: $enable_openvg"
dnl Driver info
echo ""
echo " Driver: $mesa_driver"
if echo "$DRIVER_DIRS" | grep 'osmesa' >/dev/null 2>&1; then
echo " OSMesa: lib$OSMESA_LIB"
else
echo " OSMesa: no"
if test "$mesa_driver" != no; then
if echo "$DRIVER_DIRS" | grep 'osmesa' >/dev/null 2>&1; then
echo " OSMesa: lib$OSMESA_LIB"
else
echo " OSMesa: no"
fi
if test "$mesa_driver" = dri; then
# cleanup the drivers var
dri_dirs=`echo $DRI_DIRS | $SED 's/^ *//;s/ */ /;s/ *$//'`
if test "x$DRI_DIRS" = x; then
echo " DRI drivers: no"
else
echo " DRI drivers: $dri_dirs"
fi
echo " DRI driver dir: $DRI_DRIVER_INSTALL_DIR"
echo " Use XCB: $enable_xcb"
echo " Shared dricore: $enable_dricore"
fi
fi
if test "$mesa_driver" = dri; then
# cleanup the drivers var
dri_dirs=`echo $DRI_DIRS | $SED 's/^ *//;s/ */ /;s/ *$//'`
if test "x$DRI_DIRS" = x; then
echo " DRI drivers: no"
else
echo " DRI drivers: $dri_dirs"
echo ""
echo " GLU: $enable_glu"
echo " GLw: $enable_glw (Motif: $enable_motif)"
echo " glut: $enable_glut"
dnl EGL
echo ""
echo " EGL: $enable_egl"
if test "$enable_egl" = yes; then
echo " EGL platforms: $EGL_PLATFORMS"
egl_drivers=""
for d in $EGL_DRIVERS_DIRS; do
egl_drivers="$egl_drivers builtin:egl_$d"
done
if test "$enable_gallium" = yes -a "$HAVE_ST_EGL" = yes; then
echo " EGL drivers: ${egl_drivers} egl_gallium"
echo " EGL Gallium STs:$EGL_CLIENT_APIS"
else
echo " EGL drivers: $egl_drivers"
fi
fi
echo " DRI driver dir: $DRI_DRIVER_INSTALL_DIR"
fi
echo " Use XCB: $enable_xcb"
echo ""
if test "x$MESA_LLVM" = x1; then
@@ -1655,9 +1879,6 @@ if echo "$SRC_DIRS" | grep 'gallium' >/dev/null 2>&1; then
echo " Winsys dirs: $GALLIUM_WINSYS_DIRS"
echo " Driver dirs: $GALLIUM_DRIVERS_DIRS"
echo " Trackers dirs: $GALLIUM_STATE_TRACKERS_DIRS"
if test "x$HAVE_ST_EGL" = xyes; then
echo " EGL client APIs: $EGL_CLIENT_APIS"
fi
else
echo " Gallium: no"
fi
@@ -1666,15 +1887,6 @@ dnl Libraries
echo ""
echo " Shared libs: $enable_shared"
echo " Static libs: $enable_static"
if test "$enable_egl" = yes; then
echo " EGL: $EGL_DRIVERS_DIRS"
echo " EGL platforms: $EGL_PLATFORMS"
else
echo " EGL: no"
fi
echo " GLU: $enable_glu"
echo " GLw: $enable_glw (Motif: $enable_motif)"
echo " glut: $enable_glut"
dnl Compiler options
# cleanup the CFLAGS/CXXFLAGS/DEFINES vars
@@ -1687,6 +1899,8 @@ echo ""
echo " CFLAGS: $cflags"
echo " CXXFLAGS: $cxxflags"
echo " Macros: $defines"
echo ""
echo " PYTHON2: $PYTHON2"
echo ""
echo " Run '${MAKE-make}' to build Mesa"

View File

@@ -15,39 +15,45 @@ GL 3.0:
GLSL changes (GL_EXT_gpu_shader4, etc) not started
Conditional rendering (GL_NV_conditional_render) DONE (swrast & softpipe)
Map buffer subranges (GL_ARB_map_buffer_range) DONE
Float textures, renderbuffers some infrastructure done
(incl. GL_EXT_packed_float, GL_EXT_shared_exponent)
Clamping controls (GL_ARB_color_buffer_float) BRANCH ~mareko/mesa floating2
Float textures, renderbuffers (GL_ARB_texture_float) BRANCH ~mareko/mesa floating2
GL_EXT_packed_float not started
GL_EXT_texture_shared_exponent not started
Float depth buffers (GL_ARB_depth_buffer_float) not started
Framebuffer objects (GL_EXT_framebuffer_object) DONE
Half-float some infrastructure done
Half-float DONE
Multisample blit DONE
Non-normalized Integer texture/framebuffer formats not started
Non-normalized Integer texture/framebuffer formats ~50% done
1D/2D Texture arrays core Mesa, swrast done
Packed depth/stencil formats DONE
Per-buffer blend and masks (GL_EXT_draw_buffers2) DONE
GL_EXT_texture_compression_rgtc not started
Red and red/green texture formats Ian?
GL_EXT_texture_compression_rgtc DONE (swrast, gallium r600)
Red and red/green texture formats DONE (swrast, i965, gallium)
Transform feedback (GL_EXT_transform_feedback) ~50% done
glBindFragDataLocation, glGetFragDataLocation,
glBindBufferRange, glBindBufferBase commands
Vertex array objects (GL_APPLE_vertex_array_object) DONE
sRGB framebuffer format (GL_EXT_framebuffer_sRGB) not started
glClearBuffer commands DONE, except for dispatch
glGetStringi command DONE, except for dispatch
glTexParameterI, glGetTexParameterI commands DONE, except for dispatch
glVertexAttribI commands not started
sRGB framebuffer format (GL_EXT_framebuffer_sRGB) core GL done (i965, gallium), GLX todo
glClearBuffer commands DONE
glGetStringi command DONE
glTexParameterI, glGetTexParameterI commands DONE
glVertexAttribI commands DONE (but converts int
values to floats)
Depth format cube textures 0% done
GL 3.1:
GLSL 1.30 and 1.40 not started
Instanced drawing (GL_ARB_draw_instanced) ~50% done
Instanced drawing (GL_ARB_draw_instanced) DONE (gallium, swrast)
Buffer copying (GL_ARB_copy_buffer) DONE
Primitive restart (GL_NV_primitive_restart) not started
Primitive restart (GL_NV_primitive_restart) DONE (gallium)
16 vertex texture image units not started
Texture buffer objs (GL_ARB_textur_buffer_object) not started
Texture buffer objs (GL_ARB_texture_buffer_object) not started
Rectangular textures (GL_ARB_texture_rectangle) DONE
Uniform buffer objs (GL_ARB_uniform_buffer_object) not started
Signed normalized texture formats ~50% done
Signed normalized textures (GL_EXT_texture_snorm) ~50% done
GL 3.2:
@@ -69,13 +75,13 @@ GL 3.3:
GLSL 3.30 not started
GL_ARB_blend_func_extended not started
GL_ARB_explicit_attrib_location not started
GL_ARB_occlusion_query2 not started
GL_ARB_explicit_attrib_location DONE (swrast, i915, i965)
GL_ARB_occlusion_query2 DONE (swrast, gallium)
GL_ARB_sampler_objects not started
GL_ARB_texture_rgb10_a2ui not started
GL_ARB_texture_swizzle DONE (same as EXT version)
GL_ARB_timer_query DONE (only Xlib sw driver)
GL_ARB_instanced_arrays not started
GL_ARB_instanced_arrays DONE (gallium)
GL_ARB_vertex_type_2_10_10_10_rev not started
@@ -83,7 +89,7 @@ GL 4.0:
GLSL 4.0 not started
GL_ARB_texture_query_lod not started
GL_ARB_draw_buffers_blend not started
GL_ARB_draw_buffers_blend DONE (gallium softpipe)
GL_ARB_draw_indirect not started
GL_ARB_gpu_shader_fp64 not started
GL_ARB_sample_shading not started
@@ -93,6 +99,18 @@ GL_ARB_texture_buffer_object_rgb32 not started
GL_ARB_texture_cube_map_array not started
GL_ARB_texture_gather not started
GL_ARB_transform_feedback2 not started
GL_ARB_transform_feedback3 not started
GL 4.1:
GLSL 4.1 not started
GL_ARB_ES2_compatibility not started
GL_ARB_get_program_binary not started
GL_ARB_separate_shader_objects some infrastructure done
GL_ARB_shader_precision not started
GL_ARB_vertex_attrib_64bit not started
GL_ARB_viewport_array not started

View File

@@ -83,7 +83,7 @@ Additions to the EGL 1.4 Specification:
EGLImageKHR eglCreateDRMImageMESA(EGLDisplay dpy,
const EGLint *attrib_list);
In the attribute list, pass EGL_WIDTH, EGL_EIGHT and format and
In the attribute list, pass EGL_WIDTH, EGL_HEIGHT and format and
use in the attrib list using EGL_DRM_BUFFER_FORMAT_MESA and
EGL_DRM_BUFFER_USE_MESA. The only format specified by this
extension is EGL_DRM_BUFFER_FORMAT_ARGB32_MESA, where each pixel

View File

@@ -0,0 +1,158 @@
Name
MESA_multithread_makecurrent
Name Strings
GLX_MESA_multithread_makecurrent
Contact
Eric Anholt (eric@anholt.net)
Status
Not shipping.
Version
Last Modified Date: 21 February 2011
Number
TBD
Dependencies
OpenGL 1.0 or later is required.
GLX 1.3 or later is required.
Overview
The GLX context setup encourages multithreaded applications to
create a context per thread which each operate on their own
objects in parallel, and leaves synchronization for write access
to shared objects up to the application.
For some applications, maintaining per-thread contexts and
ensuring that the glFlush happens in one thread before another
thread starts working on that object is difficult. For them,
using the same context across multiple threads and protecting its
usage with a mutex is both higher performance and easier to
implement. This extension gives those applications that option by
relaxing the context binding requirements.
This new behavior matches the requirements of AGL, while providing
a feature not specified in WGL.
IP Status
Open-source; freely implementable.
Issues
None.
New Procedures and Functions
None.
New Tokens
None.
Changes to Chapter 2 of the GLX 1.3 Specification (Functions and Errors)
Replace the following sentence from section 2.2 Rendering Contexts:
In addition, a rendering context can be current for only one
thread at a time.
with:
In addition, an indirect rendering context can be current for
only one thread at a time. A direct rendering context may be
current to multiple threads, with synchronization of access to
the context thruogh the GL managed by the application through
mutexes.
Changes to Chapter 3 of the GLX 1.3 Specification (Functions and Errors)
Replace the following sentence from section 3.3.7 Rendering Contexts:
If ctx is current to some other thread, then
glXMakeContextCurrent will generate a BadAccess error.
with:
If ctx is an indirect context current to some other thread,
then glXMakeContextCurrent will generate a BadAccess error.
Replace the following sentence from section 3.5 Rendering Contexts:
If ctx is current to some other thread, then
glXMakeCurrent will generate a BadAccess error.
with:
If ctx is an indirect context current to some other thread,
then glXMakeCurrent will generate a BadAccess error.
GLX Protocol
None. The GLX extension only extends to direct rendering contexts.
Errors
None.
New State
None.
Issues
(1) What happens if the app binds a context/drawable in multiple
threads, then binds a different context/thread in one of them?
As with binding a new context from the current thread, the old
context's refcount is reduced and the new context's refcount is
increased.
(2) What happens if the app binds a context/drawable in multiple
threads, then binds None/None in one of them?
The GLX context is unreferenced from that thread, and the other
threads retain their GLX context binding.
(3) What happens if the app binds a context/drawable in 7 threads,
then destroys the context in one of them?
As with GLX context destruction previously, the XID is destroyed
but the context remains usable by threads that have the context
current.
(4) What happens if the app binds a new drawable/readable with
glXMakeCurrent() when it is already bound to another thread?
The context becomes bound to the new drawable/readable, and
further rendering in either thread will use the new
drawable/readable.
(5) What requirements should be placed on the user managing contexts
from multiple threads?
The intention is to allow multithreaded access to the GL at the
minimal performance cost, so requiring that the GL do general
synchronization (beyond that already required by context sharing)
is not an option, and synchronizing of GL's access to the GL
context between multiple threads is left to the application to do
across GL calls. However, it would be unfortunate for a library
doing multithread_makecurrent to require that other libraries
share in synchronization for binding of their own contexts, so the
refcounting of the contexts is required to be threadsafe.
(6) Does this apply to indirect contexts?
This was ignored in the initial revision of the spec. Behavior
for indirect contexts is left as-is.
Revision History
20 November 2009 Eric Anholt - initial specification
22 November 2009 Eric Anholt - added issues from Ian Romanick.
3 February 2011 Eric Anholt - updated with resolution to issues 1-3
3 February 2011 Eric Anholt - added issue 4, 5
21 February 2011 Eric Anholt - Include glXMakeCurrent() sentence
along with glXMakeContextCurrent() for removal.

View File

@@ -1,6 +1,10 @@
File: docs/README.WIN32
Last updated: Apr 25, 2007 - Karl Schultz - kschultz@users.sourceforge.net
Last updated: Apr 25, 2007
NOTE: This information only applies to Mesa 7.8 and older. Nowadays
it's probably better to use Scons to build for Windows.
Quick Start
----- -----
@@ -130,11 +134,5 @@ change all the gl* symbols to mgl*. Because this is easy to do with a
global replace operation in a text editor, no additional mangled
version of mesa.def is maintained or shipped.
If you have a Windows-related build problem or question, it is
probably better to direct it to me (kschultz@users.sourceforge.net),
rather than directly to the other Mesa developers. I will help you as
much as I can. I also monitor the Mesa mailing lists and will answer
questions in this area there as well.
Karl Schultz
If you have a Windows-related build problem or question, please post
to the mesa-dev or mesa-users list.

View File

@@ -0,0 +1,92 @@
Name
WL_bind_wayland_display
Name Strings
EGL_WL_bind_wayland_display
Contact
Kristian Høgsberg <krh@bitplanet.net>
Benjamin Franzke <benjaminfranzke@googlemail.com>
Status
Proposal
Version
Version 1, March 1, 2011
Number
EGL Extension #not assigned
Dependencies
Reguires EGL 1.4 or later. This extension is written against the
wording of the EGL 1.4 specification.
EGL_KHR_base_image is required.
Overview
This extension provides entry points for binding and unbinding the
wl_display of a Wayland compositor to an EGLDisplay. Binding a
wl_display means that the EGL implementation should provide one or
more interfaces in the Wayland protocol to allow clients to create
wl_buffer objects. On the server side, this extension also
provides a new target for eglCreateImageKHR, to create an EGLImage
from a wl_buffer
Adding a implementation specific wayland interface, allows the
EGL implementation to define specific wayland requests and events,
needed for buffer sharing in a EGL wayland platform.
IP Status
Open-source; freely implementable.
New Procedures and Functions
EGLBoolean eglBindWaylandDisplayWL(EGLDisplay dpy,
struct wl_display *display);
EGLBoolean eglUnbindWaylandDisplayWL(EGLDisplay dpy,
struct wl_display *display);
New Tokens
Accepted as <target> in eglCreateImageKHR
EGL_WAYLAND_BUFFER_WL 0x31D5
Additions to the EGL 1.4 Specification:
To bind a server side wl_display to an EGLDisplay, call
EGLBoolean eglBindWaylandDisplayWL(EGLDisplay dpy,
struct wl_display *display);
To unbind a server side wl_display from an EGLDisplay, call
EGLBoolean eglUnbindWaylandDisplayWL(EGLDisplay dpy,
struct wl_display *display);
eglBindWaylandDisplayWL returns EGL_FALSE when there is already a
wl_display bound to EGLDisplay otherwise EGL_TRUE.
eglUnbindWaylandDisplayWL returns EGL_FALSE when there is no
wl_display bound to the EGLDisplay currently otherwise EGL_TRUE.
Import a wl_buffer by calling eglCreateImageKHR with
wl_buffer as EGLClientBuffer, EGL_WAYLAND_BUFFER_WL as the target,
and an empty attribute_list.
Issues
Revision History
Version 1, March 1, 2011
Initial draft (Benjamin Franzke)

View File

@@ -145,7 +145,7 @@ Make sure the values in src/mesa/main/version.h are correct.
</p>
<p>
Update the docs/news.html file and docs/download.html files.
Update docs/news.html.
</p>
<p>
@@ -208,10 +208,11 @@ sftp USERNAME,mesa3d@web.sourceforge.net
<p>
Make an announcement on the mailing lists:
<em>m</em><em>e</em><em>s</em><em>a</em><em>3</em><em>d</em><em>-</em><em>d</em><em>e</em><em>v</em><em>@</em><em>l</em><em>i</em><em>s</em><em>t</em><em>s</em><em>.</em><em>s</em><em>f</em><em>.</em><em>n</em><em>e</em><em>t</em>,
<em>m</em><em>e</em><em>s</em><em>a</em><em>3</em><em>d</em><em>-</em><em>u</em><em>s</em><em>e</em><em>r</em><em>s</em><em>@</em><em>l</em><em>i</em><em>s</em><em>t</em><em>s</em><em>.</em><em>s</em><em>f</em><em>.</em><em>n</em><em>e</em><em>t</em>
<em>m</em><em>e</em><em>s</em><em>a</em><em>-</em><em>d</em><em>e</em><em>v</em><em>@</em><em>l</em><em>i</em><em>s</em><em>t</em><em>s</em><em>.</em><em>f</em><em>r</em><em>e</em><em>e</em><em>d</em><em>e</em><em>s</em><em>k</em><em>t</em><em>o</em><em>p</em><em>.</em><em>o</em><em>r</em><em>g</em>,
<em>m</em><em>e</em><em>s</em><em>a</em><em>-</em><em>u</em><em>s</em><em>e</em><em>r</em><em>s</em><em>@</em><em>l</em><em>i</em><em>s</em><em>t</em><em>s</em><em>.</em><em>f</em><em>r</em><em>e</em><em>e</em><em>d</em><em>e</em><em>s</em><em>k</em><em>t</em><em>o</em><em>p</em><em>.</em><em>o</em><em>r</em><em>g</em>
and
<em>m</em><em>e</em><em>s</em><em>a</em><em>3</em><em>d</em><em>-</em><em>a</em><em>n</em><em>n</em><em>o</em><em>u</em><em>n</em><em>c</em><em>e</em><em>@</em><em>l</em><em>i</em><em>s</em><em>t</em><em>s</em><em>.</em><em>s</em><em>f</em><em>.</em><em>n</em><em>e</em><em>t</em>
<em>m</em><em>e</em><em>s</em><em>a</em><em>-</em><em>a</em><em>n</em><em>n</em><em>o</em><em>u</em><em>n</em><em>c</em><em>e</em><em>@</em><em>l</em><em>i</em><em>s</em><em>t</em><em>s</em><em>.</em><em>f</em><em>r</em><em>e</em><em>e</em><em>d</em><em>e</em><em>s</em><em>k</em><em>t</em><em>o</em><em>p</em><em>.</em><em>o</em><em>r</em><em>g</em>
</p>

View File

@@ -19,27 +19,23 @@ API entry points and helper functions for use by the drivers. Drivers are
dynamically loaded by the main library and most of the EGL API calls are
directly dispatched to the drivers.</p>
<p>The driver in use decides the window system to support. For drivers that
support hardware rendering, there are usually multiple drivers supporting the
same window system. Each one of of them supports a certain range of graphics
cards.</p>
<p>The driver in use decides the window system to support.</p>
<h2>Build EGL</h2>
<ol>
<li>
<p>Run <code>configure</code> with the desired state trackers and enable
the Gallium driver for your hardware. For example</p>
<p>Run <code>configure</code> with the desired client APIs and enable
the driver for your hardware. For example</p>
<pre>
$ ./configure --enable-gles-overlay --with-state-trackers=egl,vega --enable-gallium-intel
$ ./configure --enable-gles2 --enable-openvg --enable-gallium-nouveau
</pre>
<p>The main library and OpenGL is enabled by default. The first option enables
<a href="opengles.html">OpenGL ES 1.x and 2.x</a>. The <code>egl</code> state
tracker is needed by a number of EGL drivers. EGL drivers will be covered
later. The <a href="openvg.html">vega state tracker</a> provides OpenVG
1.x.</p>
<p>The main library and OpenGL is enabled by default. The first option above
enables <a href="opengles.html">OpenGL ES 2.x</a>. The second option enables
<a href="openvg.html">OpenVG</a>.</p>
</li>
<li>Build and install Mesa as usual.</li>
@@ -80,31 +76,27 @@ types such as <code>EGLNativeDisplayType</code> or
<p>The available platforms are <code>x11</code>, <code>drm</code>,
<code>fbdev</code>, and <code>gdi</code>. The <code>gdi</code> platform can
only be built with SCons.</p>
</li>
<li><code>--with-state-trackers</code>
<p>The argument is a comma separated string. It is usually used to specify the
rendering APIs, such as OpenVG, to build. But it is also used to specify
<code>egl</code> state tracker that <code>egl_gallium</code> depends on.</p>
</li>
<li><code>--enable-gles-overlay</code>
<p>OpenGL and OpenGL ES are not controlled by
<code>--with-state-trackers</code>. OpenGL is always built. To build OpenGL
ES, this option must be explicitly given.</p>
only be built with SCons. Unless for special needs, the build system should
select the right platforms automatically.</p>
</li>
<li><code>--enable-gles1</code> and <code>--enable-gles2</code>
<p>Unlike <code>--enable-gles-overlay</code>, which builds one library for each
rendering API, these options enable OpenGL ES support in OpenGL. The result is
one big library that supports multiple APIs.</p>
<p>These options enable OpenGL ES support in OpenGL. The result is one big
internal library that supports multiple APIs.</p>
</li>
<li><code>--enable-openvg</code>
<p>OpenVG must be explicitly enabled by this option.</p>
</li>
<li><code>--enable-gallium-egl</code>
<p>Explicitly enable or disable <code>egl_gallium</code>.</p>
</li>
@@ -131,17 +123,24 @@ colon-separated directories where the main library will look for drivers, in
addition to the default directory. This variable is ignored for setuid/setgid
binaries.</p>
<p>This variable is usually set to test an uninstalled build. For example, one
may set</p>
<pre>
$ export LD_LIBRARY_PATH=$mesa/lib
$ export EGL_DRIVERS_PATH=$mesa/lib/egl
</pre>
<p>to test a build without installation</p>
</li>
<li><code>EGL_DRIVER</code>
<p>This variable specifies a full path to an EGL driver and it forces the
specified EGL driver to be loaded. It comes in handy when one wants to test a
specific driver. This variable is ignored for setuid/setgid binaries.</p>
<p><code>egl_gallium</code> dynamically loads hardware drivers and client API
modules found in <code>EGL_DRIVERS_PATH</code>. Thus, specifying this variable
alone is not sufficient for <code>egl_gallium</code> for uninstalled build.</p>
<p>This variable specifies a full path to or the name of an EGL driver. It
forces the specified EGL driver to be loaded. It comes in handy when one wants
to test a specific driver. This variable is ignored for setuid/setgid
binaries.</p>
</li>
@@ -150,7 +149,12 @@ alone is not sufficient for <code>egl_gallium</code> for uninstalled build.</p>
<p>This variable specifies the native platform. The valid values are the same
as those for <code>--with-egl-platforms</code>. When the variable is not set,
the main library uses the first platform listed in
<code>--with-egl-platforms</code> as the native platform</p>
<code>--with-egl-platforms</code> as the native platform.</p>
<p>Extensions like <code>EGL_MESA_drm_display</code> define new functions to
create displays for non-native platforms. These extensions are usually used by
applications that support non-native platforms. Setting this variable is
probably required only for some of the demos found in mesa/demo repository.</p>
</li>
@@ -173,11 +177,25 @@ variable to true forces the use of software rendering.</p>
<h2>EGL Drivers</h2>
<ul>
<li><code>egl_dri2</code>
<p>This driver supports both <code>x11</code> and <code>drm</code> platforms.
It functions as a DRI driver loader. For <code>x11</code> support, it talks to
the X server directly using (XCB-)DRI2 protocol.</p>
<p>This driver can share DRI drivers with <code>libGL</code>.</p>
</li>
<li><code>egl_gallium</code>
<p>This driver is based on Gallium3D. It supports all rendering APIs and
hardwares supported by Gallium3D. It is the only driver that supports OpenVG.
The supported platforms are X11, KMS, FBDEV, and GDI.</p>
The supported platforms are X11, DRM, FBDEV, and GDI.</p>
<p>This driver comes with its own hardware drivers
(<code>pipe_&lt;hw&gt;</code>) and client API modules
(<code>st_&lt;api&gt;</code>).</p>
</li>
@@ -187,26 +205,24 @@ The supported platforms are X11, KMS, FBDEV, and GDI.</p>
the EGL API. It supports both direct and indirect rendering when the GLX does.
It is accelerated when the GLX is. As such, it cannot provide functions that
is not available in GLX or GLX extensions.</p>
</li>
<li><code>egl_dri2</code>
<p>This driver supports the X Window System as its window system. It functions
as a DRI2 driver loader. Unlike <code>egl_glx</code>, it has no dependency on
<code>libGL</code>. It talks to the X server directly using DRI2 protocol.</p>
</li>
<li><code>egl_dri</code>
<p>This driver lacks maintenance and does <em>not</em> build. It is similiar
to <code>egl_dri2</code> in that it functions as a DRI(1) driver loader. But
unlike <code>egl_dri2</code>, it supports Linux framebuffer devices as its
window system and supports EGL_MESA_screen_surface extension. As DRI1 drivers
are phasing out, it might eventually be replaced by <code>egl_dri2</code>.</p>
</li>
</ul>
<h2>Packaging</h2>
<p>The ABI between the main library and its drivers are not stable. Nor is
there a plan to stabilize it at the moment. Of the EGL drivers,
<code>egl_gallium</code> has its own hardware drivers and client API modules.
They are considered internal to <code>egl_gallium</code> and there is also no
stable ABI between them. These should be kept in mind when packaging for
distribution.</p>
<p>Generally, <code>egl_dri2</code> is preferred over <code>egl_gallium</code>
when the system already has DRI drivers. As <code>egl_gallium</code> is loaded
before <code>egl_dri2</code> when both are available, <code>egl_gallium</code>
may either be disabled with <code>--disable-gallium-egl</code> or packaged
separately.</p>
<h2>Developers</h2>
<p>The sources of the main library and the classic drivers can be found at
@@ -295,7 +311,6 @@ should as well lock the display before using it.
<ul>
<li>Pass the conformance tests</li>
<li>Reference counting in main library?</li>
<li>Mixed use of OpenGL, OpenGL ES 1.1, and OpenGL ES 2.0 is supported. But
which one of <code>libGL.so</code>, <code>libGLESv1_CM.so</code>, and
<code>libGLESv2.so</code> should an application link to? Bad things may happen

View File

@@ -9,17 +9,38 @@
<H1>Environment Variables</H1>
<p>
Mesa supports the following environment variables:
Normally, no environment variables need to be set. Most of the environment
variables used by Mesa/Gallium are for debugging purposes, but they can
sometimes be useful for debugging end-user issues.
</p>
<H2>LibGL environment variables</H2>
<ul>
<li>LIBGL_DEBUG - If defined debug information will be printed to stderr.
If set to 'verbose' additional information will be printed.
<li>LIBGL_DRIVERS_PATH - colon-separated list of paths to search for DRI drivers
<li>LIBGL_ALWAYS_INDIRECT - forces an indirect rendering context/connection.
<li>LIBGL_ALWAYS_SOFTWARE - if set, always use software rendering
<li>LIBGL_NO_DRAWARRAYS - if set do not use DrawArrays GLX protocol (for debugging)
</ul>
<H2>Core Mesa environment variables</H2>
<ul>
<li>MESA_NO_ASM - if set, disables all assembly language optimizations
<li>MESA_NO_MMX - if set, disables Intel MMX optimizations
<li>MESA_NO_3DNOW - if set, disables AMD 3DNow! optimizations
<li>MESA_NO_SSE - if set, disables Intel SSE optimizations
<li>MESA_DEBUG - if set, error messages are printed to stderr.
If the value of MESA_DEBUG is "FP" floating point arithmetic errors will
generate exceptions.
<li>MESA_NO_DITHER - if set, disables dithering, overriding glEnable(GL_DITHER)
<li>MESA_DEBUG - if set, error messages are printed to stderr. For example,
if the application generates a GL_INVALID_ENUM error, a corresponding error
message indicating where the error occured, and possibly why, will be
printed to stderr.<br>
If the value of MESA_DEBUG is 'FP' floating point arithmetic errors will
generate exceptions.
<li>MESA_TEX_PROG - if set, implement conventional texture env modes with
fragment programs (intended for developers only)
<li>MESA_TNL_PROG - if set, implement conventional vertex transformation
@@ -28,11 +49,14 @@ Setting this variable automatically sets the MESA_TEX_PROG variable as well.
<li>MESA_EXTENSION_OVERRIDE - can be used to enable/disable extensions.
A value such as "GL_EXT_foo -GL_EXT_bar" will enable the GL_EXT_foo extension
and disable the GL_EXT_bar extension.
<li>MESA_GLSL - <a href="shading.html#envvars">shading language options</a>
<li>MESA_GLSL - <a href="shading.html#envvars">shading language compiler options</a>
</ul>
<H2>Mesa Xlib driver environment variables</H2>
<p>
The following are only applicable to the Xlib software driver.
The following are only applicable to the Mesa Xlib software driver.
See the <A HREF="xlibdriver.html">Xlib software driver page</A> for details.
</p>
<ul>
@@ -51,9 +75,8 @@ See the <A HREF="xlibdriver.html">Xlib software driver page</A> for details.
</ul>
<p>
These environment variables are for the Intel i945/i965 drivers:
</p>
<h2>i945/i965 driver environment variables (non-Gallium)</h2>
<ul>
<li>INTEL_STRICT_CONFORMANCE - if set to 1, enable sw fallbacks to improve
OpenGL conformance. If set to 2, always use software rendering.
@@ -62,17 +85,71 @@ These environment variables are for the Intel i945/i965 drivers:
</ul>
<p>
These environment variables are for the Radeon R300 driver:
</p>
<h2>Radeon R300 driver environment variables (non-Gallium)</h2>
<ul>
<li>R300_NO_TCL - if set, disable hardware-accelerated Transform/Clip/Lighting.
</ul>
<h2>EGL environment variables</h2>
<p>
Mesa EGL supports different sets of environment variables. See the
<a href="egl.html">Mesa EGL</a> page for the details.
</p>
<h2>Gallium environment variables</h2>
<ul>
<li>GALLIUM_PRINT_OPTIONS - if non-zero, print all the Gallium environment
variables which are used, and their current values.
<li>GALLIUM_NOSSE - if non-zero, do not use SSE runtime code generation for
shader execution
<li>GALLIUM_NOPPC - if non-zero, do not use PPC runtime code generation for
shader execution
<li>GALLIUM_DUMP_CPU - if non-zero, print information about the CPU on start-up
<li>TGSI_PRINT_SANITY - if set, do extra sanity checking on TGSI shaders and
print any errors to stderr.
<LI>DRAW_FSE - ???
<LI>DRAW_NO_FSE - ???
<li>DRAW_USE_LLVM - if set to zero, the draw module will not use LLVM to execute
shaders, vertex fetch, etc.
</ul>
<h3>Softpipe driver environment variables</h3>
<ul>
<li>SOFTPIPE_DUMP_FS - if set, the softpipe driver will print fragment shaders
to stderr
<li>SOFTPIPE_DUMP_GS - if set, the softpipe driver will print geometry shaders
to stderr
<li>SOFTPIPE_NO_RAST - if set, rasterization is no-op'd. For profiling purposes.
</ul>
<h3>LLVMpipe driver environment variables</h3>
<ul>
<li>LP_NO_RAST - if set LLVMpipe will no-op rasterization
<li>LP_DEBUG - a comma-separated list of debug options is acceptec. See the
source code for details.
<li>LP_PERF - a comma-separated list of options to selectively no-op various
parts of the driver. See the source code for details.
<li>LP_NUM_THREADS - an integer indicating how many threads to use for rendering.
Zero turns of threading completely. The default value is the number of CPU
cores present.
</ul>
<p>
Other Gallium drivers have their own environment variables. These may change
frequently so the source code should be consulted for details.
</p>
<br>
<br>
</BODY>
</HTML>

View File

@@ -11,10 +11,27 @@
<H1>News</H1>
<h2>March 2, 2011</h2>
<p>
<a href="relnotes-7.9.2.html">Mesa 7.9.2</a> and
<a href="relnotes-7.10.1.html">Mesa 7.10.1</a> are released. These are
stable releases containing bug fixes since the 7.9.1 and 7.10 releases.
</p>
<h2>October 4, 2010</h2>
<p>
<a href="relnotes-7.9.html">Mesa 7.9</a> (final) is released. This is a new
development release.
</p>
<h2>September 27, 2010</h2>
<p>
<a href="relnotes-7.9.0.html">Mesa 7.9.0-rc1</a> is released. This is a
<a href="relnotes-7.9.html">Mesa 7.9.0-rc1</a> is released. This is a
release candidate for the 7.9 development release.
</p>

View File

@@ -17,7 +17,7 @@ target="_parent"> http://www.khronos.org/opengles/</a>.</p>
<h2>Build the Libraries</h2>
<ol>
<li>Run <code>configure</code> with <code>--enable-gles-overlay</code> and enable the Gallium driver for your hardware.</li>
<li>Run <code>configure</code> with <code>--enable-gles1 --enable-gles2</code> and enable the Gallium driver for your hardware.</li>
<li>Build and install Mesa as usual.</li>
</ol>
@@ -53,8 +53,6 @@ your build. For example,</p>
<tr><td>Library Name</td><td>Used By</td><td>Enabled</td><td>OpenGL</td><td>OpenGL ES 1.x</td><td>OpenGL ES 2.x</td></tr>
<tr><td><code>libmesa.a</td><td>Classic DRI drivers</td><td>y</td><td>y</td><td>--enable-gles1</td><td>--enable-gles2</td></tr>
<tr><td><code>libmesagallium.a</td><td>Gallium EGL and DRI drivers</td><td>y</td><td>y</td><td>--enable-gles1</td><td>--enable-gles2</td></tr>
<tr><td><code>libes1gallium.a</td><td>Gallium EGL drivers</td><td>--enable-gles-overlay</td><td>n</td><td>y</td><td>n</td></tr>
<tr><td><code>libes2gallium.a</td><td>Gallium EGL drivers</td><td>--enable-gles-overlay</td><td>n</td><td>n</td><td>y</td></tr>
</table>
<h3>Dispatch Table</h3>

View File

@@ -26,36 +26,27 @@ Please refer to <a href="egl.html">Mesa EGL</a> for more information about EGL.
<h2>Building the library</h2>
<ol>
<li>Build Mesa3D with Gallium3D. Any build that builds Gallium3D libraries, EGL, and Gallium EGL drivers will suffice</li>
<li>cd src/gallium/state_trackers/vega; make</li>
<li>The last step will build libOpenVG library. You can add the libdir to LD_LIBRARY_PATH or install libOpenVG</li>
<li>Run <code>configure</code> with <code>--enable-openvg</code>. If you do
not need OpenGL, you can add <code>--disable-opengl</code> to save the
compilation time.</li>
<li>Build and install Mesa as usual.</li>
</ol>
<h3>Sample build</h3>
A sample build looks as follows:
<pre>
$ ./configure --with-state-trackers=egl,vega --enable-gallium-intel
$ ./configure --disable-opengl --enable-openvg
$ make
$ make install
</pre>
<p>It will install <code>libOpenVG.so</code>, <code>libEGL.so</code>, and one
or more EGL drivers.</p>
<h2>OpenVG Demos</h2>
<p>
To build the OpenVG demos:
</p>
<pre>
cd progs/openvg
make
</pre>
<p>
To run a demo:
</p>
<pre>
cd openvg/demos
./lion
</pre>
<p>OpenVG demos can be found in mesa/demos repository.</p>
</body>
</html>

380
docs/relnotes-7.10.1.html Normal file
View File

@@ -0,0 +1,380 @@
<HTML>
<head>
<TITLE>Mesa Release Notes</TITLE>
<link rel="stylesheet" type="text/css" href="mesa.css">
<meta http-equiv="content-type" content="text/html; charset=utf-8" />
</head>
<BODY>
<body bgcolor="#eeeeee">
<H1>Mesa 7.10.1 Release Notes / TBD</H1>
<p>
Mesa 7.10.1 is a bug fix release which fixes bugs found since the 7.10 release.
</p>
<p>
Mesa 7.10.1 implements the OpenGL 2.1 API, but the version reported by
glGetString(GL_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 2.1.
</p>
<p>
See the <a href="install.html">Compiling/Installing page</a> for prerequisites
for DRI hardware acceleration.
</p>
<h2>MD5 checksums</h2>
<pre>
4b4cee19f3bf16eb78bd4cc278ccf812 MesaLib-7.10.1.tar.gz
efe8da4d80c2a5d32a800770b8ce5dfa MesaLib-7.10.1.tar.bz2
0fd2b1a025934de3f8cecf9fb9b57f4c MesaLib-7.10.1.zip
42beb0f5188d544476c19496f725fa67 MesaGLUT-7.10.1.tar.gz
637bb8a20fdad89f7382b4ea83f896e3 MesaGLUT-7.10.1.tar.bz2
bdbf3ffb2606d6aa8afabb6c6243b91b MesaGLUT-7.10.1.zip
</pre>
<h2>New features</h2>
<p>None.</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li>Fix an off-by-one bug in a vsplit assertion.</li>
<li>Fix incorrect handling of <tt>layout</tt> qualifier
with <tt>in</tt>, <tt>out</tt>, <tt>attribute</tt>, and <tt>varying</tt>.</li>
<li>Fix an i965 shader bug where the negative absolute value was generated instead of the absolute value of a negation.</li>
<li>Fix numerous issues handling precision qualifiers in GLSL ES.</li>
<li>Fixed a few GLX protocol encoder bugs (Julien Cristau)</li>
<li>Assorted Gallium llvmpipe driver bug fixes</li>
<li>Assorted Mesa/Gallium state tracker bug fixes</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=26795">Bug 26795</a> - gl_FragCoord off by one in Gallium drivers.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=29164">Bug 29164</a> - [GLSL 1.20] invariant variable shouldn't be used before declaration</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=29823">Bug 29823</a> - GetUniform[if]v busted</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=29927">Bug 29927</a> - [glsl2] fail to compile shader with constructor for array of struct type</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=30156">Bug 30156</a> - [i965] After updating to Mesa 7.9, Civilization IV starts to show garbage</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31923">Bug 31923</a> - [GLSL 1.20] allowing inconsistent centroid declaration between two vertex shaders</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31925">Bug 31925</a> - [GLSL 1.20] "#pragma STDGL invariant(all)" fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32214">Bug 32214</a> - [gles2]no link error happens when missing vertex shader or frag shader</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32375">Bug 32375</a> - [gl gles2] Not able to get the attribute by function glGetVertexAttribfv</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32541">Bug 32541</a> - Segmentation Fault while running an HDR (high dynamic range) rendering demo</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32569">Bug 32569</a> - [gles2] glGetShaderPrecisionFormat not implemented yet</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32695">Bug 32695</a> - [glsl] SIGSEGV glcpp/glcpp-parse.y:833</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32831">Bug 32831</a> - [glsl] division by zero crashes GLSL compiler</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32910">Bug 32910</a> - Keywords 'in' and 'out' not handled properly for GLSL 1.20 shaders</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33219">Bug 33219</a> -[GLSL bisected] implicit sized array triggers segfault in ir_to_mesa_visitor::copy_propagate</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33306">Bug 33306</a> - GLSL integer division by zero crashes GLSL compiler</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33308">Bug 33308</a> -[glsl] ast_to_hir.cpp:3016: virtual ir_rvalue* ast_jump_statement::hir(exec_list*, _mesa_glsl_parse_state*): Assertion `ret != __null' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33316">Bug 33316</a> - uniform array will be allocate one line more and initialize it when it was freed will abort</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33386">Bug 33386</a> - Dubious assembler in read_rgba_span_x86.S</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33388">Bug 33388</a> - Dubious assembler in xform4.S</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33433">Bug 33433</a> - Error in x86-64 API dispatch code.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33507">Bug 33507</a> - [glsl] GLSL preprocessor modulus by zero crash</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33508">Bug 33508</a> - [glsl] GLSL compiler modulus by zero crash</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33916">Bug 33916</a> - Compiler accepts reserved operators % and %=</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=34030">Bug 34030</a> - [bisected] Starcraft 2: some effects are corrupted or too big</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=34047">Bug 34047</a> - Assert in _tnl_import_array() when using GLfixed vertex datatypes with GLESv2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=34114">Bug 34114</a> - Sun Studio build fails due to standard library functions not being in global namespace</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=34179">Bug 34179</a> - Nouveau 3D driver: nv50_pc_emit.c:863 assertion error kills Compiz</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=34198">Bug 34198</a> - [GLSL] implicit sized array with index 0 used gets assertion</li>
<li><a href="https://bugs.launchpad.net/ubuntu/+source/mesa/+bug/691653">Ubuntu bug 691653</a> - compiz crashes when using alt-tab (the radeon driver kills it) </li>
<li><a href="https://bugs.meego.com/show_bug.cgi?id=13005">Meego bug 13005</a> - Graphics GLSL issue lead to camera preview fail on Pinetrail</li>
<!-- <li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=">Bug </a> - </li> -->
</ul>
<h2>Changes</h2>
<p>The full set of changes can be viewed by using the following GIT command:</p>
<pre>
git log mesa-7.10..mesa-7.10.1
</pre>
<p>Alberto Milone (1):
<ul>
<li>r600c: add evergreen ARL support.</li>
</ul></p>
<p>Brian Paul (21):
<ul>
<li>draw: Fix an off-by-one bug in a vsplit assertion.</li>
<li>docs: add links to 7.9.1 and 7.10 release notes</li>
<li>docs: added news item for 7.9.1 and 7.10 release</li>
<li>gallivm: work around LLVM 2.6 bug when calling C functions</li>
<li>gallivm: fix copy&amp;paste error from previous commit</li>
<li>mesa: fix a few format table mistakes, assertions</li>
<li>mesa: fix num_draw_buffers==0 in fixed-function fragment program generation</li>
<li>mesa: don't assert in GetIntegerIndexed, etc</li>
<li>mesa: check for dummy renderbuffer in _mesa_FramebufferRenderbufferEXT()</li>
<li>llvmpipe: make sure binning is active when we begin/end a query</li>
<li>st/mesa: fix incorrect fragcoord.x translation</li>
<li>softpipe: fix off-by-one error in setup_fragcoord_coeff()</li>
<li>cso: fix loop bound in cso_set_vertex_samplers()</li>
<li>st/mesa: fix incorrect glCopyPixels position on fallback path</li>
<li>st/mesa: set renderbuffer _BaseFormat in a few places</li>
<li>st/mesa: fix the default case in st_format_datatype()</li>
<li>st/mesa: need to translate clear color according to surface's base format</li>
<li>docs: update 7.9.2 release notes with Brian's cherry-picks</li>
<li>docs: add link to 7.10.1 release notes</li>
<li>mesa: implement glGetShaderPrecisionFormat()</li>
<li>docs: updated environment variable list</li>
</ul></p>
<p>Bryce Harrington (1):
<ul>
<li>r300g: Null pointer check for buffer deref in gallium winsys</li>
</ul></p>
<p>Chad Versace (20):
<ul>
<li>glsl: At link-time, check that globals have matching centroid qualifiers</li>
<li>glcpp: Fix segfault when validating macro redefinitions</li>
<li>glsl: Fix parser rule for type_specifier</li>
<li>glsl: Change default value of ast_type_specifier::precision</li>
<li>glsl: Add semantic checks for precision qualifiers</li>
<li>glsl: Add support for default precision statements</li>
<li>glsl: Remove redundant semantic check in parser</li>
<li>glsl: Fix semantic checks on precision qualifiers</li>
<li>glsl: Fix segfault due to missing printf argument</li>
<li>glsl: Mark 'in' variables at global scope as read-only</li>
<li>mesa: Refactor handling of extension strings</li>
<li>mesa: Add/remove extensions in extension string</li>
<li>mesa: Change dependencies of some OES extension strings</li>
<li>mesa: Change OES_point_sprite to depend on ARB_point_sprite</li>
<li>mesa: Change OES_standard_derivatives to be stand-alone extension</li>
<li>i915: Disable extension OES_standard_derivatives</li>
<li>glcpp: Raise error when modulus is zero</li>
<li>glsl: Set operators '%' and '%=' to be reserved when GLSL &lt 1.30</li>
<li>glsl: Reinstate constant-folding for division by zero</li>
<li>tnl: Add support for datatype GL_FIXED in vertex arrays</li>
</ul></p>
<p>Chia-I Wu (1):
<ul>
<li>mesa: Add glDepthRangef and glClearDepthf to APIspec.xml.</li>
</ul></p>
<p>Christoph Bumiller (1):
<ul>
<li>nv50,nvc0: do not forget to apply sign mode to saved TGSI inputs</li>
</ul></p>
<p>Cyril Brulebois (1):
<ul>
<li>Point to bugs.freedesktop.org rather than bugzilla.freedesktop.org</li>
</ul></p>
<p>Dave Airlie (3):
<ul>
<li>radeon/r200: fix fbo-clearmipmap + gen-teximage</li>
<li>radeon: calculate complete texture state inside TFP function</li>
<li>radeon: avoid segfault on 3D textures.</li>
</ul></p>
<p>Dimitry Andric (4):
<ul>
<li>mesa: s/movzx/movzbl/</li>
<li>mesa: s/movzxw/movzwl/ in read_rgba_span_x86.S</li>
<li>glapi: adding @ char before type specifier in glapi_x86.S</li>
<li>glapi: add @GOTPCREL relocation type</li>
</ul></p>
<p>Eric Anholt (16):
<ul>
<li>glsl: Fix the lowering of variable array indexing to not lose write_masks.</li>
<li>i965/fs: When producing ir_unop_abs of an operand, strip negate.</li>
<li>i965/vs: When MOVing to produce ABS, strip negate of the operand.</li>
<li>i965/fs: Do flat shading when appropriate.</li>
<li>i965: Avoid double-negation of immediate values in the VS.</li>
<li>intel: Make renderbuffer tiling choice match texture tiling choice.</li>
<li>i965: Fix dead pointers to fp-&gt;Parameters-&gt;ParameterValues[] after realloc.</li>
<li>docs: Add a relnote for the Civ IV on i965.</li>
<li>glapi: Add entrypoints and enums for GL_ARB_ES2_compatibility.</li>
<li>mesa: Add extension enable bit for GL_ARB_ES2_compatibility.</li>
<li>mesa: Add actual support for glReleaseShaderCompiler from ES2.</li>
<li>mesa: Add support for glDepthRangef and glClearDepthf.</li>
<li>mesa: Add getters for ARB_ES2_compatibility MAX_*_VECTORS.</li>
<li>mesa: Add getter for GL_SHADER_COMPILER with ARB_ES2_compatibility.</li>
<li>i965: Fix a bug in i965 compute-to-MRF.</li>
<li>i965/fs: Add a helper function for detecting math opcodes.</li>
</ul></p>
<p>Fredrik Höglund (1):
<ul>
<li>st/mesa: fix a regression from cae2bb76</li>
</ul></p>
<p>Ian Romanick (42):
<ul>
<li>docs: Add 7.10 md5sums</li>
<li>glsl: Support the 'invariant(all)' pragma</li>
<li>glcpp: Generate an error for division by zero</li>
<li>glsl: Add version_string containing properly formatted GLSL version</li>
<li>glsl &amp; glcpp: Refresh autogenerated lexer and parser files.</li>
<li>glsl: Disallow 'in' and 'out' on globals in GLSL 1.20</li>
<li>glsl: Track variable usage, use that to enforce semantics</li>
<li>glsl: Allow 'in' and 'out' when 'layout' is also available</li>
<li>docs: Initial bits of 7.10.1 release notes</li>
<li>mesa: bump version to 7.10.1-devel</li>
<li>doc: Update 7.10.1 release notes</li>
<li>glsl: Emit errors or warnings when 'layout' is used with 'attribute' or 'varying'</li>
<li>docs: Update 7.10.1 release notes</li>
<li>glsl: Refresh autogenerated lexer and parser files.</li>
<li>glsl: Don't assert when the value returned by a function has no rvalue</li>
<li>linker: Set sizes for non-global arrays as well</li>
<li>linker: Propagate max_array_access while linking functions</li>
<li>docs: Update 7.10.1 release notes</li>
<li>mesa: glGetUniform only returns a single element of an array</li>
<li>linker: Generate link errors when ES shaders are missing stages</li>
<li>mesa: Fix error checks in GetVertexAttrib functions</li>
<li>Use C-style system headers in C++ code to avoid issues with std:: namespace</li>
<li>docs: Update 7.10.1 release notes</li>
<li>glapi: Regenerate for GL_ARB_ES2_compatibility.</li>
<li>mesa: Connect glGetShaderPrecisionFormat into the dispatch table</li>
<li>i965: Set correct values for range/precision of fragment shader types</li>
<li>i915: Set correct values for range/precision of fragment shader types</li>
<li>intel: Fix typeos from 3d028024 and 790ff232</li>
<li>glsl: Ensure that all GLSL versions are supported in the stand-alone compiler</li>
<li>glsl: Reject shader versions not supported by the implementation</li>
<li>mesa: Initial size for secondary color array is 3</li>
<li>glsl: Finish out the reduce/reduce error fixes</li>
<li>glsl: Regenerate compiler and glcpp files from cherry picks</li>
<li>linker: Fix off-by-one error implicit array sizing</li>
<li>docs: update 7.10.1 release notes with Ian's recent cherry picks</li>
<li>i915: Only mark a register as available if all components are written</li>
<li>i915: Calculate partial result to temp register first</li>
<li>i915: Force lowering of all types of indirect array accesses in the FS</li>
<li>docs: Update 7.10.1 with (hopefully) the last of the cherry picks</li>
<li>docs: Clean up bug fixes list</li>
<li>intel: Remove driver date and related bits from renderer string</li>
<li>mesa: set version string to 7.10.1 (final)</li>
</ul></p>
<p>Jian Zhao (1):
<ul>
<li>mesa: fix an error in uniform arrays in row calculating.</li>
</ul></p>
<p>Julien Cristau (3):
<ul>
<li>glx: fix request lengths</li>
<li>glx: fix GLXChangeDrawableAttributesSGIX request</li>
<li>glx: fix length of GLXGetFBConfigsSGIX</li>
</ul></p>
<p>Keith Packard (1):
<ul>
<li>glsl: Eliminate reduce/reduce conflicts in glsl grammar</li>
</ul></p>
<p>Kenneth Graunke (20):
<ul>
<li>glsl: Expose a public glsl_type::void_type const pointer.</li>
<li>glsl: Don't bother unsetting a destructor that was never set.</li>
<li>glsl, i965: Remove unnecessary talloc includes.</li>
<li>glcpp: Remove use of talloc reference counting.</li>
<li>ralloc: Add a fake implementation of ralloc based on talloc.</li>
<li>Convert everything from the talloc API to the ralloc API.</li>
<li>ralloc: a new MIT-licensed recursive memory allocator.</li>
<li>Remove talloc from the make and automake build systems.</li>
<li>Remove talloc from the SCons build system.</li>
<li>Remove the talloc sources from the Mesa repository.</li>
<li>glsl: Fix use of uninitialized values in _mesa_glsl_parse_state ctor.</li>
<li>i965/fs: Apply source modifier workarounds to POW as well.</li>
<li>i965: Fix shaders that write to gl_PointSize on Sandybridge.</li>
<li>i965/fs: Avoid register coalescing away gen6 MATH workarounds.</li>
<li>i965/fs: Correctly set up gl_FragCoord.w on Sandybridge.</li>
<li>i965: Increase Sandybridge point size clamp.</li>
<li>i965/fs: Refactor control flow stack handling.</li>
<li>i965: Increase Sandybridge point size clamp in the clip state.</li>
<li>glsl: Use reralloc instead of plain realloc.</li>
<li>Revert "i965/fs: Correctly set up gl_FragCoord.w on Sandybridge."</li>
</ul></p>
<p>Marek Olšák (4):
<ul>
<li>docs: fix messed up names with special characters in relnotes-7.10</li>
<li>docs: fix messed up names with special characters in relnotes-7.9.1</li>
<li>mesa: fix texture3D mipmap generation for UNSIGNED_BYTE_3_3_2</li>
<li>st/dri: Track drawable context bindings</li>
</ul></p>
<p>Paulo Zanoni (1):
<ul>
<li>dri_util: fail driCreateNewScreen if InitScreen is NULL</li>
</ul></p>
<p>Sam Hocevar (2):
<ul>
<li>docs: add glsl info</li>
<li>docs: fix glsl_compiler name</li>
</ul></p>
<p>Tom Fogal (1):
<ul>
<li>Regenerate gl_mangle.h.</li>
</ul></p>
<p>Tom Stellard (2):
<ul>
<li>r300/compiler: Disable register rename pass on r500</li>
<li>r300/compiler: Don't erase sources when converting RGB-&gt;Alpha</li>
</ul></p>
<p>Vinson Lee (3):
<ul>
<li>ralloc: Add missing va_end following va_copy.</li>
<li>mesa: Move declaration before code in extensions.c.</li>
<li>mesa: Move loop variable declarations outside for loop in extensions.c.</li>
</ul></p>
<p>nobled (1):
<ul>
<li>glx: Put null check before use</li>
</ul></p>
</p>
</body>
</html>

2795
docs/relnotes-7.10.html Normal file

File diff suppressed because it is too large Load Diff

62
docs/relnotes-7.11.html Normal file
View File

@@ -0,0 +1,62 @@
<HTML>
<head>
<TITLE>Mesa Release Notes</TITLE>
<link rel="stylesheet" type="text/css" href="mesa.css">
<meta http-equiv="content-type" content="text/html; charset=utf-8" />
</head>
<BODY>
<body bgcolor="#eeeeee">
<H1>Mesa 7.11 Release Notes / (release date TBD)</H1>
<p>
Mesa 7.11 is a new development release.
People who are concerned with stability and reliability should stick
with a previous release or wait for Mesa 7.11.1.
</p>
<p>
Mesa 7.11 implements the OpenGL 2.1 API, but the version reported by
glGetString(GL_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 2.1.
</p>
<p>
See the <a href="install.html">Compiling/Installing page</a> for prerequisites
for DRI hardware acceleration.
</p>
<h2>MD5 checksums</h2>
<pre>
tbd
</pre>
<h2>New features</h2>
<ul>
<li>GL_ARB_draw_instanced extension (gallium drivers, swrast)
<li>GL_ARB_instanced_arrays extension (gallium drivers)
<li>GL_ARB_texture_compression_rgtc (gallium r600, swrast)
<li>GL_ARB_draw_buffers_blend (gallium)
<li>GL_EXT_texture_sRGB_decode (gallium drivers, swrast, i965)
</ul>
<h2>Bug fixes</h2>
<ul>
</ul>
<h2>Changes</h2>
<ul>
<li>The Windows MSVC project files have been removed. They haven't been maintained
in quite a while. Building with SCons is an alterantive.
<li>Removed GL_SGI_texture_color_table support from swrast driver - the only
driver that implemented it.
</ul>
</body>
</html>

View File

@@ -26,7 +26,15 @@ for DRI hardware acceleration.
<h2>MD5 checksums</h2>
<pre>
tbd
c89b63d253605ed40e8ac370d25a833c MesaLib-7.8.2.tar.gz
6be2d343a0089bfd395ce02aaf8adb57 MesaLib-7.8.2.tar.bz2
a04ad3b06ac5ff3969a003fa7bbf7d5b MesaLib-7.8.2.zip
7c213f92efeb471f0331670d5079d4c0 MesaDemos-7.8.2.tar.gz
757d9e2e06f48b1a52848be9b0307ced MesaDemos-7.8.2.tar.bz2
8d0e5cfe68b8ebf90265d350ae2c48b1 MesaDemos-7.8.2.zip
b74482e3f44f35ed395c4aada4fd8240 MesaGLUT-7.8.2.tar.gz
a471807b65e49c325808ba4551be93ed MesaGLUT-7.8.2.tar.bz2
9f190268c42be582ef66e47365ee61e3 MesaGLUT-7.8.2.zip
</pre>
@@ -44,10 +52,95 @@ tbd
<ul>
<li>Fixed Gallium glDrawPixels(GL_DEPTH_COMPONENT).
<li>Fixed Gallium Cell driver to buildable, runable state
<li>Fixed bad error checking for glFramebufferRenderbuffer(attachment=GL_DEPTH_STENCIL_ATTACHMENT).
<li>Fixed incorrect Z coordinate handling in "meta" glDraw/CopyPixels.
<a href="https://bugs.freedesktop.org/show_bug.cgi?id=23670">Bug
#23670</a>.</li>
<li>Assorted i965 driver fixes.
Including but not limited to:
<ul>
<li>Fix scissoring when width or height is
0. <a href="https://bugs.freedesktop.org/show_bug.cgi?id=27643">Bug
#27643</a>.
<li>Fix bit allocation for number of color regions for
ARB_draw_buffers.</li>
<li>Set the correct provoking vertex for clipped first-mode
trifans. <a href="https://bugs.freedesktop.org/show_bug.cgi?id=24470">Bug
#24470</a>.</li>
<li>Use <code>R16G16B16A16_FLOAT</code> for 3-component half-float.</li>
<li>Fix assertion for surface tile offset usage on Ironlake.</li>
<li>Fix cube map layouts on Ironlake.</li>
<li>When an RB gets a new region, clear the old from the state
cache. <a href="https://bugs.freedesktop.org/show_bug.cgi?id=24119">Bug
#24119</a>.</li>
<li>Reject shaders with uninlined function calls instead of hanging.</li>
</ul>
</li>
<li>Assorted i915 driver fixes. Including but not limited to:
<ul>
<li>Fixed texture LOD clamping in i915 driver.
<a href="https://bugs.freedesktop.org/show_bug.cgi?id=24846">Bug
#24846</a>.</li>
<li>Fix off-by-one for drawing rectangle.
<a href="https://bugs.freedesktop.org/show_bug.cgi?id=27408">Bug
#27408</a>.</li>
</ul>
</li>
<li>Fixed hangs in etracer on 830 and 845
chipsets. <a href="https://bugs.freedesktop.org/show_bug.cgi?id=26557">Bug
#26557</a>.</li>
<li>Fixed tiling of small textures on all Intel drivers.</li>
<li>Fixed crash in Savage driver when using <code>_mesa_CopyTexImage2D</code>.
<a href="https://bugs.freedesktop.org/show_bug.cgi?id=27652">Bug
#27652</a>.</li>
<li>Assorted GLX fixes. Including but not limited to:
<ul>
<li>Fixed <code>__glXInitializeVisualConfigFromTags</code>'s handling of
unrecognized fbconfig tags.</li>
<li>Fixed regression with <code>GLX_USE_GL</code>.
<li>Fixed config chooser logic for 'mask' matching.</li>
<li>Report swap events correctly in direct rendered case (DRI2)</li>
<li>Fixed build with dri2proto which doesn't define
<code>X_DRI2SwapInterval</code>.</li>
<li>Get <code>GLX_SCREEN</code> first in <code>__glXQueryContextInfo</code>.
<a href="https://bugs.freedesktop.org/show_bug.cgi?id=14245">Bug
#14245</a>.</li>
</ul>
</li>
<li>Assorted GLSL fixes. Including but not limited to:
<ul>
<li>Change variable declared assertion into conditional in GLSL
compiler. <a href="https://bugs.freedesktop.org/show_bug.cgi?id=27921">Bug
#27921</a>.</li>
<li>Fix instruction indexing
bugs. <a href="https://bugs.freedesktop.org/show_bug.cgi?id=27566">Bug
#27566</a>.</li>
<li>Updated uniform location / offset encoding to be more like
other implementations.</li>
<li>Don't overwrite a driver's shader infolog with generic failure
message.</li>
</ul>
</li>
<li>Fixed OSMesa build for 16 and 32-bit color channel depth.
<li>Fixed OSMesa build with hidden symbol visibility. libOSMesa no longer links to libGL.
<a href="https://bugs.freedesktop.org/show_bug.cgi?id=28305">Bug
#28305</a>.
<li>Fixed handling of multiple render targets in fixed-function
texture envrionmnent programs.</li>
<li>Fixed conversion errors in <code>signed_rgba8888[rev]</code> texel
fetch.</li>
<li>Don't set srcLevel on <code>GL_TEXTURE_RECTANGLE_ARB</code> targets.</li>
<li>Various build fixes for OpenBSD.</li>
<li>Various build fixes for OS X.</li>
<li>Various build fixes for GCC 3.3.</li>
</ul>
<h2>Changes</h2>
<p>None.</p>
</body>
</html>

89
docs/relnotes-7.8.3.html Normal file
View File

@@ -0,0 +1,89 @@
<HTML>
<TITLE>Mesa Release Notes</TITLE>
<head><link rel="stylesheet" type="text/css" href="mesa.css"></head>
<BODY>
<body bgcolor="#eeeeee">
<H1>Mesa 7.8.3 Release Notes / (date tbd)</H1>
<p>
Mesa 7.8.3 is a bug fix release which fixes bugs found since the 7.8.2 release.
</p>
<p>
Mesa 7.8.3 implements the OpenGL 2.1 API, but the version reported by
glGetString(GL_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 2.1.
</p>
<p>
See the <a href="install.html">Compiling/Installing page</a> for prerequisites
for DRI hardware acceleration.
</p>
<h2>MD5 checksums</h2>
<pre>
x MesaLib-7.8.3.tar.gz
x MesaLib-7.8.3.tar.bz2
x MesaLib-7.8.3.zip
x MesaDemos-7.8.3.tar.gz
x MesaDemos-7.8.3.tar.bz2
x MesaDemos-7.8.3.zip
x MesaGLUT-7.8.3.tar.gz
x MesaGLUT-7.8.3.tar.bz2
x MesaGLUT-7.8.3.zip
</pre>
<h2>New features</h2>
<p>None.</p>
<h2>Changes</h2>
<ul>
<li>The radeon driver should use less memory when searching for a valid mip
image.</li>
</ul>
<h2>Bug fixes</h2>
<ul>
<li>Fix unsupported FB with D24S8 (bug
<a href="https://bugs.freedesktop.org/show_bug.cgi?id=23670">29116</a>)</li>
<li>Fix ReadPixels crash when reading depth/stencil from an FBO</li>
<li>Fixed a bug rendering to 16-bit buffers using swrast.</li>
<li>Fixed a state tracker/TGSI bug that caused crashes when using Windows'
memory debugging features.</li>
<li>Fixed an issue rendering to 32-bit channels with swrast (bug
<a href="https://bugs.freedesktop.org/show_bug.cgi?id=29487">29487</a>)</li>
<li>GLSL: fix indirect <TT>gl_TextureMatrix</TT> addressing (bug
<a href="https://bugs.freedesktop.org/show_bug.cgi?id=28967">28967</a>)</li>
<li>GLSL: fix for bug
<a href="https://bugs.freedesktop.org/show_bug.cgi?id=27216">27216</a></li>
<li>GLSL: fix zw fragcoord entries in some cases (bug
<a href="https://bugs.freedesktop.org/show_bug.cgi?id=29183">29183</a>)</li>
<li>Fix texture env generation in some cases (bug
<a href="https://bugs.freedesktop.org/show_bug.cgi?id=28169">28169</a>)</li>
<li>osmesa: a fix for calling <TT>OSMesaMakeCurrent</TT> twice was applied (bug
<a href="https://bugs.freedesktop.org/show_bug.cgi?id=10966">10966</a></li>
<li>A bug was fixed which could cause Mesa to ignore the
<TT>MESA_EXTENSION_OVERRIDE</TT> environment variable.</li>
<li>A bug related to specular highlights on backfaces was fixed.</li>
<li>A radeon-specific issue with <TT>glCopyTex(Sub)Image</TT> was
corrected.</li>
<li>radeon/wine: flush command stream in more cases, fixing wine d3d9
tests.</li>
<li>r600: fix sin+cos normalization.</li>
<li>r600: (properly) ignore <TT>GL_COORD_REPLACE</TT> when point sprites are
disabled.</li>
<li>radeon: avoid flushing when the context is not current.</li>
<li>r300c: a bug affecting unaligned BOs was fixed.</li>
<li>r300c: a hardlock caused by ARB_half_float_vertex incorrectly advertised on some chipsets.</li>
</ul>
</body>
</html>

406
docs/relnotes-7.9.1.html Normal file
View File

@@ -0,0 +1,406 @@
<HTML>
<head>
<TITLE>Mesa Release Notes</TITLE>
<link rel="stylesheet" type="text/css" href="mesa.css">
<meta http-equiv="content-type" content="text/html; charset=utf-8" />
</head>
<BODY>
<body bgcolor="#eeeeee">
<H1>Mesa 7.9.1 Release Notes / January 7, 2011</H1>
<p>
Mesa 7.9.1 is a bug fix release which fixes bugs found since the 7.9 release.
</p>
<p>
Mesa 7.9.1 implements the OpenGL 2.1 API, but the version reported by
glGetString(GL_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 2.1.
</p>
<p>
See the <a href="install.html">Compiling/Installing page</a> for prerequisites
for DRI hardware acceleration.
</p>
<h2>MD5 checksums</h2>
<pre>
78422843ea875ad4eac35b9b8584032b MesaLib-7.9.1.tar.gz
07dc6cfb5928840b8b9df5bd1b3ae434 MesaLib-7.9.1.tar.bz2
c8eaea5b3c3d6dee784bd8c2db91c80f MesaLib-7.9.1.zip
ee9ecae4ca56fbb2d14dc15e3a0a7640 MesaGLUT-7.9.1.tar.gz
41fc477d524e7dc5c84da8ef22422bea MesaGLUT-7.9.1.tar.bz2
90b287229afdf19317aa989d19462e7a MesaGLUT-7.9.1.zip
</pre>
<h2>New features</h2>
<p>None.</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28800">Bug 28800</a> - [r300c, r300g] Texture corruption with World of Warcraft</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=29420">Bug 29420</a> - Amnesia / HPL2 RendererFeatTest - not rendering correctly</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=29946">Bug 29946</a> - [swrast] piglit valgrind glsl-array-bounds-04 fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=30261">Bug 30261</a> - [GLSL 1.20] allowing inconsistent invariant declaration between two vertex shaders</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=30632">Bug 30632</a> - [softpipe] state_tracker/st_manager.c:489: st_context_notify_invalid_framebuffer: Assertion `stfb &amp;&amp; stfb-&gt;iface == stfbi' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=30694">Bug 30694</a> - wincopy will crash on Gallium drivers when going to front buffer</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=30787">Bug 30787</a> - Invalid asm shader does not generate draw-time error when used with GLSL shader</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=30993">Bug 30993</a> - getFramebufferAttachmentParameteriv wrongly generates error</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31101">Bug 31101</a> - [glsl2] abort() in ir_validate::visit_enter(ir_assignment *ir)</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31193">Bug 31193</a> - [regression] aa43176e break water reflections</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31194">Bug 31194</a> - The mesa meta save/restore code doesn't ref the current GLSL program</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31371">Bug 31371</a> - glslparsertest: ir.cpp:358: ir_constant::ir_constant(const glsl_type*, const ir_constant_data*): Assertion `(type->base_type &gt;= 0) &amp;&amp; (type->base_type &lt;= 3)' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31439">Bug 31439</a> - Crash in glBufferSubData() with size == 0</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31495">Bug 31495</a> - [i965 gles2c bisected] OpenGL ES 2.0 conformance GL2Tests_GetBIFD_input.run regressed</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31514">Bug 31514</a> - isBuffer returns true for unbound buffers</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31560">Bug 31560</a> - [tdfx] tdfx_tex.c:702: error: const struct gl_color_table has no member named Format</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31617">Bug 31617</a> - Radeon/Compiz: 'failed to attach dri2 front buffer', error case not handled</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31648">Bug 31648</a> - [GLSL] array-struct-array gets assertion: `(size &gt;= 1) && (size &lt;= 4)' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31650">Bug 31650</a> - [GLSL] varying gl_TexCoord fails to be re-declared to different size in the second shader</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31673">Bug 31673</a> - GL_FRAGMENT_PRECISION_HIGH preprocessor macro undefined in GLSL ES</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31690">Bug 31690</a> - i915 shader compiler fails to flatten if in Aquarium webgl demo.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31832">Bug 31832</a> - [i915] Bad renderbuffer format: 21</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31841">Bug 31841</a> - [drm:radeon_cs_ioctl] *ERROR* Invalid command stream !</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31894">Bug 31894</a> - Writing to gl_PointSize with GLES2 corrupts other varyings</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31909">Bug 31909</a> - [i965] brw_fs.cpp:1461: void fs_visitor::emit_bool_to_cond_code(ir_rvalue*): Assertion `expr-&gt;operands[i]-&gt;type-&gt;is_scalar()' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31934">Bug 31934</a> - [gallium] Mapping empty buffer object causes SIGSEGV</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31983">Bug 31983</a> - [i915 gles2] "if (expression with builtin/varying variables) discard" breaks linkage</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31985">Bug 31985</a> - [GLSL 1.20] initialized uniform array considered as "unsized"</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31987">Bug 31987</a> - [gles2] if input a wrong pname(GL_NONE) to glGetBoolean, it will not case GL_INVALID_ENUM</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32035">Bug 32035</a> - [GLSL bisected] comparing unsized array gets segfault</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32070">Bug 32070</a> - llvmpipe renders stencil demo incorrectly</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32273">Bug 32273</a> - assertion fails when starting vdrift 2010 release with shaders enabled</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32287">Bug 32287</a> - [bisected GLSL] float-int failure</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32311">Bug 32311</a> - [965 bisected] Array look-ups broken on GM45</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32520">Bug 32520</a> - [gles2] glBlendFunc(GL_ZERO, GL_DST_COLOR) will result in GL_INVALID_ENUM</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32825">Bug 32825</a> - egl_glx driver completely broken in 7.9 branch [fix in master]</li>
</ul>
<h2>Changes</h2>
<p>The full set of changes can be viewed by using the following GIT command:</p>
<pre>
git log mesa-7.9..mesa-7.9.1
</pre>
<p>Alex Deucher (5):
<ul>
<li>r100: revalidate after radeon_update_renderbuffers</li>
<li>r600c: add missing radeon_prepare_render() call on evergreen</li>
<li>r600c: properly align mipmaps to group size</li>
<li>gallium/egl: fix r300 vs r600 loading</li>
<li>r600c: fix some opcodes on evergreen</li>
</ul></p>
<p>Aras Pranckevicius (2):
<ul>
<li>glsl: fix crash in loop analysis when some controls can't be determined</li>
<li>glsl: fix matrix type check in ir_algebraic</li>
</ul></p>
<p>Brian Paul (27):
<ul>
<li>swrast: fix choose_depth_texture_level() to respect mipmap filtering state</li>
<li>st/mesa: replace assertion w/ conditional in framebuffer invalidation</li>
<li>egl/i965: include inline_wrapper_sw_helper.h</li>
<li>mesa: Add missing else in do_row_3D</li>
<li>mesa: add missing formats in _mesa_format_to_type_and_comps()</li>
<li>mesa: handle more pixel types in mipmap generation code</li>
<li>mesa: make glIsBuffer() return false for never bound buffers</li>
<li>mesa: fix glDeleteBuffers() regression</li>
<li>swrast: init alpha value to 1.0 in opt_sample_rgb_2d()</li>
<li>meta: Mask Stencil.Clear against stencilMax in _mesa_meta_Clear</li>
<li>st/mesa: fix mapping of zero-sized buffer objects</li>
<li>mesa: check for posix_memalign() errors</li>
<li>llvmpipe: fix broken stencil writemask</li>
<li>mesa: fix GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME query</li>
<li>mesa: return GL_FRAMEBUFFER_DEFAULT as FBO attachment type</li>
<li>mesa: make glGet*(GL_NONE) generate GL_INVALID_ENUM</li>
<li>mesa: test for cube map completeness in glGenerateMipmap()</li>
<li>tnl: Initialize gl_program_machine memory in run_vp.</li>
<li>tnl: a better way to initialize the gl_program_machine memory</li>
<li>mesa, st/mesa: disable GL_ARB_geometry_shader4</li>
<li>glsl: fix off by one in register index assertion</li>
<li>st/mesa: fix mipmap generation bug</li>
<li>glsl: new glsl_strtod() wrapper to fix decimal point interpretation</li>
<li>mesa: no-op glBufferSubData() on size==0</li>
<li>tdfx: s/Format/_BaseFormat/</li>
<li>st/mesa: fix renderbuffer pointer check in st_Clear()</li>
<li>mesa: Bump the number of bits in the register index.</li>
</ul></p>
<p>Chad Versace (5):
<ul>
<li>glsl: Fix lexer rule for ^=</li>
<li>glsl: Fix ast-to-hir for ARB_fragment_coord_conventions</li>
<li>glsl: Fix ir_expression::constant_expression_value()</li>
<li>glsl: Fix erroneous cast in ast_jump_statement::hir()</li>
<li>glsl: Fix linker bug in cross_validate_globals()</li>
</ul></p>
<p>Chia-I Wu (10):
<ul>
<li>targets/egl: Fix linking with libdrm.</li>
<li>st/vega: Fix version check in context creation.</li>
<li>st/egl: Do not finish a fence that is NULL.</li>
<li>egl: Fix a false negative check in _eglCheckMakeCurrent.</li>
<li>st/mesa: Unreference the sampler view in st_bind_surface.</li>
<li>egl_dri2: Fix __DRI_DRI2 version 1 support.</li>
<li>st/vega: Do not wait NULL fences.</li>
<li>mesa: Do not advertise GL_OES_texture_3D.</li>
<li>egl_glx: Fix borken driver.</li>
<li>egl: Check extensions.</li>
</ul></p>
<p>Daniel Lichtenberger (1):
<ul>
<li>radeon: fix potential segfault in renderbuffer update</li>
</ul></p>
<p>Daniel Vetter (1):
<ul>
<li>r200: revalidate after radeon_update_renderbuffers</li>
</ul></p>
<p>Dave Airlie (1):
<ul>
<li>r300g: fixup rs690 tiling stride alignment calculations.</li>
</ul></p>
<p>Eric Anholt (13):
<ul>
<li>intel: Allow CopyTexSubImage to InternalFormat 3/4 textures, like RGB/RGBA.</li>
<li>glsl: Free the loop state context when we free the loop state.</li>
<li>i965: Allow OPCODE_SWZ to put immediates in the first arg.</li>
<li>i965: Add support for rendering to SARGB8 FBOs.</li>
<li>glsl: Add a helper constructor for expressions that works out result type.</li>
<li>glsl: Fix structure and array comparisions.</li>
<li>glsl: Quiet unreachable no-return-from-function warning.</li>
<li>glsl: Mark the array access for whole-array comparisons.</li>
<li>glsl: Fix flipped return of has_value() for array constants.</li>
<li>mesa: Add getters for the rest of the supported draw buffers.</li>
<li>mesa: Add getters for ARB_copy_buffer's attachment points.</li>
<li>i965: Correct the dp_read message descriptor setup on g4x.</li>
<li>glsl: Correct the marking of InputsRead/OutputsWritten on in/out matrices.</li>
</ul></p>
<p>Fabian Bieler (1):
<ul>
<li>glsl: fix lowering conditional returns in subroutines</li>
</ul></p>
<p>Francisco Jerez (3):
<ul>
<li>meta: Don't leak alpha function/reference value changes.</li>
<li>meta: Fix incorrect rendering of the bitmap alpha component.</li>
<li>meta: Don't try to disable cube maps if the driver doesn't expose the extension.</li>
</ul></p>
<p>Henri Verbeet (2):
<ul>
<li>r600: Evergreen has two extra frac_bits for the sampler LOD state.</li>
<li>st/mesa: Handle wrapped depth buffers in st_copy_texsubimage().</li>
</ul></p>
<p>Ian Romanick (33):
<ul>
<li>Add 7.9 md5sums</li>
<li>docs: Import 7.8.x release notes from 7.8 branch.</li>
<li>docs: download.html does not need to be updated for each release</li>
<li>docs: Update mailing lines from sf.net to freedesktop.org</li>
<li>docs: added news item for 7.9 release</li>
<li>mesa: Validate assembly shaders when GLSL shaders are used</li>
<li>linker: Reject shaders that have unresolved function calls</li>
<li>mesa: Refactor validation of shader targets</li>
<li>glsl: Slightly change the semantic of _LinkedShaders</li>
<li>linker: Improve handling of unread/unwritten shader inputs/outputs</li>
<li>glsl: Commit lexer files changed by previous cherry picking</li>
<li>mesa: Make metaops use program refcounts instead of names.</li>
<li>glsl: Fix incorrect gl_type of sampler2DArray and sampler1DArrayShadow</li>
<li>mesa: Allow query of MAX_SAMPLES with EXT_framebuffer_multisample</li>
<li>glsl: better handling of linker failures</li>
<li>mesa: Fix glGet of ES2's GL_MAX_*_VECTORS properties.</li>
<li>i915: Disallow alpha, red, RG, and sRGB as render targets</li>
<li>glsl/linker: Free any IR discarded by optimization passes.</li>
<li>glsl: Add an optimization pass to simplify discards.</li>
<li>glsl: Add a lowering pass to move discards out of if-statements.</li>
<li>i915: Correctly generate unconditional KIL instructions</li>
<li>glsl: Add unary ir_expression constructor</li>
<li>glsl: Ensure that equality comparisons don't return a NULL IR tree</li>
<li>glcpp: Commit changes in generated files cause by previous commit</li>
<li>glsl: Inherrit type of declared variable from initializer</li>
<li>glsl: Inherrit type of declared variable from initializer after processing assignment</li>
<li>linker: Ensure that unsized arrays have a size after linking</li>
<li>linker: Fix regressions caused by previous commit</li>
<li>linker: Allow built-in arrays to have different sizes between shader stages</li>
<li>ir_to_mesa: Don't generate swizzles for record derefs of non-scalar/vectors</li>
<li>Refresh autogenerated file builtin_function.cpp.</li>
<li>docs: Initial set of release notes for 7.9.1</li>
<li>mesa: set version string to 7.9.1</li>
</ul></p>
<p>Julien Cristau (1):
<ul>
<li>Makefile: don't include the same files twice in the tarball</li>
</ul></p>
<p>Kenneth Graunke (19):
<ul>
<li>glcpp: Return NEWLINE token for newlines inside multi-line comments.</li>
<li>generate_builtins.py: Output large strings as arrays of characters.</li>
<li>glsl: Fix constant component count in vector constructor emitting.</li>
<li>ir_dead_functions: Actually free dead functions and signatures.</li>
<li>glcpp: Define GL_FRAGMENT_PRECISION_HIGH if GLSL version &gt;= 1.30.</li>
<li>glsl: Unconditionally define GL_FRAGMENT_PRECISION_HIGH in ES2 shaders.</li>
<li>glsl: Fix constant expression handling for &lt, &gt;, &lt=, &gt;= on vectors.</li>
<li>glsl: Use do_common_optimization in the standalone compiler.</li>
<li>glsl: Don't inline function prototypes.</li>
<li>glsl: Add a virtual as_discard() method.</li>
<li>glsl: Remove "discard" support from lower_jumps.</li>
<li>glsl: Refactor get_num_operands.</li>
<li>glcpp: Don't emit SPACE tokens in conditional_tokens production.</li>
<li>glsl: Clean up code by adding a new is_break() function.</li>
<li>glsl: Consider the "else" branch when looking for loop breaks.</li>
<li>Remove OES_compressed_paletted_texture from the ES2 extension list.</li>
<li>glsl/builtins: Compute the correct value for smoothstep(vec, vec, vec).</li>
<li>Fix build on systems where "python" is python 3.</li>
<li>i965: Internally enable GL_NV_blend_square on ES2.</li>
</ul></p>
<p>Kristian Høgsberg (1):
<ul>
<li>i965: Don't write mrf assignment for pointsize output</li>
</ul></p>
<p>Luca Barbieri (1):
<ul>
<li>glsl: Unroll loops with conditional breaks anywhere (not just the end)</li>
</ul></p>
<p>Marek Olšák (17):
<ul>
<li>r300g: fix microtiling for 16-bits-per-channel formats</li>
<li>r300g: fix texture border for 16-bits-per-channel formats</li>
<li>r300g: add a default channel ordering of texture border for unhandled formats</li>
<li>r300g: fix texture border color for all texture formats</li>
<li>r300g: fix rendering with no vertex elements</li>
<li>r300/compiler: fix rc_rewrite_depth_out for it to work with any instruction</li>
<li>r300g: fix texture border color once again</li>
<li>r300g: fix texture swizzling with compressed textures on r400-r500</li>
<li>r300g: disable ARB_texture_swizzle if S3TC is enabled on r3xx-only</li>
<li>mesa, st/mesa: fix gl_FragCoord with FBOs in Gallium</li>
<li>st/mesa: initialize key in st_vp_varient</li>
<li>r300/compiler: fix swizzle lowering with a presubtract source operand</li>
<li>r300g: fix rendering with a vertex attrib having a zero stride</li>
<li>ir_to_mesa: Add support for conditional discards.</li>
<li>r300g: finally fix the texture corruption on r3xx-r4xx</li>
<li>mesa: fix texel store functions for some float formats</li>
<li>r300/compiler: disable the rename_regs pass for loops</li>
</ul></p>
<p>Mario Kleiner (1):
<ul>
<li>mesa/r300classic: Fix dri2Invalidate/radeon_prepare_render for page flipping.</li>
</ul></p>
<p>Peter Clifton (1):
<ul>
<li>intel: Fix emit_linear_blit to use DWORD aligned width blits</li>
</ul></p>
<p>Robert Hooker (2):
<ul>
<li>intel: Add a new B43 pci id.</li>
<li>egl_dri2: Add missing intel chip ids.</li>
</ul></p>
<p>Roland Scheidegger (1):
<ul>
<li>r200: fix r200 large points</li>
</ul></p>
<p>Thomas Hellstrom (17):
<ul>
<li>st/xorg: Don't try to use option values before processing options</li>
<li>xorg/vmwgfx: Make vmwarectrl work also on 64-bit servers</li>
<li>st/xorg: Add a customizer option to get rid of annoying cursor update flicker</li>
<li>xorg/vmwgfx: Don't hide HW cursors when updating them</li>
<li>st/xorg: Don't try to remove invalid fbs</li>
<li>st/xorg: Fix typo</li>
<li>st/xorg, xorg/vmwgfx: Be a bit more frendly towards cross-compiling environments</li>
<li>st/xorg: Fix compilation errors for Xservers compiled without Composite</li>
<li>st/xorg: Don't use deprecated x*alloc / xfree functions</li>
<li>xorg/vmwgfx: Don't use deprecated x*alloc / xfree functions</li>
<li>st/xorg: Fix compilation for Xservers &gt;= 1.10</li>
<li>mesa: Make sure we have the talloc cflags when using the talloc headers</li>
<li>egl: Add an include for size_t</li>
<li>mesa: Add talloc includes for gles</li>
<li>st/egl: Fix build for include files in nonstandard places</li>
<li>svga/drm: Optionally resolve calls to powf during link-time</li>
<li>gallium/targets: Trivial crosscompiling fix</li>
</ul></p>
<p>Tom Stellard (7):
<ul>
<li>r300/compiler: Make sure presubtract sources use supported swizzles</li>
<li>r300/compiler: Fix register allocator's handling of loops</li>
<li>r300/compiler: Fix instruction scheduling within IF blocks</li>
<li>r300/compiler: Use zero as the register index for unused sources</li>
<li>r300/compiler: Ignore alpha dest register when replicating the result</li>
<li>r300/compiler: Use correct swizzles for all presubtract sources</li>
<li>r300/compiler: Don't allow presubtract sources to be remapped twice</li>
</ul></p>
<p>Vinson Lee (1):
<ul>
<li>glsl: Fix 'control reaches end of non-void function' warning.</li>
</ul></p>
<p>richard (1):
<ul>
<li>r600c : inline vertex format is not updated in an app, switch to use vfetch constants. For the 7.9 and 7.10 branches as well.</li>
</ul></p>
</body>
</html>

336
docs/relnotes-7.9.2.html Normal file
View File

@@ -0,0 +1,336 @@
<HTML>
<head>
<TITLE>Mesa Release Notes</TITLE>
<link rel="stylesheet" type="text/css" href="mesa.css">
<meta http-equiv="content-type" content="text/html; charset=utf-8" />
</head>
<BODY>
<body bgcolor="#eeeeee">
<H1>Mesa 7.9.2 Release Notes / TBD</H1>
<p>
Mesa 7.9.2 is a bug fix release which fixes bugs found since the 7.9.1 release.
</p>
<p>
Mesa 7.9.2 implements the OpenGL 2.1 API, but the version reported by
glGetString(GL_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 2.1.
</p>
<p>
See the <a href="install.html">Compiling/Installing page</a> for prerequisites
for DRI hardware acceleration.
</p>
<h2>MD5 checksums</h2>
<pre>
eb4ab8c1a03386def3ea34b1358e9cda MesaLib-7.9.2.tar.gz
8f6d1474912787ce13bd35f3bae9938a MesaLib-7.9.2.tar.bz2
427a81dd43ac97603768dc5c6af3df26 MesaLib-7.9.2.zip
aacb8f4db997e346db40c6066942140a MesaGLUT-7.9.2.tar.gz
18abe6cff4fad8ad4752c7b7ab548e5d MesaGLUT-7.9.2.tar.bz2
3189e5732d636c71baf3d8bc23ce7b11 MesaGLUT-7.9.2.zip
</pre>
<h2>New features</h2>
<p>None.</p>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li>Fix an off-by-one bug in a vsplit assertion.</li>
<li>Fix incorrect handling of <tt>layout</tt> qualifier
with <tt>in</tt>, <tt>out</tt>, <tt>attribute</tt>, and <tt>varying</tt>.</li>
<li>Fix an i965 GPU hang in GLSL shaders that contain an unconditional <tt>discard</tt> statement.</li>
<li>Fix an i965 shader bug where the negative absolute value was generated instead of the absolute value of a negation.</li>
<li>Fix numerous issues handling precision qualifiers in GLSL ES.</li>
<li>Fixed a few GLX protocol encoder bugs (Julien Cristau)</li>
<li>Assorted Gallium llvmpipe driver bug fixes</li>
<li>Assorted Mesa/Gallium state tracker bug fixes</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=26795">Bug 26795</a> - gl_FragCoord off by one in Gallium drivers.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=29164">Bug 29164</a> - [GLSL 1.20] invariant variable shouldn't be used before declaration</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=29823">Bug 29823</a> - GetUniform[if]v busted</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=29927">Bug 29927</a> - [glsl2] fail to compile shader with constructor for array of struct type</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=30156">Bug 30156</a> - [i965] After updating to Mesa 7.9, Civilization IV starts to show garbage</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31923">Bug 31923</a> - [GLSL 1.20] allowing inconsistent centroid declaration between two vertex shaders</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=31925">Bug 31925</a> - [GLSL 1.20] "#pragma STDGL invariant(all)" fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32214">Bug 32214</a> - [gles2]no link error happens when missing vertex shader or frag shader</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32375">Bug 32375</a> - [gl gles2] Not able to get the attribute by function glGetVertexAttribfv</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32541">Bug 32541</a> - Segmentation Fault while running an HDR (high dynamic range) rendering demo</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32569">Bug 32569</a> - [gles2] glGetShaderPrecisionFormat not implemented yet</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32695">Bug 32695</a> - [glsl] SIGSEGV glcpp/glcpp-parse.y:833</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32831">Bug 32831</a> - [glsl] division by zero crashes GLSL compiler</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=32910">Bug 32910</a> - Keywords 'in' and 'out' not handled properly for GLSL 1.20 shaders</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33219">Bug 33219</a> -[GLSL bisected] implicit sized array triggers segfault in ir_to_mesa_visitor::copy_propagate</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33306">Bug 33306</a> - GLSL integer division by zero crashes GLSL compiler</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33308">Bug 33308</a> -[glsl] ast_to_hir.cpp:3016: virtual ir_rvalue* ast_jump_statement::hir(exec_list*, _mesa_glsl_parse_state*): Assertion `ret != __null' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33316">Bug 33316</a> - uniform array will be allocate one line more and initialize it when it was freed will abort</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33386">Bug 33386</a> - Dubious assembler in read_rgba_span_x86.S</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33388">Bug 33388</a> - Dubious assembler in xform4.S</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33433">Bug 33433</a> - Error in x86-64 API dispatch code.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33507">Bug 33507</a> - [glsl] GLSL preprocessor modulus by zero crash</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33508">Bug 33508</a> - [glsl] GLSL compiler modulus by zero crash</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=33916">Bug 33916</a> - Compiler accepts reserved operators % and %=</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=34047">Bug 34047</a> - Assert in _tnl_import_array() when using GLfixed vertex datatypes with GLESv2</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=34114">Bug 34114</a> - Sun Studio build fails due to standard library functions not being in global namespace</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=34198">Bug 34198</a> - [GLSL] implicit sized array with index 0 used gets assertion</li>
<li><a href="https://bugs.launchpad.net/ubuntu/+source/mesa/+bug/691653">Ubuntu bug 691653</a> - compiz crashes when using alt-tab (the radeon driver kills it) </li>
<li><a href="https://bugs.meego.com/show_bug.cgi?id=13005">Meego bug 13005</a> - Graphics GLSL issue lead to camera preview fail on Pinetrail</li>
<!-- <li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=">Bug </a> - </li> -->
</ul>
<h2>Changes</h2>
<p>The full set of changes can be viewed by using the following GIT command:</p>
<pre>
git log mesa-7.9.1..mesa-7.9.2
</pre>
<p>Alberto Milone (1):
<ul>
<li>r600c: add evergreen ARL support.</li>
</ul></p>
<p>Brian Paul (19):
<ul>
<li>draw: Fix an off-by-one bug in a vsplit assertion.</li>
<li>mesa: fix a few format table mistakes, assertions</li>
<li>mesa: fix num_draw_buffers==0 in fixed-function fragment program generation</li>
<li>mesa: don't assert in GetIntegerIndexed, etc</li>
<li>mesa: check for dummy renderbuffer in _mesa_FramebufferRenderbufferEXT()</li>
<li>llvmpipe: make sure binning is active when we begin/end a query</li>
<li>st/mesa: fix incorrect fragcoord.x translation</li>
<li>softpipe: fix off-by-one error in setup_fragcoord_coeff()</li>
<li>cso: fix loop bound in cso_set_vertex_samplers()</li>
<li>st/mesa: set renderbuffer _BaseFormat in a few places</li>
<li>st/mesa: fix the default case in st_format_datatype()</li>
<li>st/mesa: need to translate clear color according to surface's base format</li>
<li>docs: update 7.9.2 release notes with Brian's cherry-picks</li>
<li>docs: add links to 7.9.1 and 7.9.2 release notes</li>
<li>mesa: include compiler.h for ASSERT macro</li>
<li>glsl: add ir_shader case in switch stmt to silence warning</li>
<li>glsl2: fix signed/unsigned comparison warning</li>
<li>mesa: implement glGetShaderPrecisionFormat()</li>
<li>docs: updated environment variable list</li>
</ul></p>
<p>Bryce Harrington (1):
<ul>
<li>r300g: Null pointer check for buffer deref in gallium winsys</li>
</ul></p>
<p>Chad Versace (14):
<ul>
<li>glsl: At link-time, check that globals have matching centroid qualifiers</li>
<li>glcpp: Fix segfault when validating macro redefinitions</li>
<li>glsl: Fix parser rule for type_specifier</li>
<li>glsl: Change default value of ast_type_specifier::precision</li>
<li>glsl: Add semantic checks for precision qualifiers</li>
<li>glsl: Add support for default precision statements</li>
<li>glsl: Remove redundant semantic check in parser</li>
<li>glsl: Fix semantic checks on precision qualifiers</li>
<li>glsl: Fix segfault due to missing printf argument</li>
<li>glsl: Mark 'in' variables at global scope as read-only</li>
<li>glcpp: Raise error when modulus is zero</li>
<li>glsl: Set operators '%' and '%=' to be reserved when GLSL &lt 1.30</li>
<li>glsl: Reinstate constant-folding for division by zero</li>
<li>tnl: Add support for datatype GL_FIXED in vertex arrays</li>
</ul></p>
<p>Chia-I Wu (1):
<ul>
<li>mesa: Add glDepthRangef and glClearDepthf to APIspec.xml.</li>
</ul></p>
<p>Chris Wilson (1):
<ul>
<li>intel: Check for unsupported texture when finishing using as a render target</li>
</ul></p>
<p>Cyril Brulebois (1):
<ul>
<li>Point to bugs.freedesktop.org rather than bugzilla.freedesktop.org</li>
</ul></p>
<p>Dave Airlie (2):
<ul>
<li>radeon/r200: fix fbo-clearmipmap + gen-teximage</li>
<li>radeon: avoid segfault on 3D textures.</li>
</ul></p>
<p>Dimitry Andric (4):
<ul>
<li>mesa: s/movzx/movzbl/</li>
<li>mesa: s/movzxw/movzwl/ in read_rgba_span_x86.S</li>
<li>glapi: adding @ char before type specifier in glapi_x86.S</li>
<li>glapi: add @GOTPCREL relocation type</li>
</ul></p>
<p>Eric Anholt (11):
<ul>
<li>i965: Avoid double-negation of immediate values in the VS.</li>
<li>docs: Add a relnote for the Civ IV on i965.</li>
<li>i965/vs: When MOVing to produce ABS, strip negate of the operand.</li>
<li>glsl: Fix the lowering of variable array indexing to not lose write_masks.</li>
<li>intel: Make renderbuffer tiling choice match texture tiling choice.</li>
<li>glapi: Add entrypoints and enums for GL_ARB_ES2_compatibility.</li>
<li>mesa: Add extension enable bit for GL_ARB_ES2_compatibility.</li>
<li>mesa: Add actual support for glReleaseShaderCompiler from ES2.</li>
<li>mesa: Add support for glDepthRangef and glClearDepthf.</li>
<li>mesa: Add getters for ARB_ES2_compatibility MAX_*_VECTORS.</li>
<li>mesa: Add getter for GL_SHADER_COMPILER with ARB_ES2_compatibility.</li>
</ul></p>
<p>Ian Romanick (42):
<ul>
<li>docs: Add 7.9.1 md5sums</li>
<li>glsl: Support the 'invariant(all)' pragma</li>
<li>glcpp: Generate an error for division by zero</li>
<li>glsl: Add version_string containing properly formatted GLSL version</li>
<li>glsl &amp; glcpp: Refresh autogenerated lexer and parser files.</li>
<li>glsl: Disallow 'in' and 'out' on globals in GLSL 1.20</li>
<li>glsl: Track variable usage, use that to enforce semantics</li>
<li>glsl: Allow 'in' and 'out' when 'layout' is also available</li>
<li>docs: Initial set of release notes for 7.9.2</li>
<li>mesa: bump version to 7.9.2-devel</li>
<li>docs: Update 7.9.2 release notes</li>
<li>i965: Make OPCODE_KIL_NV do its work in a temp, not the null reg!</li>
<li>glsl: Refresh autogenerated lexer and parser files.</li>
<li>glsl: Don't assert when the value returned by a function has no rvalue</li>
<li>linker: Set sizes for non-global arrays as well</li>
<li>linker: Propagate max_array_access while linking functions</li>
<li>docs: Update 7.9.2 release notes</li>
<li>Use C-style system headers in C++ code to avoid issues with std:: namespace</li>
<li>mesa: glGetUniform only returns a single element of an array</li>
<li>linker: Generate link errors when ES shaders are missing stages</li>
<li>mesa: Fix error checks in GetVertexAttrib functions</li>
<li>docs: Update 7.9.2 release notes</li>
<li>mesa: Remove unsupported OES extensions</li>
<li>glapi: Regenerate for GL_ARB_ES2_compatibility.</li>
<li>mesa: Connect glGetShaderPrecisionFormat into the dispatch table</li>
<li>i965: Set correct values for range/precision of fragment shader types</li>
<li>i915: Set correct values for range/precision of fragment shader types</li>
<li>intel: Fix typeos from 3d028024 and 790ff232</li>
<li>glsl: Ensure that all GLSL versions are supported in the stand-alone compiler</li>
<li>glsl: Reject shader versions not supported by the implementation</li>
<li>mesa: Initial size for secondary color array is 3</li>
<li>glcpp: Regenerate files from recent cherry picks</li>
<li>glsl: Finish out the reduce/reduce error fixes</li>
<li>glsl: Regenerate compiler files from cherry picks</li>
<li>linker: Fix off-by-one error implicit array sizing</li>
<li>i915: Only mark a register as available if all components are written</li>
<li>i915: Calculate partial result to temp register first</li>
<li>i915: Force lowering of all types of indirect array accesses in the FS</li>
<li>docs: Update 7.9.2 release notes for recent cherry picks</li>
<li>docs: Clean up bug fixes list</li>
<li>intel: Remove driver date and related bits from renderer string</li>
<li>mesa: set version string to 7.9.2 (final)</li>
</ul></p>
<p>Jian Zhao (1):
<ul>
<li>mesa: fix an error in uniform arrays in row calculating.</li>
</ul></p>
<p>Julien Cristau (3):
<ul>
<li>glx: fix request lengths</li>
<li>glx: fix GLXChangeDrawableAttributesSGIX request</li>
<li>glx: fix length of GLXGetFBConfigsSGIX</li>
</ul></p>
<p>Keith Packard (1):
<ul>
<li>glsl: Eliminate reduce/reduce conflicts in glsl grammar</li>
</ul></p>
<p>Kenneth Graunke (12):
<ul>
<li>glsl: Expose a public glsl_type::void_type const pointer.</li>
<li>glsl: Don't bother unsetting a destructor that was never set.</li>
<li>glsl, i965: Remove unnecessary talloc includes.</li>
<li>glcpp: Remove use of talloc reference counting.</li>
<li>ralloc: Add a fake implementation of ralloc based on talloc.</li>
<li>Convert everything from the talloc API to the ralloc API.</li>
<li>ralloc: a new MIT-licensed recursive memory allocator.</li>
<li>Remove talloc from the make and automake build systems.</li>
<li>Remove talloc from the SCons build system.</li>
<li>Remove the talloc sources from the Mesa repository.</li>
<li>glsl: Fix use of uninitialized values in _mesa_glsl_parse_state ctor.</li>
<li>glsl: Use reralloc instead of plain realloc.</li>
</ul></p>
<p>Marek Olšák (3):
<ul>
<li>docs: fix messed up names with special characters in relnotes-7.9.1</li>
<li>mesa: fix texture3D mipmap generation for UNSIGNED_BYTE_3_3_2</li>
<li>st/dri: Track drawable context bindings</li>
</ul></p>
<p>Paulo Zanoni (1):
<ul>
<li>dri_util: fail driCreateNewScreen if InitScreen is NULL</li>
</ul></p>
<p>Sam Hocevar (2):
<ul>
<li>docs: add glsl info</li>
<li>docs: fix glsl_compiler name</li>
</ul></p>
<p>Vinson Lee (1):
<ul>
<li>ralloc: Add missing va_end following va_copy.</li>
</ul></p>
<p>nobled (1):
<ul>
<li>glx: Put null check before use</li>
</ul></p>
</p>
</body>
</html>

View File

@@ -8,7 +8,7 @@
<body bgcolor="#eeeeee">
<H1>Mesa 7.9 Release Notes / date TBD</H1>
<H1>Mesa 7.9 Release Notes / October 4, 2010</H1>
<p>
Mesa 7.9 is a new development release.
@@ -28,12 +28,12 @@ for DRI hardware acceleration.
<h2>MD5 checksums</h2>
<pre>
f1f01a7baec255f13e9468fb4b05922a MesaLib-7.9-rc1.tar.gz
7ffbda3b7056c60b8f87e3082d853af1 MesaLib-7.9-rc1.tar.bz2
9d4650df4e5b530178d6fde840f76664 MesaLib-7.9-rc1.zip
a81c2e7a0c7832e67c768d6f209f2c8f MesaGLUT-7.9-rc1.tar.gz
b4c1c2f0b47a07be10fa2dd42e6a63d7 MesaGLUT-7.9-rc1.tar.bz2
c9dd7419a19bcb24a1fe556ec2e78451 MesaGLUT-7.9-rc1.zip
ed65ab425b25895c7f473d0a5e6e64f8 MesaLib-7.9.tar.gz
82c740c49d572baa6da2b1a1eee90bca MesaLib-7.9.tar.bz2
cd2b6ecec759b0457475e94bbb38fedb MesaLib-7.9.zip
7b54af9fb9b1f6a1a65db2520f50848f MesaGLUT-7.9.tar.gz
20d07419d1929f833fdb36bced290ad5 MesaGLUT-7.9.tar.bz2
62a7edecd7c92675cd6029b05217eb0a MesaGLUT-7.9.zip
</pre>
@@ -42,16 +42,85 @@ c9dd7419a19bcb24a1fe556ec2e78451 MesaGLUT-7.9-rc1.zip
<li>New, improved GLSL compiler written by Intel.
See the <a href="shading.html"> Shading Language</a> page for
more information.
<li>GL_EXT_timer_query extension (i965 driver only)
<li>New, very experimental Gallium driver for R600-R700 Radeons.
<li>Support for AMD Evergreen-based Radeons (HD 5xxx)
<li>GL_EXT_timer_query extension (i965 driver and softpipe only)
<li>GL_EXT_framebuffer_multisample extension (intel drivers, MAX_SAMPLES = 1)
<li>GL_ARB_texture_swizzle extension (alias of GL_EXT_texture_swizzle)
<li>GL_ARB_draw_elements_base_vertex, GL_ARB_fragment_program_shadow
and GL_EXT_draw_buffers2 in Gallium drivers
<li>GL_ARB_draw_elements_base_vertex, GL_ARB_fragment_program_shadow,
GL_ARB_window_pos, GL_EXT_gpu_program_parameters,
GL_ATI_texture_env_combine3, GL_MESA_pack_invert, and GL_OES_EGL_image
extensions in Gallium drivers
<li>GL_ARB_depth_clamp and GL_NV_depth_clamp extensions (in nv50 and r600
Gallium drivers)
<li>GL_ARB_half_float_vertex extension (in nvfx, r300, r600, softpipe,
and llvmpipe Gallium drivers)
<li>GL_EXT_draw_buffers2 (in nv50, r600, softpipe, and llvmpipe Gallium
drivers)
<li>GL_EXT_texture_swizzle (in nvfx, r300, r600, softpipe, and llvmpipe
Gallium drivers)
<li>GL_ATI_texture_mirror_once (in nvfx, nv50, r300, r600, softpipe, and
llvmpipe Gallium drivers)
<li>GL_NV_conditional_render (in r300 Gallium driver)
<li>Initial "signs of life" support for Sandybridge hardware in i965 DRI
driver.
</ul>
<h2>Bug fixes</h2>
<p>This list is likely incomplete.</p>
<ul>
<li>Massive improvements to the Gallium driver for R300-R500 Radeons; this
driver is now considered stable for use as a DRI (OpenGL) driver.
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=10908">Bug 10908</a> - GLSL: gl_FogParamaters gl_Fog built-in uniform not functioning</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=13753">Bug 13753</a> - Numerous bugs in GLSL uniform handling</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=16854">Bug 16854</a> - GLSL function call at global scope causes SEGV</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=16856">Bug 16856</a> - GLSL indexing of unsized array results in assertion failure</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=18659">Bug 18659</a> - Crash in shader/slang/slang_codegen.c _slang_gen_function_call_name()</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=19089">Bug 19089</a> - [GLSL] glsl1/shadow2D() cases fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=22622">Bug 22622</a> - [GM965 GLSL] noise*() cause GPU lockup</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=23743">Bug 23743</a> - For loop from 0 to 0 not optimized out</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=24553">Bug 24553</a> - shader compilation times explode when using more () pairs</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=25664">Bug 25664</a> - [GLSL] re-declaring an empty array fails to compile</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=25769">Bug 25769</a> - [GLSL] "float" can be implicitly converted to "int"</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=25808">Bug 25808</a> - [GLSL] const variable is modified successfully</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=25826">Bug 25826</a> - [GLSL] declaring an unsized array then re-declaring with a size fails</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=25827">Bug 25827</a> - [GLSL] vector constructor accepts too many arguments successfully</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=25829">Bug 25829</a> - [GLSL] allowing non-void function without returning value</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=25830">Bug 25830</a> - [GLSL] allowing non-constant-expression as const declaration initializer</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=25877">Bug 25877</a> - [GLSL 1.10] implicit conversion from "int" to "float" should not be allowed</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=25878">Bug 25878</a> - [GLSL] sampler is converted to int successfully</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=25994">Bug 25994</a> - [GM45][GLSL] 'return' statement in vertex shader unsupported</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=25999">Bug 25999</a> - [GLSL] embedded structure constructor fails to compile</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=26000">Bug 26000</a> - [GLSL] allowing different parameter qualifier between the function definition and declaration</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=26001">Bug 26001</a> - [GLSL 1.10] constructing matrix from matrix succeeds</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=26224">Bug 26224</a> - [GLSL] Cannot get location of a uniform struct member</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=26990">Bug 26990</a> - [GLSL] variable declaration in "while" fails to compile</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=27004">Bug 27004</a> - [GLSL] allowing macro redefinition</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=27060">Bug 27060</a> - [965] piglit glsl-fs-raytrace failure due to lack of function calls.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=27216">Bug 27216</a> - Assignment with a function call in an if statement causes an assertion failure</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=27261">Bug 27261</a> - GLSL Compiler fails on the following vertex shader</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=27265">Bug 27265</a> - GLSL Compiler doesnt link the attached vertex shader</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=27388">Bug 27388</a> - [i965] piglit glsl-vs-arrays failure</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=27403">Bug 27403</a> - GLSL struct causing "Invalid src register file ..." error</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=27914">Bug 27914</a> - GLSL compiler uses MUL+ADD where it could use MAD</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28055">Bug 28055</a> - glsl-texcoord-array fails GLSL compilation</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28374">Bug 28374</a> - SIGSEGV shader/slang/slang_typeinfo.c:534</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28748">Bug 28748</a> - [i965] uninlined function calls support</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28833">Bug 28833</a> - piglit/shaders/glsl-texcoord-array fail</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28834">Bug 28834</a> - Add support for system fpclassify to GL_OES_query_matrix function for OpenBSD / NetBSD</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28837">Bug 28837</a> - varying vec4 index support</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28845">Bug 28845</a> - The GLU tesselator code has some warnings</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28889">Bug 28889</a> - [regression] wine game crash</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28894">Bug 28894</a> - slang build fails if absolute path contains spaces</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28913">Bug 28913</a> - [GLSL] allowing two version statements</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28931">Bug 28931</a> - Floating Point Exception in Warzone2100 Trunk version</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28966">Bug 28966</a> - [r300g] Dynamic branching 3 demo does not run</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28967">Bug 28967</a> - slang/slang_emit.c:350: storage_to_src_reg: Assertion `index &gt;= 0' failed.</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=29013">Bug 29013</a> - [r300g] translate_rgb_op: unknown opcode ILLEGAL OPCODE</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=29020">Bug 29020</a> - [r300g] Wine d3d9 tests hardlock</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=29910">Bug 29910</a> - Mesa advertises bogus GL_ARB_shading_language_120</li>
<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=30196">Bug 30196</a> - [GLSL] gl_TextureMatrix{Inverse,Transpose,InverseTranspose} unsupported</li>
</ul>

View File

@@ -13,7 +13,13 @@ The release notes summarize what's new or changed in each Mesa release.
</p>
<UL>
<LI><A HREF="relnotes-7.11.html">7.11 release notes</A>
<LI><A HREF="relnotes-7.10.1.html">7.10.1 release notes</A>
<LI><A HREF="relnotes-7.10.html">7.10 release notes</A>
<LI><A HREF="relnotes-7.9.2.html">7.9.2 release notes</A>
<LI><A HREF="relnotes-7.9.1.html">7.9.1 release notes</A>
<LI><A HREF="relnotes-7.9.html">7.9 release notes</A>
<LI><A HREF="relnotes-7.8.3.html">7.8.3 release notes</A>
<LI><A HREF="relnotes-7.8.2.html">7.8.2 release notes</A>
<LI><A HREF="relnotes-7.8.1.html">7.8.1 release notes</A>
<LI><A HREF="relnotes-7.8.html">7.8 release notes</A>

View File

@@ -167,7 +167,7 @@ Here's an example of using the compiler to compile a vertex shader and
emit GL_ARB_vertex_program-style instructions:
</p>
<pre>
src/glsl/glslcompiler --dump-ast myshader.vert
src/glsl/glsl_compiler --dump-ast myshader.vert
</pre>
Options include

View File

@@ -23,6 +23,7 @@ each directory.
<ul>
<li><b>docs</b> - EGL documentation
<li><b>drivers</b> - EGL drivers
<li><b>glsl</b> - the GLSL compiler
<li><b>main</b> - main EGL library implementation. This is where all
the EGL API functions are implemented, like eglCreateContext().
</ul>

1
doxygen/.gitignore vendored
View File

@@ -6,6 +6,7 @@ core
core_subset
gallium
glapi
glsl
main
math
math_subset

View File

@@ -11,6 +11,7 @@ FULL = \
math.doxy \
vbo.doxy \
glapi.doxy \
glsl.doxy \
shader.doxy \
swrast.doxy \
swrast_setup.doxy \

39
doxygen/glsl.doxy Normal file
View File

@@ -0,0 +1,39 @@
# Doxyfile 0.1
@INCLUDE = common.doxy
#---------------------------------------------------------------------------
# General configuration options
#---------------------------------------------------------------------------
PROJECT_NAME = "Mesa GLSL module"
#---------------------------------------------------------------------------
# configuration options related to the input files
#---------------------------------------------------------------------------
INPUT = ../src/glsl/
RECURSIVE = NO
EXCLUDE = ../src/glsl/glsl_lexer.cpp \
../src/glsl/glsl_lexer.h \
../src/glsl/glsl_parser.cpp \
../src/glsl/glsl_parser.h
EXCLUDE_PATTERNS =
#---------------------------------------------------------------------------
# configuration options related to the HTML output
#---------------------------------------------------------------------------
HTML_OUTPUT = glsl
#---------------------------------------------------------------------------
# Configuration options related to the preprocessor
#---------------------------------------------------------------------------
ENABLE_PREPROCESSING = YES
MACRO_EXPANSION = NO
EXPAND_ONLY_PREDEF = NO
SEARCH_INCLUDES = YES
INCLUDE_PATH =
INCLUDE_FILE_PATTERNS =
PREDEFINED =
EXPAND_AS_DEFINED =
SKIP_FUNCTION_MACROS = NO
#---------------------------------------------------------------------------
# Configuration::addtions related to external references
#---------------------------------------------------------------------------
TAGFILES =
GENERATE_TAGFILE = glsl.tag

View File

@@ -7,6 +7,7 @@
<div class="qindex">
<a class="qindex" href="../main/index.html">core</a> |
<a class="qindex" href="../glapi/index.html">glapi</a> |
<a class="qindex" href="../glsl/index.html">glsl</a> |
<a class="qindex" href="../vbo/index.html">vbo</a> |
<a class="qindex" href="../math/index.html">math</a> |
<a class="qindex" href="../shader/index.html">shader</a> |

View File

@@ -143,6 +143,20 @@ typedef EGLImageKHR (EGLAPIENTRYP PFNEGLCREATEDRMIMAGEMESA) (EGLDisplay dpy, con
typedef EGLBoolean (EGLAPIENTRYP PFNEGLEXPORTDRMIMAGEMESA) (EGLDisplay dpy, EGLImageKHR image, EGLint *name, EGLint *handle, EGLint *stride);
#endif
#ifndef EGL_WL_bind_wayland_display
#define EGL_WL_bind_wayland_display 1
#define EGL_WAYLAND_BUFFER_WL 0x31D5 /* eglCreateImageKHR target */
struct wl_display;
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglBindWaylandDisplayWL(EGLDisplay dpy, struct wl_display *display);
EGLAPI EGLBoolean EGLAPIENTRY eglUnbindWaylandDisplayWL(EGLDisplay dpy, struct wl_display *display);
#else
typedef EGLBoolean (EGLAPIENTRY PFNEGLBINDWAYLANDDISPLAYWL) (EGLDisplay dpy, struct wl_display *display);
typedef EGLBoolean (EGLAPIENTRY PFNEGLUNBINDWAYLANDDISPLAYWL) (EGLDisplay dpy, struct wl_display *display);
#endif
#endif
#if KHRONOS_SUPPORT_INT64 /* EGLTimeKHR requires 64-bit uint support */
#ifndef EGL_KHR_reusable_sync
#define EGL_KHR_reusable_sync 1
@@ -376,6 +390,20 @@ typedef EGLBoolean (EGLAPIENTRYP PFNEGLSWAPBUFFERSREGIONNOK) (EGLDisplay dpy, EG
#define EGL_Y_INVERTED_NOK 0x307F
#endif /* EGL_NOK_texture_from_pixmap */
#ifndef EGL_ANDROID_image_native_buffer
#define EGL_ANDROID_image_native_buffer 1
struct android_native_buffer_t;
#define EGL_NATIVE_BUFFER_ANDROID 0x3140 /* eglCreateImageKHR target */
#endif
#ifndef EGL_ANDROID_swap_rectangle
#define EGL_ANDROID_swap_rectangle 1
#ifdef EGL_EGLEXT_PROTOTYPES
EGLAPI EGLBoolean EGLAPIENTRY eglSetSwapRectangleANDROID (EGLDisplay dpy, EGLSurface draw, EGLint left, EGLint top, EGLint width, EGLint height);
#endif /* EGL_EGLEXT_PROTOTYPES */
typedef EGLBoolean (EGLAPIENTRYP PFNEGLSETSWAPRECTANGLEANDROIDPROC) (EGLDisplay dpy, EGLSurface draw, EGLint left, EGLint top, EGLint width, EGLint height);
#endif
#ifdef __cplusplus
}

View File

@@ -78,6 +78,21 @@ typedef int EGLNativeDisplayType;
typedef void *EGLNativeWindowType;
typedef void *EGLNativePixmapType;
#elif defined(WL_EGL_PLATFORM)
typedef struct wl_egl_display *EGLNativeDisplayType;
typedef struct wl_egl_pixmap *EGLNativePixmapType;
typedef struct wl_egl_window *EGLNativeWindowType;
#elif defined(ANDROID) /* Android */
struct android_native_window_t;
struct egl_native_pixmap_t;
typedef struct android_native_window_t* EGLNativeWindowType;
typedef struct egl_native_pixmap_t* EGLNativePixmapType;
typedef void* EGLNativeDisplayType;
#elif defined(__unix__) || defined(__unix)
#ifdef MESA_EGL_NO_X11_HEADERS

View File

@@ -31,6 +31,7 @@
#define glAccum MANGLE(Accum)
#define glActiveProgramEXT MANGLE(ActiveProgramEXT)
#define glActiveShaderProgram MANGLE(ActiveShaderProgram)
#define glActiveStencilFaceEXT MANGLE(ActiveStencilFaceEXT)
#define glActiveTextureARB MANGLE(ActiveTextureARB)
#define glActiveTexture MANGLE(ActiveTexture)
@@ -56,6 +57,7 @@
#define glBeginOcclusionQueryNV MANGLE(BeginOcclusionQueryNV)
#define glBeginPerfMonitorAMD MANGLE(BeginPerfMonitorAMD)
#define glBeginQueryARB MANGLE(BeginQueryARB)
#define glBeginQueryIndexed MANGLE(BeginQueryIndexed)
#define glBeginQuery MANGLE(BeginQuery)
#define glBeginTransformFeedbackEXT MANGLE(BeginTransformFeedbackEXT)
#define glBeginTransformFeedback MANGLE(BeginTransformFeedback)
@@ -75,22 +77,27 @@
#define glBindBufferRange MANGLE(BindBufferRange)
#define glBindBufferRangeNV MANGLE(BindBufferRangeNV)
#define glBindFragDataLocationEXT MANGLE(BindFragDataLocationEXT)
#define glBindFragDataLocationIndexed MANGLE(BindFragDataLocationIndexed)
#define glBindFragDataLocation MANGLE(BindFragDataLocation)
#define glBindFragmentShaderATI MANGLE(BindFragmentShaderATI)
#define glBindFramebufferEXT MANGLE(BindFramebufferEXT)
#define glBindFramebuffer MANGLE(BindFramebuffer)
#define glBindImageTextureEXT MANGLE(BindImageTextureEXT)
#define glBindLightParameterEXT MANGLE(BindLightParameterEXT)
#define glBindMaterialParameterEXT MANGLE(BindMaterialParameterEXT)
#define glBindMultiTextureEXT MANGLE(BindMultiTextureEXT)
#define glBindParameterEXT MANGLE(BindParameterEXT)
#define glBindProgramARB MANGLE(BindProgramARB)
#define glBindProgramNV MANGLE(BindProgramNV)
#define glBindProgramPipeline MANGLE(BindProgramPipeline)
#define glBindRenderbufferEXT MANGLE(BindRenderbufferEXT)
#define glBindRenderbuffer MANGLE(BindRenderbuffer)
#define glBindSampler MANGLE(BindSampler)
#define glBindTexGenParameterEXT MANGLE(BindTexGenParameterEXT)
#define glBindTextureEXT MANGLE(BindTextureEXT)
#define glBindTexture MANGLE(BindTexture)
#define glBindTextureUnitParameterEXT MANGLE(BindTextureUnitParameterEXT)
#define glBindTransformFeedback MANGLE(BindTransformFeedback)
#define glBindTransformFeedbackNV MANGLE(BindTransformFeedbackNV)
#define glBindVertexArrayAPPLE MANGLE(BindVertexArrayAPPLE)
#define glBindVertexArray MANGLE(BindVertexArray)
@@ -112,18 +119,22 @@
#define glBlendColorEXT MANGLE(BlendColorEXT)
#define glBlendColor MANGLE(BlendColor)
#define glBlendEquationEXT MANGLE(BlendEquationEXT)
#define glBlendEquationiARB MANGLE(BlendEquationiARB)
#define glBlendEquationi MANGLE(BlendEquationi)
#define glBlendEquationIndexedAMD MANGLE(BlendEquationIndexedAMD)
#define glBlendEquation MANGLE(BlendEquation)
#define glBlendEquationSeparateATI MANGLE(BlendEquationSeparateATI)
#define glBlendEquationSeparateEXT MANGLE(BlendEquationSeparateEXT)
#define glBlendEquationSeparateiARB MANGLE(BlendEquationSeparateiARB)
#define glBlendEquationSeparatei MANGLE(BlendEquationSeparatei)
#define glBlendEquationSeparateIndexedAMD MANGLE(BlendEquationSeparateIndexedAMD)
#define glBlendEquationSeparate MANGLE(BlendEquationSeparate)
#define glBlendFunciARB MANGLE(BlendFunciARB)
#define glBlendFunci MANGLE(BlendFunci)
#define glBlendFuncIndexedAMD MANGLE(BlendFuncIndexedAMD)
#define glBlendFunc MANGLE(BlendFunc)
#define glBlendFuncSeparateEXT MANGLE(BlendFuncSeparateEXT)
#define glBlendFuncSeparateiARB MANGLE(BlendFuncSeparateiARB)
#define glBlendFuncSeparatei MANGLE(BlendFuncSeparatei)
#define glBlendFuncSeparateIndexedAMD MANGLE(BlendFuncSeparateIndexedAMD)
#define glBlendFuncSeparateINGR MANGLE(BlendFuncSeparateINGR)
@@ -153,6 +164,7 @@
#define glClearColor MANGLE(ClearColor)
#define glClearDebugLogMESA MANGLE(ClearDebugLogMESA)
#define glClearDepthdNV MANGLE(ClearDepthdNV)
#define glClearDepthf MANGLE(ClearDepthf)
#define glClearDepth MANGLE(ClearDepth)
#define glClearIndex MANGLE(ClearIndex)
#define glClear MANGLE(Clear)
@@ -215,6 +227,10 @@
#define glColorMaskIndexedEXT MANGLE(ColorMaskIndexedEXT)
#define glColorMask MANGLE(ColorMask)
#define glColorMaterial MANGLE(ColorMaterial)
#define glColorP3ui MANGLE(ColorP3ui)
#define glColorP3uiv MANGLE(ColorP3uiv)
#define glColorP4ui MANGLE(ColorP4ui)
#define glColorP4uiv MANGLE(ColorP4uiv)
#define glColorPointerEXT MANGLE(ColorPointerEXT)
#define glColorPointerListIBM MANGLE(ColorPointerListIBM)
#define glColorPointer MANGLE(ColorPointer)
@@ -236,6 +252,7 @@
#define glCombinerParameterivNV MANGLE(CombinerParameterivNV)
#define glCombinerStageParameterfvNV MANGLE(CombinerStageParameterfvNV)
#define glCompileShaderARB MANGLE(CompileShaderARB)
#define glCompileShaderIncludeARB MANGLE(CompileShaderIncludeARB)
#define glCompileShader MANGLE(CompileShader)
#define glCompressedMultiTexImage1DEXT MANGLE(CompressedMultiTexImage1DEXT)
#define glCompressedMultiTexImage2DEXT MANGLE(CompressedMultiTexImage2DEXT)
@@ -310,10 +327,18 @@
#define glCreateShader MANGLE(CreateShader)
#define glCreateShaderObjectARB MANGLE(CreateShaderObjectARB)
#define glCreateShaderProgramEXT MANGLE(CreateShaderProgramEXT)
#define glCreateShaderProgramv MANGLE(CreateShaderProgramv)
#define glCreateSyncFromCLeventARB MANGLE(CreateSyncFromCLeventARB)
#define glCullFace MANGLE(CullFace)
#define glCullParameterdvEXT MANGLE(CullParameterdvEXT)
#define glCullParameterfvEXT MANGLE(CullParameterfvEXT)
#define glCurrentPaletteMatrixARB MANGLE(CurrentPaletteMatrixARB)
#define glDebugMessageCallbackAMD MANGLE(DebugMessageCallbackAMD)
#define glDebugMessageCallbackARB MANGLE(DebugMessageCallbackARB)
#define glDebugMessageControlARB MANGLE(DebugMessageControlARB)
#define glDebugMessageEnableAMD MANGLE(DebugMessageEnableAMD)
#define glDebugMessageInsertAMD MANGLE(DebugMessageInsertAMD)
#define glDebugMessageInsertARB MANGLE(DebugMessageInsertARB)
#define glDeformationMap3dSGIX MANGLE(DeformationMap3dSGIX)
#define glDeformationMap3fSGIX MANGLE(DeformationMap3fSGIX)
#define glDeformSGIX MANGLE(DeformSGIX)
@@ -326,20 +351,25 @@
#define glDeleteFramebuffersEXT MANGLE(DeleteFramebuffersEXT)
#define glDeleteFramebuffers MANGLE(DeleteFramebuffers)
#define glDeleteLists MANGLE(DeleteLists)
#define glDeleteNamedStringARB MANGLE(DeleteNamedStringARB)
#define glDeleteNamesAMD MANGLE(DeleteNamesAMD)
#define glDeleteObjectARB MANGLE(DeleteObjectARB)
#define glDeleteOcclusionQueriesNV MANGLE(DeleteOcclusionQueriesNV)
#define glDeletePerfMonitorsAMD MANGLE(DeletePerfMonitorsAMD)
#define glDeleteProgram MANGLE(DeleteProgram)
#define glDeleteProgramPipelines MANGLE(DeleteProgramPipelines)
#define glDeleteProgramsARB MANGLE(DeleteProgramsARB)
#define glDeleteProgramsNV MANGLE(DeleteProgramsNV)
#define glDeleteQueriesARB MANGLE(DeleteQueriesARB)
#define glDeleteQueries MANGLE(DeleteQueries)
#define glDeleteRenderbuffersEXT MANGLE(DeleteRenderbuffersEXT)
#define glDeleteRenderbuffers MANGLE(DeleteRenderbuffers)
#define glDeleteSamplers MANGLE(DeleteSamplers)
#define glDeleteShader MANGLE(DeleteShader)
#define glDeleteSync MANGLE(DeleteSync)
#define glDeleteTexturesEXT MANGLE(DeleteTexturesEXT)
#define glDeleteTextures MANGLE(DeleteTextures)
#define glDeleteTransformFeedbacks MANGLE(DeleteTransformFeedbacks)
#define glDeleteTransformFeedbacksNV MANGLE(DeleteTransformFeedbacksNV)
#define glDeleteVertexArraysAPPLE MANGLE(DeleteVertexArraysAPPLE)
#define glDeleteVertexArrays MANGLE(DeleteVertexArrays)
@@ -348,7 +378,10 @@
#define glDepthBoundsEXT MANGLE(DepthBoundsEXT)
#define glDepthFunc MANGLE(DepthFunc)
#define glDepthMask MANGLE(DepthMask)
#define glDepthRangeArrayv MANGLE(DepthRangeArrayv)
#define glDepthRangedNV MANGLE(DepthRangedNV)
#define glDepthRangef MANGLE(DepthRangef)
#define glDepthRangeIndexed MANGLE(DepthRangeIndexed)
#define glDepthRange MANGLE(DepthRange)
#define glDetachObjectARB MANGLE(DetachObjectARB)
#define glDetachShader MANGLE(DetachShader)
@@ -363,6 +396,7 @@
#define glDisableVertexAttribArrayARB MANGLE(DisableVertexAttribArrayARB)
#define glDisableVertexAttribArray MANGLE(DisableVertexAttribArray)
#define glDrawArraysEXT MANGLE(DrawArraysEXT)
#define glDrawArraysIndirect MANGLE(DrawArraysIndirect)
#define glDrawArraysInstancedARB MANGLE(DrawArraysInstancedARB)
#define glDrawArraysInstancedEXT MANGLE(DrawArraysInstancedEXT)
#define glDrawArraysInstanced MANGLE(DrawArraysInstanced)
@@ -374,6 +408,7 @@
#define glDrawElementArrayAPPLE MANGLE(DrawElementArrayAPPLE)
#define glDrawElementArrayATI MANGLE(DrawElementArrayATI)
#define glDrawElementsBaseVertex MANGLE(DrawElementsBaseVertex)
#define glDrawElementsIndirect MANGLE(DrawElementsIndirect)
#define glDrawElementsInstancedARB MANGLE(DrawElementsInstancedARB)
#define glDrawElementsInstancedBaseVertex MANGLE(DrawElementsInstancedBaseVertex)
#define glDrawElementsInstancedEXT MANGLE(DrawElementsInstancedEXT)
@@ -386,7 +421,9 @@
#define glDrawRangeElementsBaseVertex MANGLE(DrawRangeElementsBaseVertex)
#define glDrawRangeElementsEXT MANGLE(DrawRangeElementsEXT)
#define glDrawRangeElements MANGLE(DrawRangeElements)
#define glDrawTransformFeedback MANGLE(DrawTransformFeedback)
#define glDrawTransformFeedbackNV MANGLE(DrawTransformFeedbackNV)
#define glDrawTransformFeedbackStream MANGLE(DrawTransformFeedbackStream)
#define glEdgeFlagFormatNV MANGLE(EdgeFlagFormatNV)
#define glEdgeFlag MANGLE(EdgeFlag)
#define glEdgeFlagPointerEXT MANGLE(EdgeFlagPointerEXT)
@@ -414,6 +451,7 @@
#define glEndOcclusionQueryNV MANGLE(EndOcclusionQueryNV)
#define glEndPerfMonitorAMD MANGLE(EndPerfMonitorAMD)
#define glEndQueryARB MANGLE(EndQueryARB)
#define glEndQueryIndexed MANGLE(EndQueryIndexed)
#define glEndQuery MANGLE(EndQuery)
#define glEndTransformFeedbackEXT MANGLE(EndTransformFeedbackEXT)
#define glEndTransformFeedback MANGLE(EndTransformFeedback)
@@ -447,6 +485,7 @@
#define glFlush MANGLE(Flush)
#define glFlushMappedBufferRangeAPPLE MANGLE(FlushMappedBufferRangeAPPLE)
#define glFlushMappedBufferRange MANGLE(FlushMappedBufferRange)
#define glFlushMappedNamedBufferRangeEXT MANGLE(FlushMappedNamedBufferRangeEXT)
#define glFlushPixelDataRangeNV MANGLE(FlushPixelDataRangeNV)
#define glFlushRasterSGIX MANGLE(FlushRasterSGIX)
#define glFlushVertexArrayRangeAPPLE MANGLE(FlushVertexArrayRangeAPPLE)
@@ -498,7 +537,6 @@
#define glFramebufferTextureEXT MANGLE(FramebufferTextureEXT)
#define glFramebufferTextureFaceARB MANGLE(FramebufferTextureFaceARB)
#define glFramebufferTextureFaceEXT MANGLE(FramebufferTextureFaceEXT)
#define glFramebufferTextureFace MANGLE(FramebufferTextureFace)
#define glFramebufferTextureLayerARB MANGLE(FramebufferTextureLayerARB)
#define glFramebufferTextureLayerEXT MANGLE(FramebufferTextureLayerEXT)
#define glFramebufferTextureLayer MANGLE(FramebufferTextureLayer)
@@ -521,23 +559,30 @@
#define glGenFramebuffersEXT MANGLE(GenFramebuffersEXT)
#define glGenFramebuffers MANGLE(GenFramebuffers)
#define glGenLists MANGLE(GenLists)
#define glGenNamesAMD MANGLE(GenNamesAMD)
#define glGenOcclusionQueriesNV MANGLE(GenOcclusionQueriesNV)
#define glGenPerfMonitorsAMD MANGLE(GenPerfMonitorsAMD)
#define glGenProgramPipelines MANGLE(GenProgramPipelines)
#define glGenProgramsARB MANGLE(GenProgramsARB)
#define glGenProgramsNV MANGLE(GenProgramsNV)
#define glGenQueriesARB MANGLE(GenQueriesARB)
#define glGenQueries MANGLE(GenQueries)
#define glGenRenderbuffersEXT MANGLE(GenRenderbuffersEXT)
#define glGenRenderbuffers MANGLE(GenRenderbuffers)
#define glGenSamplers MANGLE(GenSamplers)
#define glGenSymbolsEXT MANGLE(GenSymbolsEXT)
#define glGenTexturesEXT MANGLE(GenTexturesEXT)
#define glGenTextures MANGLE(GenTextures)
#define glGenTransformFeedbacks MANGLE(GenTransformFeedbacks)
#define glGenTransformFeedbacksNV MANGLE(GenTransformFeedbacksNV)
#define glGenVertexArraysAPPLE MANGLE(GenVertexArraysAPPLE)
#define glGenVertexArrays MANGLE(GenVertexArrays)
#define glGenVertexShadersEXT MANGLE(GenVertexShadersEXT)
#define glGetActiveAttribARB MANGLE(GetActiveAttribARB)
#define glGetActiveAttrib MANGLE(GetActiveAttrib)
#define glGetActiveSubroutineName MANGLE(GetActiveSubroutineName)
#define glGetActiveSubroutineUniformiv MANGLE(GetActiveSubroutineUniformiv)
#define glGetActiveSubroutineUniformName MANGLE(GetActiveSubroutineUniformName)
#define glGetActiveUniformARB MANGLE(GetActiveUniformARB)
#define glGetActiveUniformBlockiv MANGLE(GetActiveUniformBlockiv)
#define glGetActiveUniformBlockName MANGLE(GetActiveUniformBlockName)
@@ -589,16 +634,21 @@
#define glGetConvolutionParameteriv MANGLE(GetConvolutionParameteriv)
#define glGetDebugLogLengthMESA MANGLE(GetDebugLogLengthMESA)
#define glGetDebugLogMESA MANGLE(GetDebugLogMESA)
#define glGetDebugMessageLogAMD MANGLE(GetDebugMessageLogAMD)
#define glGetDebugMessageLogARB MANGLE(GetDebugMessageLogARB)
#define glGetDetailTexFuncSGIS MANGLE(GetDetailTexFuncSGIS)
#define glGetDoubleIndexedvEXT MANGLE(GetDoubleIndexedvEXT)
#define glGetDoublei_v MANGLE(GetDoublei_v)
#define glGetDoublev MANGLE(GetDoublev)
#define glGetError MANGLE(GetError)
#define glGetFenceivNV MANGLE(GetFenceivNV)
#define glGetFinalCombinerInputParameterfvNV MANGLE(GetFinalCombinerInputParameterfvNV)
#define glGetFinalCombinerInputParameterivNV MANGLE(GetFinalCombinerInputParameterivNV)
#define glGetFloatIndexedvEXT MANGLE(GetFloatIndexedvEXT)
#define glGetFloati_v MANGLE(GetFloati_v)
#define glGetFloatv MANGLE(GetFloatv)
#define glGetFogFuncSGIS MANGLE(GetFogFuncSGIS)
#define glGetFragDataIndex MANGLE(GetFragDataIndex)
#define glGetFragDataLocationEXT MANGLE(GetFragDataLocationEXT)
#define glGetFragDataLocation MANGLE(GetFragDataLocation)
#define glGetFragmentLightfvSGIX MANGLE(GetFragmentLightfvSGIX)
@@ -608,6 +658,7 @@
#define glGetFramebufferAttachmentParameterivEXT MANGLE(GetFramebufferAttachmentParameterivEXT)
#define glGetFramebufferAttachmentParameteriv MANGLE(GetFramebufferAttachmentParameteriv)
#define glGetFramebufferParameterivEXT MANGLE(GetFramebufferParameterivEXT)
#define glGetGraphicsResetStatusARB MANGLE(GetGraphicsResetStatusARB)
#define glGetHandleARB MANGLE(GetHandleARB)
#define glGetHistogramEXT MANGLE(GetHistogramEXT)
#define glGetHistogram MANGLE(GetHistogram)
@@ -678,6 +729,26 @@
#define glGetNamedProgramLocalParameterIuivEXT MANGLE(GetNamedProgramLocalParameterIuivEXT)
#define glGetNamedProgramStringEXT MANGLE(GetNamedProgramStringEXT)
#define glGetNamedRenderbufferParameterivEXT MANGLE(GetNamedRenderbufferParameterivEXT)
#define glGetNamedStringARB MANGLE(GetNamedStringARB)
#define glGetNamedStringivARB MANGLE(GetNamedStringivARB)
#define glGetnColorTableARB MANGLE(GetnColorTableARB)
#define glGetnCompressedTexImageARB MANGLE(GetnCompressedTexImageARB)
#define glGetnConvolutionFilterARB MANGLE(GetnConvolutionFilterARB)
#define glGetnHistogramARB MANGLE(GetnHistogramARB)
#define glGetnMapdvARB MANGLE(GetnMapdvARB)
#define glGetnMapfvARB MANGLE(GetnMapfvARB)
#define glGetnMapivARB MANGLE(GetnMapivARB)
#define glGetnMinmaxARB MANGLE(GetnMinmaxARB)
#define glGetnPixelMapfvARB MANGLE(GetnPixelMapfvARB)
#define glGetnPixelMapuivARB MANGLE(GetnPixelMapuivARB)
#define glGetnPixelMapusvARB MANGLE(GetnPixelMapusvARB)
#define glGetnPolygonStippleARB MANGLE(GetnPolygonStippleARB)
#define glGetnSeparableFilterARB MANGLE(GetnSeparableFilterARB)
#define glGetnTexImageARB MANGLE(GetnTexImageARB)
#define glGetnUniformdvARB MANGLE(GetnUniformdvARB)
#define glGetnUniformfvARB MANGLE(GetnUniformfvARB)
#define glGetnUniformivARB MANGLE(GetnUniformivARB)
#define glGetnUniformuivARB MANGLE(GetnUniformuivARB)
#define glGetObjectBufferfvATI MANGLE(GetObjectBufferfvATI)
#define glGetObjectBufferivATI MANGLE(GetObjectBufferivATI)
#define glGetObjectParameterfvARB MANGLE(GetObjectParameterfvARB)
@@ -700,6 +771,7 @@
#define glGetPointervEXT MANGLE(GetPointervEXT)
#define glGetPointerv MANGLE(GetPointerv)
#define glGetPolygonStipple MANGLE(GetPolygonStipple)
#define glGetProgramBinary MANGLE(GetProgramBinary)
#define glGetProgramEnvParameterdvARB MANGLE(GetProgramEnvParameterdvARB)
#define glGetProgramEnvParameterfvARB MANGLE(GetProgramEnvParameterfvARB)
#define glGetProgramEnvParameterIivNV MANGLE(GetProgramEnvParameterIivNV)
@@ -716,28 +788,42 @@
#define glGetProgramNamedParameterfvNV MANGLE(GetProgramNamedParameterfvNV)
#define glGetProgramParameterdvNV MANGLE(GetProgramParameterdvNV)
#define glGetProgramParameterfvNV MANGLE(GetProgramParameterfvNV)
#define glGetProgramPipelineInfoLog MANGLE(GetProgramPipelineInfoLog)
#define glGetProgramPipelineiv MANGLE(GetProgramPipelineiv)
#define glGetProgramRegisterfvMESA MANGLE(GetProgramRegisterfvMESA)
#define glGetProgramStageiv MANGLE(GetProgramStageiv)
#define glGetProgramStringARB MANGLE(GetProgramStringARB)
#define glGetProgramStringNV MANGLE(GetProgramStringNV)
#define glGetProgramSubroutineParameteruivNV MANGLE(GetProgramSubroutineParameteruivNV)
#define glGetQueryIndexediv MANGLE(GetQueryIndexediv)
#define glGetQueryivARB MANGLE(GetQueryivARB)
#define glGetQueryiv MANGLE(GetQueryiv)
#define glGetQueryObjecti64vEXT MANGLE(GetQueryObjecti64vEXT)
#define glGetQueryObjecti64v MANGLE(GetQueryObjecti64v)
#define glGetQueryObjectivARB MANGLE(GetQueryObjectivARB)
#define glGetQueryObjectiv MANGLE(GetQueryObjectiv)
#define glGetQueryObjectui64vEXT MANGLE(GetQueryObjectui64vEXT)
#define glGetQueryObjectui64v MANGLE(GetQueryObjectui64v)
#define glGetQueryObjectuivARB MANGLE(GetQueryObjectuivARB)
#define glGetQueryObjectuiv MANGLE(GetQueryObjectuiv)
#define glGetRenderbufferParameterivEXT MANGLE(GetRenderbufferParameterivEXT)
#define glGetRenderbufferParameteriv MANGLE(GetRenderbufferParameteriv)
#define glGetSamplerParameterfv MANGLE(GetSamplerParameterfv)
#define glGetSamplerParameterIiv MANGLE(GetSamplerParameterIiv)
#define glGetSamplerParameterIuiv MANGLE(GetSamplerParameterIuiv)
#define glGetSamplerParameteriv MANGLE(GetSamplerParameteriv)
#define glGetSeparableFilterEXT MANGLE(GetSeparableFilterEXT)
#define glGetSeparableFilter MANGLE(GetSeparableFilter)
#define glGetShaderInfoLog MANGLE(GetShaderInfoLog)
#define glGetShaderiv MANGLE(GetShaderiv)
#define glGetShaderPrecisionFormat MANGLE(GetShaderPrecisionFormat)
#define glGetShaderSourceARB MANGLE(GetShaderSourceARB)
#define glGetShaderSource MANGLE(GetShaderSource)
#define glGetSharpenTexFuncSGIS MANGLE(GetSharpenTexFuncSGIS)
#define glGetStringi MANGLE(GetStringi)
#define glGetString MANGLE(GetString)
#define glGetSubroutineIndex MANGLE(GetSubroutineIndex)
#define glGetSubroutineUniformLocation MANGLE(GetSubroutineUniformLocation)
#define glGetSynciv MANGLE(GetSynciv)
#define glGetTexBumpParameterfvATI MANGLE(GetTexBumpParameterfvATI)
#define glGetTexBumpParameterivATI MANGLE(GetTexBumpParameterivATI)
@@ -770,14 +856,17 @@
#define glGetTransformFeedbackVaryingNV MANGLE(GetTransformFeedbackVaryingNV)
#define glGetUniformBlockIndex MANGLE(GetUniformBlockIndex)
#define glGetUniformBufferSizeEXT MANGLE(GetUniformBufferSizeEXT)
#define glGetUniformdv MANGLE(GetUniformdv)
#define glGetUniformfvARB MANGLE(GetUniformfvARB)
#define glGetUniformfv MANGLE(GetUniformfv)
#define glGetUniformi64vNV MANGLE(GetUniformi64vNV)
#define glGetUniformIndices MANGLE(GetUniformIndices)
#define glGetUniformivARB MANGLE(GetUniformivARB)
#define glGetUniformiv MANGLE(GetUniformiv)
#define glGetUniformLocationARB MANGLE(GetUniformLocationARB)
#define glGetUniformLocation MANGLE(GetUniformLocation)
#define glGetUniformOffsetEXT MANGLE(GetUniformOffsetEXT)
#define glGetUniformSubroutineuiv MANGLE(GetUniformSubroutineuiv)
#define glGetUniformui64vNV MANGLE(GetUniformui64vNV)
#define glGetUniformuivEXT MANGLE(GetUniformuivEXT)
#define glGetUniformuiv MANGLE(GetUniformuiv)
@@ -803,6 +892,10 @@
#define glGetVertexAttribivARB MANGLE(GetVertexAttribivARB)
#define glGetVertexAttribiv MANGLE(GetVertexAttribiv)
#define glGetVertexAttribivNV MANGLE(GetVertexAttribivNV)
#define glGetVertexAttribLdvEXT MANGLE(GetVertexAttribLdvEXT)
#define glGetVertexAttribLdv MANGLE(GetVertexAttribLdv)
#define glGetVertexAttribLi64vNV MANGLE(GetVertexAttribLi64vNV)
#define glGetVertexAttribLui64vNV MANGLE(GetVertexAttribLui64vNV)
#define glGetVertexAttribPointervARB MANGLE(GetVertexAttribPointervARB)
#define glGetVertexAttribPointerv MANGLE(GetVertexAttribPointerv)
#define glGetVertexAttribPointervNV MANGLE(GetVertexAttribPointervNV)
@@ -864,20 +957,25 @@
#define glIsFramebufferEXT MANGLE(IsFramebufferEXT)
#define glIsFramebuffer MANGLE(IsFramebuffer)
#define glIsList MANGLE(IsList)
#define glIsNameAMD MANGLE(IsNameAMD)
#define glIsNamedBufferResidentNV MANGLE(IsNamedBufferResidentNV)
#define glIsNamedStringARB MANGLE(IsNamedStringARB)
#define glIsObjectBufferATI MANGLE(IsObjectBufferATI)
#define glIsOcclusionQueryNV MANGLE(IsOcclusionQueryNV)
#define glIsProgramARB MANGLE(IsProgramARB)
#define glIsProgram MANGLE(IsProgram)
#define glIsProgramNV MANGLE(IsProgramNV)
#define glIsProgramPipeline MANGLE(IsProgramPipeline)
#define glIsQueryARB MANGLE(IsQueryARB)
#define glIsQuery MANGLE(IsQuery)
#define glIsRenderbufferEXT MANGLE(IsRenderbufferEXT)
#define glIsRenderbuffer MANGLE(IsRenderbuffer)
#define glIsSampler MANGLE(IsSampler)
#define glIsShader MANGLE(IsShader)
#define glIsSync MANGLE(IsSync)
#define glIsTextureEXT MANGLE(IsTextureEXT)
#define glIsTexture MANGLE(IsTexture)
#define glIsTransformFeedback MANGLE(IsTransformFeedback)
#define glIsTransformFeedbackNV MANGLE(IsTransformFeedbackNV)
#define glIsVariantEnabledEXT MANGLE(IsVariantEnabledEXT)
#define glIsVertexArrayAPPLE MANGLE(IsVertexArrayAPPLE)
@@ -915,6 +1013,8 @@
#define glLogicOp MANGLE(LogicOp)
#define glMakeBufferNonResidentNV MANGLE(MakeBufferNonResidentNV)
#define glMakeBufferResidentNV MANGLE(MakeBufferResidentNV)
#define glMakeNamedBufferNonResidentNV MANGLE(MakeNamedBufferNonResidentNV)
#define glMakeNamedBufferResidentNV MANGLE(MakeNamedBufferResidentNV)
#define glMap1d MANGLE(Map1d)
#define glMap1f MANGLE(Map1f)
#define glMap2d MANGLE(Map2d)
@@ -928,6 +1028,7 @@
#define glMapGrid2d MANGLE(MapGrid2d)
#define glMapGrid2f MANGLE(MapGrid2f)
#define glMapNamedBufferEXT MANGLE(MapNamedBufferEXT)
#define glMapNamedBufferRangeEXT MANGLE(MapNamedBufferRangeEXT)
#define glMapObjectBufferATI MANGLE(MapObjectBufferATI)
#define glMapParameterfvNV MANGLE(MapParameterfvNV)
#define glMapParameterivNV MANGLE(MapParameterivNV)
@@ -963,8 +1064,10 @@
#define glMatrixScalefEXT MANGLE(MatrixScalefEXT)
#define glMatrixTranslatedEXT MANGLE(MatrixTranslatedEXT)
#define glMatrixTranslatefEXT MANGLE(MatrixTranslatefEXT)
#define glMemoryBarrierEXT MANGLE(MemoryBarrierEXT)
#define glMinmaxEXT MANGLE(MinmaxEXT)
#define glMinmax MANGLE(Minmax)
#define glMinSampleShadingARB MANGLE(MinSampleShadingARB)
#define glMinSampleShading MANGLE(MinSampleShading)
#define glMultiDrawArraysEXT MANGLE(MultiDrawArraysEXT)
#define glMultiDrawArrays MANGLE(MultiDrawArrays)
@@ -1048,6 +1151,14 @@
#define glMultiTexCoord4s MANGLE(MultiTexCoord4s)
#define glMultiTexCoord4svARB MANGLE(MultiTexCoord4svARB)
#define glMultiTexCoord4sv MANGLE(MultiTexCoord4sv)
#define glMultiTexCoordP1ui MANGLE(MultiTexCoordP1ui)
#define glMultiTexCoordP1uiv MANGLE(MultiTexCoordP1uiv)
#define glMultiTexCoordP2ui MANGLE(MultiTexCoordP2ui)
#define glMultiTexCoordP2uiv MANGLE(MultiTexCoordP2uiv)
#define glMultiTexCoordP3ui MANGLE(MultiTexCoordP3ui)
#define glMultiTexCoordP3uiv MANGLE(MultiTexCoordP3uiv)
#define glMultiTexCoordP4ui MANGLE(MultiTexCoordP4ui)
#define glMultiTexCoordP4uiv MANGLE(MultiTexCoordP4uiv)
#define glMultiTexCoordPointerEXT MANGLE(MultiTexCoordPointerEXT)
#define glMultiTexEnvfEXT MANGLE(MultiTexEnvfEXT)
#define glMultiTexEnvfvEXT MANGLE(MultiTexEnvfvEXT)
@@ -1080,6 +1191,7 @@
#define glMultTransposeMatrixf MANGLE(MultTransposeMatrixf)
#define glNamedBufferDataEXT MANGLE(NamedBufferDataEXT)
#define glNamedBufferSubDataEXT MANGLE(NamedBufferSubDataEXT)
#define glNamedCopyBufferSubDataEXT MANGLE(NamedCopyBufferSubDataEXT)
#define glNamedFramebufferRenderbufferEXT MANGLE(NamedFramebufferRenderbufferEXT)
#define glNamedFramebufferTexture1DEXT MANGLE(NamedFramebufferTexture1DEXT)
#define glNamedFramebufferTexture2DEXT MANGLE(NamedFramebufferTexture2DEXT)
@@ -1087,8 +1199,6 @@
#define glNamedFramebufferTextureEXT MANGLE(NamedFramebufferTextureEXT)
#define glNamedFramebufferTextureFaceEXT MANGLE(NamedFramebufferTextureFaceEXT)
#define glNamedFramebufferTextureLayerEXT MANGLE(NamedFramebufferTextureLayerEXT)
#define glNamedMakeBufferNonResidentNV MANGLE(NamedMakeBufferNonResidentNV)
#define glNamedMakeBufferResidentNV MANGLE(NamedMakeBufferResidentNV)
#define glNamedProgramLocalParameter4dEXT MANGLE(NamedProgramLocalParameter4dEXT)
#define glNamedProgramLocalParameter4dvEXT MANGLE(NamedProgramLocalParameter4dvEXT)
#define glNamedProgramLocalParameter4fEXT MANGLE(NamedProgramLocalParameter4fEXT)
@@ -1104,6 +1214,7 @@
#define glNamedRenderbufferStorageEXT MANGLE(NamedRenderbufferStorageEXT)
#define glNamedRenderbufferStorageMultisampleCoverageEXT MANGLE(NamedRenderbufferStorageMultisampleCoverageEXT)
#define glNamedRenderbufferStorageMultisampleEXT MANGLE(NamedRenderbufferStorageMultisampleEXT)
#define glNamedStringARB MANGLE(NamedStringARB)
#define glNewList MANGLE(NewList)
#define glNewObjectBufferATI MANGLE(NewObjectBufferATI)
#define glNormal3b MANGLE(Normal3b)
@@ -1121,6 +1232,8 @@
#define glNormal3s MANGLE(Normal3s)
#define glNormal3sv MANGLE(Normal3sv)
#define glNormalFormatNV MANGLE(NormalFormatNV)
#define glNormalP3ui MANGLE(NormalP3ui)
#define glNormalP3uiv MANGLE(NormalP3uiv)
#define glNormalPointerEXT MANGLE(NormalPointerEXT)
#define glNormalPointerListIBM MANGLE(NormalPointerListIBM)
#define glNormalPointer MANGLE(NormalPointer)
@@ -1140,6 +1253,9 @@
#define glOrtho MANGLE(Ortho)
#define glPassTexCoordATI MANGLE(PassTexCoordATI)
#define glPassThrough MANGLE(PassThrough)
#define glPatchParameterfv MANGLE(PatchParameterfv)
#define glPatchParameteri MANGLE(PatchParameteri)
#define glPauseTransformFeedback MANGLE(PauseTransformFeedback)
#define glPauseTransformFeedbackNV MANGLE(PauseTransformFeedbackNV)
#define glPixelDataRangeNV MANGLE(PixelDataRangeNV)
#define glPixelMapfv MANGLE(PixelMapfv)
@@ -1191,6 +1307,7 @@
#define glPrimitiveRestartNV MANGLE(PrimitiveRestartNV)
#define glPrioritizeTexturesEXT MANGLE(PrioritizeTexturesEXT)
#define glPrioritizeTextures MANGLE(PrioritizeTextures)
#define glProgramBinary MANGLE(ProgramBinary)
#define glProgramBufferParametersfvNV MANGLE(ProgramBufferParametersfvNV)
#define glProgramBufferParametersIivNV MANGLE(ProgramBufferParametersIivNV)
#define glProgramBufferParametersIuivNV MANGLE(ProgramBufferParametersIuivNV)
@@ -1231,39 +1348,123 @@
#define glProgramParameters4dvNV MANGLE(ProgramParameters4dvNV)
#define glProgramParameters4fvNV MANGLE(ProgramParameters4fvNV)
#define glProgramStringARB MANGLE(ProgramStringARB)
#define glProgramSubroutineParametersuivNV MANGLE(ProgramSubroutineParametersuivNV)
#define glProgramUniform1dEXT MANGLE(ProgramUniform1dEXT)
#define glProgramUniform1d MANGLE(ProgramUniform1d)
#define glProgramUniform1dvEXT MANGLE(ProgramUniform1dvEXT)
#define glProgramUniform1dv MANGLE(ProgramUniform1dv)
#define glProgramUniform1fEXT MANGLE(ProgramUniform1fEXT)
#define glProgramUniform1f MANGLE(ProgramUniform1f)
#define glProgramUniform1fvEXT MANGLE(ProgramUniform1fvEXT)
#define glProgramUniform1fv MANGLE(ProgramUniform1fv)
#define glProgramUniform1i64NV MANGLE(ProgramUniform1i64NV)
#define glProgramUniform1i64vNV MANGLE(ProgramUniform1i64vNV)
#define glProgramUniform1iEXT MANGLE(ProgramUniform1iEXT)
#define glProgramUniform1i MANGLE(ProgramUniform1i)
#define glProgramUniform1ivEXT MANGLE(ProgramUniform1ivEXT)
#define glProgramUniform1iv MANGLE(ProgramUniform1iv)
#define glProgramUniform1ui64NV MANGLE(ProgramUniform1ui64NV)
#define glProgramUniform1ui64vNV MANGLE(ProgramUniform1ui64vNV)
#define glProgramUniform1uiEXT MANGLE(ProgramUniform1uiEXT)
#define glProgramUniform1ui MANGLE(ProgramUniform1ui)
#define glProgramUniform1uivEXT MANGLE(ProgramUniform1uivEXT)
#define glProgramUniform1uiv MANGLE(ProgramUniform1uiv)
#define glProgramUniform2dEXT MANGLE(ProgramUniform2dEXT)
#define glProgramUniform2d MANGLE(ProgramUniform2d)
#define glProgramUniform2dvEXT MANGLE(ProgramUniform2dvEXT)
#define glProgramUniform2dv MANGLE(ProgramUniform2dv)
#define glProgramUniform2fEXT MANGLE(ProgramUniform2fEXT)
#define glProgramUniform2f MANGLE(ProgramUniform2f)
#define glProgramUniform2fvEXT MANGLE(ProgramUniform2fvEXT)
#define glProgramUniform2fv MANGLE(ProgramUniform2fv)
#define glProgramUniform2i64NV MANGLE(ProgramUniform2i64NV)
#define glProgramUniform2i64vNV MANGLE(ProgramUniform2i64vNV)
#define glProgramUniform2iEXT MANGLE(ProgramUniform2iEXT)
#define glProgramUniform2i MANGLE(ProgramUniform2i)
#define glProgramUniform2ivEXT MANGLE(ProgramUniform2ivEXT)
#define glProgramUniform2iv MANGLE(ProgramUniform2iv)
#define glProgramUniform2ui64NV MANGLE(ProgramUniform2ui64NV)
#define glProgramUniform2ui64vNV MANGLE(ProgramUniform2ui64vNV)
#define glProgramUniform2uiEXT MANGLE(ProgramUniform2uiEXT)
#define glProgramUniform2ui MANGLE(ProgramUniform2ui)
#define glProgramUniform2uivEXT MANGLE(ProgramUniform2uivEXT)
#define glProgramUniform2uiv MANGLE(ProgramUniform2uiv)
#define glProgramUniform3dEXT MANGLE(ProgramUniform3dEXT)
#define glProgramUniform3d MANGLE(ProgramUniform3d)
#define glProgramUniform3dvEXT MANGLE(ProgramUniform3dvEXT)
#define glProgramUniform3dv MANGLE(ProgramUniform3dv)
#define glProgramUniform3fEXT MANGLE(ProgramUniform3fEXT)
#define glProgramUniform3f MANGLE(ProgramUniform3f)
#define glProgramUniform3fvEXT MANGLE(ProgramUniform3fvEXT)
#define glProgramUniform3fv MANGLE(ProgramUniform3fv)
#define glProgramUniform3i64NV MANGLE(ProgramUniform3i64NV)
#define glProgramUniform3i64vNV MANGLE(ProgramUniform3i64vNV)
#define glProgramUniform3iEXT MANGLE(ProgramUniform3iEXT)
#define glProgramUniform3i MANGLE(ProgramUniform3i)
#define glProgramUniform3ivEXT MANGLE(ProgramUniform3ivEXT)
#define glProgramUniform3iv MANGLE(ProgramUniform3iv)
#define glProgramUniform3ui64NV MANGLE(ProgramUniform3ui64NV)
#define glProgramUniform3ui64vNV MANGLE(ProgramUniform3ui64vNV)
#define glProgramUniform3uiEXT MANGLE(ProgramUniform3uiEXT)
#define glProgramUniform3ui MANGLE(ProgramUniform3ui)
#define glProgramUniform3uivEXT MANGLE(ProgramUniform3uivEXT)
#define glProgramUniform3uiv MANGLE(ProgramUniform3uiv)
#define glProgramUniform4dEXT MANGLE(ProgramUniform4dEXT)
#define glProgramUniform4d MANGLE(ProgramUniform4d)
#define glProgramUniform4dvEXT MANGLE(ProgramUniform4dvEXT)
#define glProgramUniform4dv MANGLE(ProgramUniform4dv)
#define glProgramUniform4fEXT MANGLE(ProgramUniform4fEXT)
#define glProgramUniform4f MANGLE(ProgramUniform4f)
#define glProgramUniform4fvEXT MANGLE(ProgramUniform4fvEXT)
#define glProgramUniform4fv MANGLE(ProgramUniform4fv)
#define glProgramUniform4i64NV MANGLE(ProgramUniform4i64NV)
#define glProgramUniform4i64vNV MANGLE(ProgramUniform4i64vNV)
#define glProgramUniform4iEXT MANGLE(ProgramUniform4iEXT)
#define glProgramUniform4i MANGLE(ProgramUniform4i)
#define glProgramUniform4ivEXT MANGLE(ProgramUniform4ivEXT)
#define glProgramUniform4iv MANGLE(ProgramUniform4iv)
#define glProgramUniform4ui64NV MANGLE(ProgramUniform4ui64NV)
#define glProgramUniform4ui64vNV MANGLE(ProgramUniform4ui64vNV)
#define glProgramUniform4uiEXT MANGLE(ProgramUniform4uiEXT)
#define glProgramUniform4ui MANGLE(ProgramUniform4ui)
#define glProgramUniform4uivEXT MANGLE(ProgramUniform4uivEXT)
#define glProgramUniform4uiv MANGLE(ProgramUniform4uiv)
#define glProgramUniformMatrix2dvEXT MANGLE(ProgramUniformMatrix2dvEXT)
#define glProgramUniformMatrix2dv MANGLE(ProgramUniformMatrix2dv)
#define glProgramUniformMatrix2fvEXT MANGLE(ProgramUniformMatrix2fvEXT)
#define glProgramUniformMatrix2fv MANGLE(ProgramUniformMatrix2fv)
#define glProgramUniformMatrix2x3dvEXT MANGLE(ProgramUniformMatrix2x3dvEXT)
#define glProgramUniformMatrix2x3dv MANGLE(ProgramUniformMatrix2x3dv)
#define glProgramUniformMatrix2x3fvEXT MANGLE(ProgramUniformMatrix2x3fvEXT)
#define glProgramUniformMatrix2x3fv MANGLE(ProgramUniformMatrix2x3fv)
#define glProgramUniformMatrix2x4dvEXT MANGLE(ProgramUniformMatrix2x4dvEXT)
#define glProgramUniformMatrix2x4dv MANGLE(ProgramUniformMatrix2x4dv)
#define glProgramUniformMatrix2x4fvEXT MANGLE(ProgramUniformMatrix2x4fvEXT)
#define glProgramUniformMatrix2x4fv MANGLE(ProgramUniformMatrix2x4fv)
#define glProgramUniformMatrix3dvEXT MANGLE(ProgramUniformMatrix3dvEXT)
#define glProgramUniformMatrix3dv MANGLE(ProgramUniformMatrix3dv)
#define glProgramUniformMatrix3fvEXT MANGLE(ProgramUniformMatrix3fvEXT)
#define glProgramUniformMatrix3fv MANGLE(ProgramUniformMatrix3fv)
#define glProgramUniformMatrix3x2dvEXT MANGLE(ProgramUniformMatrix3x2dvEXT)
#define glProgramUniformMatrix3x2dv MANGLE(ProgramUniformMatrix3x2dv)
#define glProgramUniformMatrix3x2fvEXT MANGLE(ProgramUniformMatrix3x2fvEXT)
#define glProgramUniformMatrix3x2fv MANGLE(ProgramUniformMatrix3x2fv)
#define glProgramUniformMatrix3x4dvEXT MANGLE(ProgramUniformMatrix3x4dvEXT)
#define glProgramUniformMatrix3x4dv MANGLE(ProgramUniformMatrix3x4dv)
#define glProgramUniformMatrix3x4fvEXT MANGLE(ProgramUniformMatrix3x4fvEXT)
#define glProgramUniformMatrix3x4fv MANGLE(ProgramUniformMatrix3x4fv)
#define glProgramUniformMatrix4dvEXT MANGLE(ProgramUniformMatrix4dvEXT)
#define glProgramUniformMatrix4dv MANGLE(ProgramUniformMatrix4dv)
#define glProgramUniformMatrix4fvEXT MANGLE(ProgramUniformMatrix4fvEXT)
#define glProgramUniformMatrix4fv MANGLE(ProgramUniformMatrix4fv)
#define glProgramUniformMatrix4x2dvEXT MANGLE(ProgramUniformMatrix4x2dvEXT)
#define glProgramUniformMatrix4x2dv MANGLE(ProgramUniformMatrix4x2dv)
#define glProgramUniformMatrix4x2fvEXT MANGLE(ProgramUniformMatrix4x2fvEXT)
#define glProgramUniformMatrix4x2fv MANGLE(ProgramUniformMatrix4x2fv)
#define glProgramUniformMatrix4x3dvEXT MANGLE(ProgramUniformMatrix4x3dvEXT)
#define glProgramUniformMatrix4x3dv MANGLE(ProgramUniformMatrix4x3dv)
#define glProgramUniformMatrix4x3fvEXT MANGLE(ProgramUniformMatrix4x3fvEXT)
#define glProgramUniformMatrix4x3fv MANGLE(ProgramUniformMatrix4x3fv)
#define glProgramUniformui64NV MANGLE(ProgramUniformui64NV)
#define glProgramUniformui64vNV MANGLE(ProgramUniformui64vNV)
#define glProgramVertexLimitNV MANGLE(ProgramVertexLimitNV)
@@ -1274,6 +1475,7 @@
#define glPushClientAttrib MANGLE(PushClientAttrib)
#define glPushMatrix MANGLE(PushMatrix)
#define glPushName MANGLE(PushName)
#define glQueryCounter MANGLE(QueryCounter)
#define glRasterPos2d MANGLE(RasterPos2d)
#define glRasterPos2dv MANGLE(RasterPos2dv)
#define glRasterPos2f MANGLE(RasterPos2f)
@@ -1300,6 +1502,7 @@
#define glRasterPos4sv MANGLE(RasterPos4sv)
#define glReadBuffer MANGLE(ReadBuffer)
#define glReadInstrumentsSGIX MANGLE(ReadInstrumentsSGIX)
#define glReadnPixelsARB MANGLE(ReadnPixelsARB)
#define glReadPixels MANGLE(ReadPixels)
#define glRectd MANGLE(Rectd)
#define glRectdv MANGLE(Rectdv)
@@ -1310,6 +1513,7 @@
#define glRects MANGLE(Rects)
#define glRectsv MANGLE(Rectsv)
#define glReferencePlaneSGIX MANGLE(ReferencePlaneSGIX)
#define glReleaseShaderCompiler MANGLE(ReleaseShaderCompiler)
#define glRenderbufferStorageEXT MANGLE(RenderbufferStorageEXT)
#define glRenderbufferStorage MANGLE(RenderbufferStorage)
#define glRenderbufferStorageMultisampleCoverageNV MANGLE(RenderbufferStorageMultisampleCoverageNV)
@@ -1345,6 +1549,7 @@
#define glResetMinmaxEXT MANGLE(ResetMinmaxEXT)
#define glResetMinmax MANGLE(ResetMinmax)
#define glResizeBuffersMESA MANGLE(ResizeBuffersMESA)
#define glResumeTransformFeedback MANGLE(ResumeTransformFeedback)
#define glResumeTransformFeedbackNV MANGLE(ResumeTransformFeedbackNV)
#define glRotated MANGLE(Rotated)
#define glRotatef MANGLE(Rotatef)
@@ -1357,8 +1562,17 @@
#define glSampleMaskSGIS MANGLE(SampleMaskSGIS)
#define glSamplePatternEXT MANGLE(SamplePatternEXT)
#define glSamplePatternSGIS MANGLE(SamplePatternSGIS)
#define glSamplerParameterf MANGLE(SamplerParameterf)
#define glSamplerParameterfv MANGLE(SamplerParameterfv)
#define glSamplerParameterIiv MANGLE(SamplerParameterIiv)
#define glSamplerParameteri MANGLE(SamplerParameteri)
#define glSamplerParameterIuiv MANGLE(SamplerParameterIuiv)
#define glSamplerParameteriv MANGLE(SamplerParameteriv)
#define glScaled MANGLE(Scaled)
#define glScalef MANGLE(Scalef)
#define glScissorArrayv MANGLE(ScissorArrayv)
#define glScissorIndexed MANGLE(ScissorIndexed)
#define glScissorIndexedv MANGLE(ScissorIndexedv)
#define glScissor MANGLE(Scissor)
#define glSecondaryColor3bEXT MANGLE(SecondaryColor3bEXT)
#define glSecondaryColor3b MANGLE(SecondaryColor3b)
@@ -1395,6 +1609,8 @@
#define glSecondaryColor3usvEXT MANGLE(SecondaryColor3usvEXT)
#define glSecondaryColor3usv MANGLE(SecondaryColor3usv)
#define glSecondaryColorFormatNV MANGLE(SecondaryColorFormatNV)
#define glSecondaryColorP3ui MANGLE(SecondaryColorP3ui)
#define glSecondaryColorP3uiv MANGLE(SecondaryColorP3uiv)
#define glSecondaryColorPointerEXT MANGLE(SecondaryColorPointerEXT)
#define glSecondaryColorPointerListIBM MANGLE(SecondaryColorPointerListIBM)
#define glSecondaryColorPointer MANGLE(SecondaryColorPointer)
@@ -1408,6 +1624,7 @@
#define glSetInvariantEXT MANGLE(SetInvariantEXT)
#define glSetLocalConstantEXT MANGLE(SetLocalConstantEXT)
#define glShadeModel MANGLE(ShadeModel)
#define glShaderBinary MANGLE(ShaderBinary)
#define glShaderOp1EXT MANGLE(ShaderOp1EXT)
#define glShaderOp2EXT MANGLE(ShaderOp2EXT)
#define glShaderOp3EXT MANGLE(ShaderOp3EXT)
@@ -1509,6 +1726,14 @@
#define glTexCoord4s MANGLE(TexCoord4s)
#define glTexCoord4sv MANGLE(TexCoord4sv)
#define glTexCoordFormatNV MANGLE(TexCoordFormatNV)
#define glTexCoordP1ui MANGLE(TexCoordP1ui)
#define glTexCoordP1uiv MANGLE(TexCoordP1uiv)
#define glTexCoordP2ui MANGLE(TexCoordP2ui)
#define glTexCoordP2uiv MANGLE(TexCoordP2uiv)
#define glTexCoordP3ui MANGLE(TexCoordP3ui)
#define glTexCoordP3uiv MANGLE(TexCoordP3uiv)
#define glTexCoordP4ui MANGLE(TexCoordP4ui)
#define glTexCoordP4uiv MANGLE(TexCoordP4uiv)
#define glTexCoordPointerEXT MANGLE(TexCoordPointerEXT)
#define glTexCoordPointerListIBM MANGLE(TexCoordPointerListIBM)
#define glTexCoordPointer MANGLE(TexCoordPointer)
@@ -1569,73 +1794,108 @@
#define glTextureSubImage3DEXT MANGLE(TextureSubImage3DEXT)
#define glTrackMatrixNV MANGLE(TrackMatrixNV)
#define glTransformFeedbackAttribsNV MANGLE(TransformFeedbackAttribsNV)
#define glTransformFeedbackStreamAttribsNV MANGLE(TransformFeedbackStreamAttribsNV)
#define glTransformFeedbackVaryingsEXT MANGLE(TransformFeedbackVaryingsEXT)
#define glTransformFeedbackVaryings MANGLE(TransformFeedbackVaryings)
#define glTransformFeedbackVaryingsNV MANGLE(TransformFeedbackVaryingsNV)
#define glTranslated MANGLE(Translated)
#define glTranslatef MANGLE(Translatef)
#define glUniform1d MANGLE(Uniform1d)
#define glUniform1dv MANGLE(Uniform1dv)
#define glUniform1fARB MANGLE(Uniform1fARB)
#define glUniform1f MANGLE(Uniform1f)
#define glUniform1fvARB MANGLE(Uniform1fvARB)
#define glUniform1fv MANGLE(Uniform1fv)
#define glUniform1i64NV MANGLE(Uniform1i64NV)
#define glUniform1i64vNV MANGLE(Uniform1i64vNV)
#define glUniform1iARB MANGLE(Uniform1iARB)
#define glUniform1i MANGLE(Uniform1i)
#define glUniform1ivARB MANGLE(Uniform1ivARB)
#define glUniform1iv MANGLE(Uniform1iv)
#define glUniform1ui64NV MANGLE(Uniform1ui64NV)
#define glUniform1ui64vNV MANGLE(Uniform1ui64vNV)
#define glUniform1uiEXT MANGLE(Uniform1uiEXT)
#define glUniform1ui MANGLE(Uniform1ui)
#define glUniform1uivEXT MANGLE(Uniform1uivEXT)
#define glUniform1uiv MANGLE(Uniform1uiv)
#define glUniform2d MANGLE(Uniform2d)
#define glUniform2dv MANGLE(Uniform2dv)
#define glUniform2fARB MANGLE(Uniform2fARB)
#define glUniform2f MANGLE(Uniform2f)
#define glUniform2fvARB MANGLE(Uniform2fvARB)
#define glUniform2fv MANGLE(Uniform2fv)
#define glUniform2i64NV MANGLE(Uniform2i64NV)
#define glUniform2i64vNV MANGLE(Uniform2i64vNV)
#define glUniform2iARB MANGLE(Uniform2iARB)
#define glUniform2i MANGLE(Uniform2i)
#define glUniform2ivARB MANGLE(Uniform2ivARB)
#define glUniform2iv MANGLE(Uniform2iv)
#define glUniform2ui64NV MANGLE(Uniform2ui64NV)
#define glUniform2ui64vNV MANGLE(Uniform2ui64vNV)
#define glUniform2uiEXT MANGLE(Uniform2uiEXT)
#define glUniform2ui MANGLE(Uniform2ui)
#define glUniform2uivEXT MANGLE(Uniform2uivEXT)
#define glUniform2uiv MANGLE(Uniform2uiv)
#define glUniform3d MANGLE(Uniform3d)
#define glUniform3dv MANGLE(Uniform3dv)
#define glUniform3fARB MANGLE(Uniform3fARB)
#define glUniform3f MANGLE(Uniform3f)
#define glUniform3fvARB MANGLE(Uniform3fvARB)
#define glUniform3fv MANGLE(Uniform3fv)
#define glUniform3i64NV MANGLE(Uniform3i64NV)
#define glUniform3i64vNV MANGLE(Uniform3i64vNV)
#define glUniform3iARB MANGLE(Uniform3iARB)
#define glUniform3i MANGLE(Uniform3i)
#define glUniform3ivARB MANGLE(Uniform3ivARB)
#define glUniform3iv MANGLE(Uniform3iv)
#define glUniform3ui64NV MANGLE(Uniform3ui64NV)
#define glUniform3ui64vNV MANGLE(Uniform3ui64vNV)
#define glUniform3uiEXT MANGLE(Uniform3uiEXT)
#define glUniform3ui MANGLE(Uniform3ui)
#define glUniform3uivEXT MANGLE(Uniform3uivEXT)
#define glUniform3uiv MANGLE(Uniform3uiv)
#define glUniform4d MANGLE(Uniform4d)
#define glUniform4dv MANGLE(Uniform4dv)
#define glUniform4fARB MANGLE(Uniform4fARB)
#define glUniform4f MANGLE(Uniform4f)
#define glUniform4fvARB MANGLE(Uniform4fvARB)
#define glUniform4fv MANGLE(Uniform4fv)
#define glUniform4i64NV MANGLE(Uniform4i64NV)
#define glUniform4i64vNV MANGLE(Uniform4i64vNV)
#define glUniform4iARB MANGLE(Uniform4iARB)
#define glUniform4i MANGLE(Uniform4i)
#define glUniform4ivARB MANGLE(Uniform4ivARB)
#define glUniform4iv MANGLE(Uniform4iv)
#define glUniform4ui64NV MANGLE(Uniform4ui64NV)
#define glUniform4ui64vNV MANGLE(Uniform4ui64vNV)
#define glUniform4uiEXT MANGLE(Uniform4uiEXT)
#define glUniform4ui MANGLE(Uniform4ui)
#define glUniform4uivEXT MANGLE(Uniform4uivEXT)
#define glUniform4uiv MANGLE(Uniform4uiv)
#define glUniformBlockBinding MANGLE(UniformBlockBinding)
#define glUniformBufferEXT MANGLE(UniformBufferEXT)
#define glUniformMatrix2dv MANGLE(UniformMatrix2dv)
#define glUniformMatrix2fvARB MANGLE(UniformMatrix2fvARB)
#define glUniformMatrix2fv MANGLE(UniformMatrix2fv)
#define glUniformMatrix2x3dv MANGLE(UniformMatrix2x3dv)
#define glUniformMatrix2x3fv MANGLE(UniformMatrix2x3fv)
#define glUniformMatrix2x4dv MANGLE(UniformMatrix2x4dv)
#define glUniformMatrix2x4fv MANGLE(UniformMatrix2x4fv)
#define glUniformMatrix3dv MANGLE(UniformMatrix3dv)
#define glUniformMatrix3fvARB MANGLE(UniformMatrix3fvARB)
#define glUniformMatrix3fv MANGLE(UniformMatrix3fv)
#define glUniformMatrix3x2dv MANGLE(UniformMatrix3x2dv)
#define glUniformMatrix3x2fv MANGLE(UniformMatrix3x2fv)
#define glUniformMatrix3x4dv MANGLE(UniformMatrix3x4dv)
#define glUniformMatrix3x4fv MANGLE(UniformMatrix3x4fv)
#define glUniformMatrix4dv MANGLE(UniformMatrix4dv)
#define glUniformMatrix4fvARB MANGLE(UniformMatrix4fvARB)
#define glUniformMatrix4fv MANGLE(UniformMatrix4fv)
#define glUniformMatrix4x2dv MANGLE(UniformMatrix4x2dv)
#define glUniformMatrix4x2fv MANGLE(UniformMatrix4x2fv)
#define glUniformMatrix4x3dv MANGLE(UniformMatrix4x3dv)
#define glUniformMatrix4x3fv MANGLE(UniformMatrix4x3fv)
#define glUniformSubroutinesuiv MANGLE(UniformSubroutinesuiv)
#define glUniformui64NV MANGLE(Uniformui64NV)
#define glUniformui64vNV MANGLE(Uniformui64vNV)
#define glUnlockArraysEXT MANGLE(UnlockArraysEXT)
@@ -1646,9 +1906,11 @@
#define glUpdateObjectBufferATI MANGLE(UpdateObjectBufferATI)
#define glUseProgram MANGLE(UseProgram)
#define glUseProgramObjectARB MANGLE(UseProgramObjectARB)
#define glUseProgramStages MANGLE(UseProgramStages)
#define glUseShaderProgramEXT MANGLE(UseShaderProgramEXT)
#define glValidateProgramARB MANGLE(ValidateProgramARB)
#define glValidateProgram MANGLE(ValidateProgram)
#define glValidateProgramPipeline MANGLE(ValidateProgramPipeline)
#define glVariantArrayObjectATI MANGLE(VariantArrayObjectATI)
#define glVariantbvEXT MANGLE(VariantbvEXT)
#define glVariantdvEXT MANGLE(VariantdvEXT)
@@ -1659,6 +1921,16 @@
#define glVariantubvEXT MANGLE(VariantubvEXT)
#define glVariantuivEXT MANGLE(VariantuivEXT)
#define glVariantusvEXT MANGLE(VariantusvEXT)
#define glVDPAUFiniNV MANGLE(VDPAUFiniNV)
#define glVDPAUGetSurfaceivNV MANGLE(VDPAUGetSurfaceivNV)
#define glVDPAUInitNV MANGLE(VDPAUInitNV)
#define glVDPAUIsSurfaceNV MANGLE(VDPAUIsSurfaceNV)
#define glVDPAUMapSurfacesNV MANGLE(VDPAUMapSurfacesNV)
#define glVDPAURegisterOutputSurfaceNV MANGLE(VDPAURegisterOutputSurfaceNV)
#define glVDPAURegisterVideoSurfaceNV MANGLE(VDPAURegisterVideoSurfaceNV)
#define glVDPAUSurfaceAccessNV MANGLE(VDPAUSurfaceAccessNV)
#define glVDPAUUnmapSurfacesNV MANGLE(VDPAUUnmapSurfacesNV)
#define glVDPAUUnregisterSurfaceNV MANGLE(VDPAUUnregisterSurfaceNV)
#define glVertex2d MANGLE(Vertex2d)
#define glVertex2dv MANGLE(Vertex2dv)
#define glVertex2f MANGLE(Vertex2f)
@@ -1692,6 +1964,7 @@
#define glVertexArrayParameteriAPPLE MANGLE(VertexArrayParameteriAPPLE)
#define glVertexArrayRangeAPPLE MANGLE(VertexArrayRangeAPPLE)
#define glVertexArrayRangeNV MANGLE(VertexArrayRangeNV)
#define glVertexArrayVertexAttribLOffsetEXT MANGLE(VertexArrayVertexAttribLOffsetEXT)
#define glVertexAttrib1dARB MANGLE(VertexAttrib1dARB)
#define glVertexAttrib1d MANGLE(VertexAttrib1d)
#define glVertexAttrib1dNV MANGLE(VertexAttrib1dNV)
@@ -1800,6 +2073,7 @@
#define glVertexAttrib4usv MANGLE(VertexAttrib4usv)
#define glVertexAttribArrayObjectATI MANGLE(VertexAttribArrayObjectATI)
#define glVertexAttribDivisorARB MANGLE(VertexAttribDivisorARB)
#define glVertexAttribDivisor MANGLE(VertexAttribDivisor)
#define glVertexAttribFormatNV MANGLE(VertexAttribFormatNV)
#define glVertexAttribI1iEXT MANGLE(VertexAttribI1iEXT)
#define glVertexAttribI1i MANGLE(VertexAttribI1i)
@@ -1844,6 +2118,49 @@
#define glVertexAttribIFormatNV MANGLE(VertexAttribIFormatNV)
#define glVertexAttribIPointerEXT MANGLE(VertexAttribIPointerEXT)
#define glVertexAttribIPointer MANGLE(VertexAttribIPointer)
#define glVertexAttribL1dEXT MANGLE(VertexAttribL1dEXT)
#define glVertexAttribL1d MANGLE(VertexAttribL1d)
#define glVertexAttribL1dvEXT MANGLE(VertexAttribL1dvEXT)
#define glVertexAttribL1dv MANGLE(VertexAttribL1dv)
#define glVertexAttribL1i64NV MANGLE(VertexAttribL1i64NV)
#define glVertexAttribL1i64vNV MANGLE(VertexAttribL1i64vNV)
#define glVertexAttribL1ui64NV MANGLE(VertexAttribL1ui64NV)
#define glVertexAttribL1ui64vNV MANGLE(VertexAttribL1ui64vNV)
#define glVertexAttribL2dEXT MANGLE(VertexAttribL2dEXT)
#define glVertexAttribL2d MANGLE(VertexAttribL2d)
#define glVertexAttribL2dvEXT MANGLE(VertexAttribL2dvEXT)
#define glVertexAttribL2dv MANGLE(VertexAttribL2dv)
#define glVertexAttribL2i64NV MANGLE(VertexAttribL2i64NV)
#define glVertexAttribL2i64vNV MANGLE(VertexAttribL2i64vNV)
#define glVertexAttribL2ui64NV MANGLE(VertexAttribL2ui64NV)
#define glVertexAttribL2ui64vNV MANGLE(VertexAttribL2ui64vNV)
#define glVertexAttribL3dEXT MANGLE(VertexAttribL3dEXT)
#define glVertexAttribL3d MANGLE(VertexAttribL3d)
#define glVertexAttribL3dvEXT MANGLE(VertexAttribL3dvEXT)
#define glVertexAttribL3dv MANGLE(VertexAttribL3dv)
#define glVertexAttribL3i64NV MANGLE(VertexAttribL3i64NV)
#define glVertexAttribL3i64vNV MANGLE(VertexAttribL3i64vNV)
#define glVertexAttribL3ui64NV MANGLE(VertexAttribL3ui64NV)
#define glVertexAttribL3ui64vNV MANGLE(VertexAttribL3ui64vNV)
#define glVertexAttribL4dEXT MANGLE(VertexAttribL4dEXT)
#define glVertexAttribL4d MANGLE(VertexAttribL4d)
#define glVertexAttribL4dvEXT MANGLE(VertexAttribL4dvEXT)
#define glVertexAttribL4dv MANGLE(VertexAttribL4dv)
#define glVertexAttribL4i64NV MANGLE(VertexAttribL4i64NV)
#define glVertexAttribL4i64vNV MANGLE(VertexAttribL4i64vNV)
#define glVertexAttribL4ui64NV MANGLE(VertexAttribL4ui64NV)
#define glVertexAttribL4ui64vNV MANGLE(VertexAttribL4ui64vNV)
#define glVertexAttribLFormatNV MANGLE(VertexAttribLFormatNV)
#define glVertexAttribLPointerEXT MANGLE(VertexAttribLPointerEXT)
#define glVertexAttribLPointer MANGLE(VertexAttribLPointer)
#define glVertexAttribP1ui MANGLE(VertexAttribP1ui)
#define glVertexAttribP1uiv MANGLE(VertexAttribP1uiv)
#define glVertexAttribP2ui MANGLE(VertexAttribP2ui)
#define glVertexAttribP2uiv MANGLE(VertexAttribP2uiv)
#define glVertexAttribP3ui MANGLE(VertexAttribP3ui)
#define glVertexAttribP3uiv MANGLE(VertexAttribP3uiv)
#define glVertexAttribP4ui MANGLE(VertexAttribP4ui)
#define glVertexAttribP4uiv MANGLE(VertexAttribP4uiv)
#define glVertexAttribPointerARB MANGLE(VertexAttribPointerARB)
#define glVertexAttribPointer MANGLE(VertexAttribPointer)
#define glVertexAttribPointerNV MANGLE(VertexAttribPointerNV)
@@ -1868,6 +2185,12 @@
#define glVertexBlendEnvfATI MANGLE(VertexBlendEnvfATI)
#define glVertexBlendEnviATI MANGLE(VertexBlendEnviATI)
#define glVertexFormatNV MANGLE(VertexFormatNV)
#define glVertexP2ui MANGLE(VertexP2ui)
#define glVertexP2uiv MANGLE(VertexP2uiv)
#define glVertexP3ui MANGLE(VertexP3ui)
#define glVertexP3uiv MANGLE(VertexP3uiv)
#define glVertexP4ui MANGLE(VertexP4ui)
#define glVertexP4uiv MANGLE(VertexP4uiv)
#define glVertexPointerEXT MANGLE(VertexPointerEXT)
#define glVertexPointerListIBM MANGLE(VertexPointerListIBM)
#define glVertexPointer MANGLE(VertexPointer)
@@ -1913,6 +2236,9 @@
#define glVideoCaptureStreamParameterdvNV MANGLE(VideoCaptureStreamParameterdvNV)
#define glVideoCaptureStreamParameterfvNV MANGLE(VideoCaptureStreamParameterfvNV)
#define glVideoCaptureStreamParameterivNV MANGLE(VideoCaptureStreamParameterivNV)
#define glViewportArrayv MANGLE(ViewportArrayv)
#define glViewportIndexedf MANGLE(ViewportIndexedf)
#define glViewportIndexedfv MANGLE(ViewportIndexedfv)
#define glViewport MANGLE(Viewport)
#define glWaitSync MANGLE(WaitSync)
#define glWeightbvARB MANGLE(WeightbvARB)

View File

@@ -29,9 +29,9 @@ extern "C" {
*/
/* Header file version number, required by OpenGL ABI for Linux */
/* glext.h last updated $Date: 2010-08-03 01:30:25 -0700 (Tue, 03 Aug 2010) $ */
/* glext.h last updated $Date: 2010-12-09 02:15:08 -0800 (Thu, 09 Dec 2010) $ */
/* Current version at http://www.opengl.org/registry/ */
#define GL_GLEXT_VERSION 64
#define GL_GLEXT_VERSION 67
/* Function declaration macros - to move into glplatform.h */
#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__)
@@ -4840,7 +4840,7 @@ extern "C" {
#endif
#ifndef GL_AMD_seamless_cubemap_per_texture
/* reuse GL_TEXTURE_CUBE_MAP_SEAMLESS_ARB */
/* reuse GL_TEXTURE_CUBE_MAP_SEAMLESS */
#endif
#ifndef GL_AMD_conservative_depth
@@ -4925,6 +4925,8 @@ extern "C" {
#define GL_MIN_FRAGMENT_INTERPOLATION_OFFSET_NV 0x8E5B
#define GL_MAX_FRAGMENT_INTERPOLATION_OFFSET_NV 0x8E5C
#define GL_FRAGMENT_PROGRAM_INTERPOLATION_OFFSET_BITS_NV 0x8E5D
#define GL_MIN_PROGRAM_TEXTURE_GATHER_OFFSET_NV 0x8E5E
#define GL_MAX_PROGRAM_TEXTURE_GATHER_OFFSET_NV 0x8E5F
#define GL_MAX_PROGRAM_SUBROUTINE_PARAMETERS_NV 0x8F44
#define GL_MAX_PROGRAM_SUBROUTINE_NUM_NV 0x8F45
#endif
@@ -5019,6 +5021,17 @@ extern "C" {
#ifndef GL_AMD_transform_feedback3_lines_triangles
#endif
#ifndef GL_AMD_depth_clamp_separate
#define GL_DEPTH_CLAMP_NEAR_AMD 0x901E
#define GL_DEPTH_CLAMP_FAR_AMD 0x901F
#endif
#ifndef GL_EXT_texture_sRGB_decode
#define GL_TEXTURE_SRGB_DECODE_EXT 0x8A48
#define GL_DECODE_EXT 0x8A49
#define GL_SKIP_DECODE_EXT 0x8A4A
#endif
/*************************************************************/
@@ -8765,8 +8778,8 @@ GLAPI void APIENTRY glProgramParameter4dNV (GLenum target, GLuint index, GLdoubl
GLAPI void APIENTRY glProgramParameter4dvNV (GLenum target, GLuint index, const GLdouble *v);
GLAPI void APIENTRY glProgramParameter4fNV (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
GLAPI void APIENTRY glProgramParameter4fvNV (GLenum target, GLuint index, const GLfloat *v);
GLAPI void APIENTRY glProgramParameters4dvNV (GLenum target, GLuint index, GLuint count, const GLdouble *v);
GLAPI void APIENTRY glProgramParameters4fvNV (GLenum target, GLuint index, GLuint count, const GLfloat *v);
GLAPI void APIENTRY glProgramParameters4dvNV (GLenum target, GLuint index, GLsizei count, const GLdouble *v);
GLAPI void APIENTRY glProgramParameters4fvNV (GLenum target, GLuint index, GLsizei count, const GLfloat *v);
GLAPI void APIENTRY glRequestResidentProgramsNV (GLsizei n, const GLuint *programs);
GLAPI void APIENTRY glTrackMatrixNV (GLenum target, GLuint address, GLenum matrix, GLenum transform);
GLAPI void APIENTRY glVertexAttribPointerNV (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer);
@@ -8830,8 +8843,8 @@ typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DNVPROC) (GLenum target, GLuint in
typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DVNVPROC) (GLenum target, GLuint index, const GLdouble *v);
typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FNVPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FVNVPROC) (GLenum target, GLuint index, const GLfloat *v);
typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint index, GLuint count, const GLdouble *v);
typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLuint count, const GLfloat *v);
typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLdouble *v);
typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLfloat *v);
typedef void (APIENTRYP PFNGLREQUESTRESIDENTPROGRAMSNVPROC) (GLsizei n, const GLuint *programs);
typedef void (APIENTRYP PFNGLTRACKMATRIXNVPROC) (GLenum target, GLuint address, GLenum matrix, GLenum transform);
typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer);
@@ -11020,6 +11033,14 @@ typedef void (APIENTRYP PFNGLVDPAUUNMAPSURFACESNVPROC) (GLsizei numSurface, cons
#define GL_AMD_transform_feedback3_lines_triangles 1
#endif
#ifndef GL_AMD_depth_clamp_separate
#define GL_AMD_depth_clamp_separate 1
#endif
#ifndef GL_EXT_texture_sRGB_decode
#define GL_EXT_texture_sRGB_decode 1
#endif
#ifdef __cplusplus
}

View File

@@ -251,6 +251,15 @@ struct __DRItexBufferExtensionRec {
GLint target,
GLint format,
__DRIdrawable *pDraw);
/**
* Method to release texture buffer in case some special platform
* need this.
*
* For GLX_EXT_texture_from_pixmap with AIGLX.
*/
void (*releaseTexBuffer)(__DRIcontext *pDRICtx,
GLint target,
__DRIdrawable *pDraw);
};
/**
@@ -490,6 +499,7 @@ struct __DRIuseInvalidateExtensionRec {
#define __DRI_ATTRIB_BIND_TO_MIPMAP_TEXTURE 45
#define __DRI_ATTRIB_BIND_TO_TEXTURE_TARGETS 46
#define __DRI_ATTRIB_YINVERTED 47
#define __DRI_ATTRIB_FRAMEBUFFER_SRGB_CAPABLE 48
/* __DRI_ATTRIB_RENDER_TYPE */
#define __DRI_ATTRIB_RGBA_BIT 0x01
@@ -647,7 +657,7 @@ struct __DRIlegacyExtensionRec {
* conjunction with the core extension.
*/
#define __DRI_SWRAST "DRI_SWRast"
#define __DRI_SWRAST_VERSION 1
#define __DRI_SWRAST_VERSION 2
struct __DRIswrastExtensionRec {
__DRIextension base;
@@ -660,6 +670,13 @@ struct __DRIswrastExtensionRec {
__DRIdrawable *(*createNewDrawable)(__DRIscreen *screen,
const __DRIconfig *config,
void *loaderPrivate);
/* Since version 2 */
__DRIcontext *(*createNewContextForAPI)(__DRIscreen *screen,
int api,
const __DRIconfig *config,
__DRIcontext *shared,
void *data);
};
/**
@@ -769,6 +786,14 @@ struct __DRIdri2ExtensionRec {
const __DRIconfig *config,
__DRIcontext *shared,
void *data);
__DRIbuffer *(*allocateBuffer)(__DRIscreen *screen,
unsigned int attachment,
unsigned int format,
int width,
int height);
void (*releaseBuffer)(__DRIscreen *screen,
__DRIbuffer *buffer);
};
@@ -788,6 +813,7 @@ struct __DRIdri2ExtensionRec {
#define __DRI_IMAGE_FORMAT_RGB565 0x1001
#define __DRI_IMAGE_FORMAT_XRGB8888 0x1002
#define __DRI_IMAGE_FORMAT_ARGB8888 0x1003
#define __DRI_IMAGE_FORMAT_RGBA8888_REV 0x1004
#define __DRI_IMAGE_USE_SHARE 0x0001
#define __DRI_IMAGE_USE_SCANOUT 0x0002

View File

@@ -1,8 +1,8 @@
/* $Revision: 6822 $ on $Date:: 2008-10-30 05:14:19 -0400 #$ */
/* $Revision: 9203 $ on $Date:: 2009-10-07 02:21:52 -0700 #$ */
/*------------------------------------------------------------------------
*
* OpenVG 1.0.1 Reference Implementation
* OpenVG 1.1 Reference Implementation
* -------------------------------------
*
* Copyright (c) 2008 The Khronos Group Inc.
@@ -28,7 +28,7 @@
*
*//**
* \file
* \brief OpenVG 1.0.1 API.
* \brief OpenVG 1.1 API.
*//*-------------------------------------------------------------------*/
#ifndef _OPENVG_H
@@ -42,6 +42,7 @@ extern "C" {
#define OPENVG_VERSION_1_0 1
#define OPENVG_VERSION_1_0_1 1
#define OPENVG_VERSION_1_1 2
#ifndef VG_MAXSHORT
#define VG_MAXSHORT 0x7FFF
@@ -55,10 +56,12 @@ extern "C" {
#define VG_MAX_ENUM 0x7FFFFFFF
#endif
typedef long VGHandle;
typedef VGuint VGHandle;
typedef VGHandle VGPath;
typedef VGHandle VGImage;
typedef VGHandle VGMaskLayer;
typedef VGHandle VGFont;
typedef VGHandle VGPaint;
#define VG_INVALID_HANDLE ((VGHandle)0)
@@ -96,6 +99,10 @@ typedef enum {
/* Scissoring rectangles */
VG_SCISSOR_RECTS = 0x1106,
/* Color Transformation */
VG_COLOR_TRANSFORM = 0x1170,
VG_COLOR_TRANSFORM_VALUES = 0x1171,
/* Stroke parameters */
VG_STROKE_LINE_WIDTH = 0x1110,
VG_STROKE_CAP_STYLE = 0x1111,
@@ -111,6 +118,9 @@ typedef enum {
/* Color for vgClear */
VG_CLEAR_COLOR = 0x1121,
/* Glyph origin */
VG_GLYPH_ORIGIN = 0x1122,
/* Enable/disable alpha masking and scissoring */
VG_MASKING = 0x1130,
VG_SCISSORING = 0x1131,
@@ -165,6 +175,7 @@ typedef enum {
VG_MATRIX_IMAGE_USER_TO_SURFACE = 0x1401,
VG_MATRIX_FILL_PAINT_TO_USER = 0x1402,
VG_MATRIX_STROKE_PAINT_TO_USER = 0x1403,
VG_MATRIX_GLYPH_USER_TO_SURFACE = 0x1404,
VG_MATRIX_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGMatrixMode;
@@ -365,6 +376,8 @@ typedef enum {
VG_lL_8 = 10,
VG_A_8 = 11,
VG_BW_1 = 12,
VG_A_1 = 13,
VG_A_4 = 14,
/* {A,X}RGB channel ordering */
VG_sXRGB_8888 = 0 | (1 << 6),
@@ -448,6 +461,12 @@ typedef enum {
VG_BLEND_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGBlendMode;
typedef enum {
VG_FONT_NUM_GLYPHS = 0x2F00,
VG_FONT_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGFontParamType;
typedef enum {
VG_IMAGE_FORMAT_QUERY = 0x2100,
VG_PATH_DATATYPE_QUERY = 0x2101,
@@ -541,8 +560,22 @@ VG_API_CALL void VG_API_ENTRY vgShear(VGfloat shx, VGfloat shy) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgRotate(VGfloat angle) VG_API_EXIT;
/* Masking and Clearing */
VG_API_CALL void VG_API_ENTRY vgMask(VGImage mask, VGMaskOperation operation,
VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgMask(VGHandle mask, VGMaskOperation operation,
VGint x, VGint y,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgRenderToMask(VGPath path,
VGbitfield paintModes,
VGMaskOperation operation) VG_API_EXIT;
VG_API_CALL VGMaskLayer VG_API_ENTRY vgCreateMaskLayer(VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDestroyMaskLayer(VGMaskLayer maskLayer) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgFillMaskLayer(VGMaskLayer maskLayer,
VGint x, VGint y,
VGint width, VGint height,
VGfloat value) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgCopyMask(VGMaskLayer maskLayer,
VGint dx, VGint dy,
VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgClear(VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
/* Paths */
@@ -636,6 +669,33 @@ VG_API_CALL void VG_API_ENTRY vgCopyPixels(VGint dx, VGint dy,
VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
/* Text */
VG_API_CALL VGFont VG_API_ENTRY vgCreateFont(VGint glyphCapacityHint) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDestroyFont(VGFont font) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetGlyphToPath(VGFont font,
VGuint glyphIndex,
VGPath path,
VGboolean isHinted,
const VGfloat glyphOrigin [2],
const VGfloat escapement[2]) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetGlyphToImage(VGFont font,
VGuint glyphIndex,
VGImage image,
const VGfloat glyphOrigin [2],
const VGfloat escapement[2]) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgClearGlyph(VGFont font,VGuint glyphIndex) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDrawGlyph(VGFont font,
VGuint glyphIndex,
VGbitfield paintModes,
VGboolean allowAutoHinting) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDrawGlyphs(VGFont font,
VGint glyphCount,
const VGuint *glyphIndices,
const VGfloat *adjustments_x,
const VGfloat *adjustments_y,
VGbitfield paintModes,
VGboolean allowAutoHinting) VG_API_EXIT;
/* Image Filters */
VG_API_CALL void VG_API_ENTRY vgColorMatrix(VGImage dst, VGImage src,
const VGfloat * matrix) VG_API_EXIT;

View File

@@ -1,233 +1,233 @@
/* $Revision: 6810 $ on $Date:: 2008-10-29 10:31:37 -0400 #$ */
/*------------------------------------------------------------------------
*
* VG extensions Reference Implementation
* -------------------------------------
*
* Copyright (c) 2008 The Khronos Group Inc.
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and /or associated documentation files
* (the "Materials "), to deal in the Materials without restriction,
* including without limitation the rights to use, copy, modify, merge,
* publish, distribute, sublicense, and/or sell copies of the Materials,
* and to permit persons to whom the Materials are furnished to do so,
* subject to the following conditions:
*
* The above copyright notice and this permission notice shall be included
* in all copies or substantial portions of the Materials.
*
* THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
* IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
* DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
* OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
* THE USE OR OTHER DEALINGS IN THE MATERIALS.
*
*//**
* \file
* \brief VG extensions
*//*-------------------------------------------------------------------*/
#ifndef _VGEXT_H
#define _VGEXT_H
#ifdef __cplusplus
extern "C" {
#endif
#include <VG/openvg.h>
#include <VG/vgu.h>
#ifndef VG_API_ENTRYP
# define VG_API_ENTRYP VG_API_ENTRY*
#endif
#ifndef VGU_API_ENTRYP
# define VGU_API_ENTRYP VGU_API_ENTRY*
#endif
/*-------------------------------------------------------------------------------
* KHR extensions
*------------------------------------------------------------------------------*/
typedef enum {
#ifndef VG_KHR_iterative_average_blur
VG_MAX_AVERAGE_BLUR_DIMENSION_KHR = 0x116B,
VG_AVERAGE_BLUR_DIMENSION_RESOLUTION_KHR = 0x116C,
VG_MAX_AVERAGE_BLUR_ITERATIONS_KHR = 0x116D,
#endif
VG_PARAM_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM
} VGParamTypeKHR;
#ifndef VG_KHR_EGL_image
#define VG_KHR_EGL_image 1
/* VGEGLImageKHR is an opaque handle to an EGLImage */
typedef void* VGeglImageKHR;
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL VGImage VG_API_ENTRY vgCreateEGLImageTargetKHR(VGeglImageKHR image);
#endif
typedef VGImage (VG_API_ENTRYP PFNVGCREATEEGLIMAGETARGETKHRPROC) (VGeglImageKHR image);
#endif
#ifndef VG_KHR_iterative_average_blur
#define VG_KHR_iterative_average_blur 1
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL void vgIterativeAverageBlurKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
#endif
typedef void (VG_API_ENTRYP PFNVGITERATIVEAVERAGEBLURKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
#endif
#ifndef VG_KHR_advanced_blending
#define VG_KHR_advanced_blending 1
typedef enum {
VG_BLEND_OVERLAY_KHR = 0x2010,
VG_BLEND_HARDLIGHT_KHR = 0x2011,
VG_BLEND_SOFTLIGHT_SVG_KHR = 0x2012,
VG_BLEND_SOFTLIGHT_KHR = 0x2013,
VG_BLEND_COLORDODGE_KHR = 0x2014,
VG_BLEND_COLORBURN_KHR = 0x2015,
VG_BLEND_DIFFERENCE_KHR = 0x2016,
VG_BLEND_SUBTRACT_KHR = 0x2017,
VG_BLEND_INVERT_KHR = 0x2018,
VG_BLEND_EXCLUSION_KHR = 0x2019,
VG_BLEND_LINEARDODGE_KHR = 0x201a,
VG_BLEND_LINEARBURN_KHR = 0x201b,
VG_BLEND_VIVIDLIGHT_KHR = 0x201c,
VG_BLEND_LINEARLIGHT_KHR = 0x201d,
VG_BLEND_PINLIGHT_KHR = 0x201e,
VG_BLEND_HARDMIX_KHR = 0x201f,
VG_BLEND_CLEAR_KHR = 0x2020,
VG_BLEND_DST_KHR = 0x2021,
VG_BLEND_SRC_OUT_KHR = 0x2022,
VG_BLEND_DST_OUT_KHR = 0x2023,
VG_BLEND_SRC_ATOP_KHR = 0x2024,
VG_BLEND_DST_ATOP_KHR = 0x2025,
VG_BLEND_XOR_KHR = 0x2026,
VG_BLEND_MODE_KHR_FORCE_SIZE= VG_MAX_ENUM
} VGBlendModeKHR;
#endif
#ifndef VG_KHR_parametric_filter
#define VG_KHR_parametric_filter 1
typedef enum {
VG_PF_OBJECT_VISIBLE_FLAG_KHR = (1 << 0),
VG_PF_KNOCKOUT_FLAG_KHR = (1 << 1),
VG_PF_OUTER_FLAG_KHR = (1 << 2),
VG_PF_INNER_FLAG_KHR = (1 << 3),
VG_PF_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM
} VGPfTypeKHR;
typedef enum {
VGU_IMAGE_IN_USE_ERROR = 0xF010,
VGU_ERROR_CODE_KHR_FORCE_SIZE = VG_MAX_ENUM
} VGUErrorCodeKHR;
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL void VG_API_ENTRY vgParametricFilterKHR(VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguDropShadowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA) ;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
#endif
typedef void (VG_API_ENTRYP PFNVGPARAMETRICFILTERKHRPROC) (VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUDROPSHADOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
#endif
/*-------------------------------------------------------------------------------
* NDS extensions
*------------------------------------------------------------------------------*/
#ifndef VG_NDS_paint_generation
#define VG_NDS_paint_generation 1
typedef enum {
VG_PAINT_COLOR_RAMP_LINEAR_NDS = 0x1A10,
VG_COLOR_MATRIX_NDS = 0x1A11,
VG_PAINT_COLOR_TRANSFORM_LINEAR_NDS = 0x1A12,
VG_PAINT_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGPaintParamTypeNds;
typedef enum {
VG_DRAW_IMAGE_COLOR_MATRIX_NDS = 0x1F10,
VG_IMAGE_MODE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGImageModeNds;
#endif
#ifndef VG_NDS_projective_geometry
#define VG_NDS_projective_geometry 1
typedef enum {
VG_CLIP_MODE_NDS = 0x1180,
VG_CLIP_LINES_NDS = 0x1181,
VG_MAX_CLIP_LINES_NDS = 0x1182,
VG_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGParamTypeNds;
typedef enum {
VG_CLIPMODE_NONE_NDS = 0x3000,
VG_CLIPMODE_CLIP_CLOSED_NDS = 0x3001,
VG_CLIPMODE_CLIP_OPEN_NDS = 0x3002,
VG_CLIPMODE_CULL_NDS = 0x3003,
VG_CLIPMODE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGClipModeNds;
typedef enum {
VG_RQUAD_TO_NDS = ( 13 << 1 ),
VG_RCUBIC_TO_NDS = ( 14 << 1 ),
VG_PATH_SEGMENT_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGPathSegmentNds;
typedef enum {
VG_RQUAD_TO_ABS_NDS = (VG_RQUAD_TO_NDS | VG_ABSOLUTE),
VG_RQUAD_TO_REL_NDS = (VG_RQUAD_TO_NDS | VG_RELATIVE),
VG_RCUBIC_TO_ABS_NDS = (VG_RCUBIC_TO_NDS | VG_ABSOLUTE),
VG_RCUBIC_TO_REL_NDS = (VG_RCUBIC_TO_NDS | VG_RELATIVE),
VG_PATH_COMMAND_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGPathCommandNds;
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL void VG_API_ENTRY vgProjectiveMatrixNDS(VGboolean enable) ;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguTransformClipLineNDS(const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
#endif
typedef void (VG_API_ENTRYP PFNVGPROJECTIVEMATRIXNDSPROC) (VGboolean enable) ;
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUTRANSFORMCLIPLINENDSPROC) (const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
#endif
#ifdef __cplusplus
} /* extern "C" */
#endif
#endif /* _VGEXT_H */
/* $Revision: 6810 $ on $Date:: 2008-10-29 07:31:37 -0700 #$ */
/*------------------------------------------------------------------------
*
* VG extensions Reference Implementation
* -------------------------------------
*
* Copyright (c) 2008 The Khronos Group Inc.
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and /or associated documentation files
* (the "Materials "), to deal in the Materials without restriction,
* including without limitation the rights to use, copy, modify, merge,
* publish, distribute, sublicense, and/or sell copies of the Materials,
* and to permit persons to whom the Materials are furnished to do so,
* subject to the following conditions:
*
* The above copyright notice and this permission notice shall be included
* in all copies or substantial portions of the Materials.
*
* THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
* IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
* DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
* OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
* THE USE OR OTHER DEALINGS IN THE MATERIALS.
*
*//**
* \file
* \brief VG extensions
*//*-------------------------------------------------------------------*/
#ifndef _VGEXT_H
#define _VGEXT_H
#ifdef __cplusplus
extern "C" {
#endif
#include <VG/openvg.h>
#include <VG/vgu.h>
#ifndef VG_API_ENTRYP
# define VG_API_ENTRYP VG_API_ENTRY*
#endif
#ifndef VGU_API_ENTRYP
# define VGU_API_ENTRYP VGU_API_ENTRY*
#endif
/*-------------------------------------------------------------------------------
* KHR extensions
*------------------------------------------------------------------------------*/
typedef enum {
#ifndef VG_KHR_iterative_average_blur
VG_MAX_AVERAGE_BLUR_DIMENSION_KHR = 0x116B,
VG_AVERAGE_BLUR_DIMENSION_RESOLUTION_KHR = 0x116C,
VG_MAX_AVERAGE_BLUR_ITERATIONS_KHR = 0x116D,
#endif
VG_PARAM_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM
} VGParamTypeKHR;
#ifndef VG_KHR_EGL_image
#define VG_KHR_EGL_image 1
/* VGEGLImageKHR is an opaque handle to an EGLImage */
typedef void* VGeglImageKHR;
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL VGImage VG_API_ENTRY vgCreateEGLImageTargetKHR(VGeglImageKHR image);
#endif
typedef VGImage (VG_API_ENTRYP PFNVGCREATEEGLIMAGETARGETKHRPROC) (VGeglImageKHR image);
#endif
#ifndef VG_KHR_iterative_average_blur
#define VG_KHR_iterative_average_blur 1
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL void vgIterativeAverageBlurKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
#endif
typedef void (VG_API_ENTRYP PFNVGITERATIVEAVERAGEBLURKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
#endif
#ifndef VG_KHR_advanced_blending
#define VG_KHR_advanced_blending 1
typedef enum {
VG_BLEND_OVERLAY_KHR = 0x2010,
VG_BLEND_HARDLIGHT_KHR = 0x2011,
VG_BLEND_SOFTLIGHT_SVG_KHR = 0x2012,
VG_BLEND_SOFTLIGHT_KHR = 0x2013,
VG_BLEND_COLORDODGE_KHR = 0x2014,
VG_BLEND_COLORBURN_KHR = 0x2015,
VG_BLEND_DIFFERENCE_KHR = 0x2016,
VG_BLEND_SUBTRACT_KHR = 0x2017,
VG_BLEND_INVERT_KHR = 0x2018,
VG_BLEND_EXCLUSION_KHR = 0x2019,
VG_BLEND_LINEARDODGE_KHR = 0x201a,
VG_BLEND_LINEARBURN_KHR = 0x201b,
VG_BLEND_VIVIDLIGHT_KHR = 0x201c,
VG_BLEND_LINEARLIGHT_KHR = 0x201d,
VG_BLEND_PINLIGHT_KHR = 0x201e,
VG_BLEND_HARDMIX_KHR = 0x201f,
VG_BLEND_CLEAR_KHR = 0x2020,
VG_BLEND_DST_KHR = 0x2021,
VG_BLEND_SRC_OUT_KHR = 0x2022,
VG_BLEND_DST_OUT_KHR = 0x2023,
VG_BLEND_SRC_ATOP_KHR = 0x2024,
VG_BLEND_DST_ATOP_KHR = 0x2025,
VG_BLEND_XOR_KHR = 0x2026,
VG_BLEND_MODE_KHR_FORCE_SIZE= VG_MAX_ENUM
} VGBlendModeKHR;
#endif
#ifndef VG_KHR_parametric_filter
#define VG_KHR_parametric_filter 1
typedef enum {
VG_PF_OBJECT_VISIBLE_FLAG_KHR = (1 << 0),
VG_PF_KNOCKOUT_FLAG_KHR = (1 << 1),
VG_PF_OUTER_FLAG_KHR = (1 << 2),
VG_PF_INNER_FLAG_KHR = (1 << 3),
VG_PF_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM
} VGPfTypeKHR;
typedef enum {
VGU_IMAGE_IN_USE_ERROR = 0xF010,
VGU_ERROR_CODE_KHR_FORCE_SIZE = VG_MAX_ENUM
} VGUErrorCodeKHR;
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL void VG_API_ENTRY vgParametricFilterKHR(VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguDropShadowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA) ;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
#endif
typedef void (VG_API_ENTRYP PFNVGPARAMETRICFILTERKHRPROC) (VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUDROPSHADOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
#endif
/*-------------------------------------------------------------------------------
* NDS extensions
*------------------------------------------------------------------------------*/
#ifndef VG_NDS_paint_generation
#define VG_NDS_paint_generation 1
typedef enum {
VG_PAINT_COLOR_RAMP_LINEAR_NDS = 0x1A10,
VG_COLOR_MATRIX_NDS = 0x1A11,
VG_PAINT_COLOR_TRANSFORM_LINEAR_NDS = 0x1A12,
VG_PAINT_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGPaintParamTypeNds;
typedef enum {
VG_DRAW_IMAGE_COLOR_MATRIX_NDS = 0x1F10,
VG_IMAGE_MODE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGImageModeNds;
#endif
#ifndef VG_NDS_projective_geometry
#define VG_NDS_projective_geometry 1
typedef enum {
VG_CLIP_MODE_NDS = 0x1180,
VG_CLIP_LINES_NDS = 0x1181,
VG_MAX_CLIP_LINES_NDS = 0x1182,
VG_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGParamTypeNds;
typedef enum {
VG_CLIPMODE_NONE_NDS = 0x3000,
VG_CLIPMODE_CLIP_CLOSED_NDS = 0x3001,
VG_CLIPMODE_CLIP_OPEN_NDS = 0x3002,
VG_CLIPMODE_CULL_NDS = 0x3003,
VG_CLIPMODE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGClipModeNds;
typedef enum {
VG_RQUAD_TO_NDS = ( 13 << 1 ),
VG_RCUBIC_TO_NDS = ( 14 << 1 ),
VG_PATH_SEGMENT_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGPathSegmentNds;
typedef enum {
VG_RQUAD_TO_ABS_NDS = (VG_RQUAD_TO_NDS | VG_ABSOLUTE),
VG_RQUAD_TO_REL_NDS = (VG_RQUAD_TO_NDS | VG_RELATIVE),
VG_RCUBIC_TO_ABS_NDS = (VG_RCUBIC_TO_NDS | VG_ABSOLUTE),
VG_RCUBIC_TO_REL_NDS = (VG_RCUBIC_TO_NDS | VG_RELATIVE),
VG_PATH_COMMAND_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGPathCommandNds;
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL void VG_API_ENTRY vgProjectiveMatrixNDS(VGboolean enable) ;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguTransformClipLineNDS(const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
#endif
typedef void (VG_API_ENTRYP PFNVGPROJECTIVEMATRIXNDSPROC) (VGboolean enable) ;
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUTRANSFORMCLIPLINENDSPROC) (const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
#endif
#ifdef __cplusplus
} /* extern "C" */
#endif
#endif /* _VGEXT_H */

View File

@@ -1,92 +1,92 @@
/* $Revision: 6810 $ on $Date:: 2008-10-29 10:31:37 -0400 #$ */
/*------------------------------------------------------------------------
*
* VG platform specific header Reference Implementation
* ----------------------------------------------------
*
* Copyright (c) 2008 The Khronos Group Inc.
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and /or associated documentation files
* (the "Materials "), to deal in the Materials without restriction,
* including without limitation the rights to use, copy, modify, merge,
* publish, distribute, sublicense, and/or sell copies of the Materials,
* and to permit persons to whom the Materials are furnished to do so,
* subject to the following conditions:
*
* The above copyright notice and this permission notice shall be included
* in all copies or substantial portions of the Materials.
*
* THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
* IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
* DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
* OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
* THE USE OR OTHER DEALINGS IN THE MATERIALS.
*
*//**
* \file
* \brief VG platform specific header
*//*-------------------------------------------------------------------*/
#ifndef _VGPLATFORM_H
#define _VGPLATFORM_H
#include <KHR/khrplatform.h>
#ifdef __cplusplus
extern "C" {
#endif
#ifndef VG_API_CALL
#if defined(OPENVG_STATIC_LIBRARY)
# define VG_API_CALL
#else
# define VG_API_CALL KHRONOS_APICALL
#endif /* defined OPENVG_STATIC_LIBRARY */
#endif /* ifndef VG_API_CALL */
#ifndef VGU_API_CALL
#if defined(OPENVG_STATIC_LIBRARY)
# define VGU_API_CALL
#else
# define VGU_API_CALL KHRONOS_APICALL
#endif /* defined OPENVG_STATIC_LIBRARY */
#endif /* ifndef VGU_API_CALL */
#ifndef VG_API_ENTRY
#define VG_API_ENTRY
#endif
#ifndef VG_API_EXIT
#define VG_API_EXIT
#endif
#ifndef VGU_API_ENTRY
#define VGU_API_ENTRY
#endif
#ifndef VGU_API_EXIT
#define VGU_API_EXIT
#endif
typedef float VGfloat;
typedef signed char VGbyte;
typedef unsigned char VGubyte;
typedef signed short VGshort;
typedef signed int VGint;
typedef unsigned int VGuint;
typedef unsigned int VGbitfield;
#ifndef VG_VGEXT_PROTOTYPES
#define VG_VGEXT_PROTOTYPES
#endif
#ifdef __cplusplus
} /* extern "C" */
#endif
#endif /* _VGPLATFORM_H */
/* $Revision: 6810 $ on $Date:: 2008-10-29 07:31:37 -0700 #$ */
/*------------------------------------------------------------------------
*
* VG platform specific header Reference Implementation
* ----------------------------------------------------
*
* Copyright (c) 2008 The Khronos Group Inc.
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and /or associated documentation files
* (the "Materials "), to deal in the Materials without restriction,
* including without limitation the rights to use, copy, modify, merge,
* publish, distribute, sublicense, and/or sell copies of the Materials,
* and to permit persons to whom the Materials are furnished to do so,
* subject to the following conditions:
*
* The above copyright notice and this permission notice shall be included
* in all copies or substantial portions of the Materials.
*
* THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
* IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
* DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
* OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
* THE USE OR OTHER DEALINGS IN THE MATERIALS.
*
*//**
* \file
* \brief VG platform specific header
*//*-------------------------------------------------------------------*/
#ifndef _VGPLATFORM_H
#define _VGPLATFORM_H
#include <KHR/khrplatform.h>
#ifdef __cplusplus
extern "C" {
#endif
#ifndef VG_API_CALL
#if defined(OPENVG_STATIC_LIBRARY)
# define VG_API_CALL
#else
# define VG_API_CALL KHRONOS_APICALL
#endif /* defined OPENVG_STATIC_LIBRARY */
#endif /* ifndef VG_API_CALL */
#ifndef VGU_API_CALL
#if defined(OPENVG_STATIC_LIBRARY)
# define VGU_API_CALL
#else
# define VGU_API_CALL KHRONOS_APICALL
#endif /* defined OPENVG_STATIC_LIBRARY */
#endif /* ifndef VGU_API_CALL */
#ifndef VG_API_ENTRY
#define VG_API_ENTRY
#endif
#ifndef VG_API_EXIT
#define VG_API_EXIT
#endif
#ifndef VGU_API_ENTRY
#define VGU_API_ENTRY
#endif
#ifndef VGU_API_EXIT
#define VGU_API_EXIT
#endif
typedef float VGfloat;
typedef signed char VGbyte;
typedef unsigned char VGubyte;
typedef signed short VGshort;
typedef signed int VGint;
typedef unsigned int VGuint;
typedef unsigned int VGbitfield;
#ifndef VG_VGEXT_PROTOTYPES
#define VG_VGEXT_PROTOTYPES
#endif
#ifdef __cplusplus
} /* extern "C" */
#endif
#endif /* _VGPLATFORM_H */

View File

@@ -1,130 +1,131 @@
/* $Revision: 6810 $ on $Date:: 2008-10-29 10:31:37 -0400 #$ */
/*------------------------------------------------------------------------
*
* VGU 1.0.1 Reference Implementation
* -------------------------------------
*
* Copyright (c) 2008 The Khronos Group Inc.
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and /or associated documentation files
* (the "Materials "), to deal in the Materials without restriction,
* including without limitation the rights to use, copy, modify, merge,
* publish, distribute, sublicense, and/or sell copies of the Materials,
* and to permit persons to whom the Materials are furnished to do so,
* subject to the following conditions:
*
* The above copyright notice and this permission notice shall be included
* in all copies or substantial portions of the Materials.
*
* THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
* IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
* DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
* OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
* THE USE OR OTHER DEALINGS IN THE MATERIALS.
*
*//**
* \file
* \brief VGU 1.0.1 API.
*//*-------------------------------------------------------------------*/
#ifndef _VGU_H
#define _VGU_H
#ifdef __cplusplus
extern "C" {
#endif
#include <VG/openvg.h>
#define VGU_VERSION_1_0 1
#ifndef VGU_API_CALL
# error VGU_API_CALL must be defined
#endif
#ifndef VGU_API_ENTRY
# error VGU_API_ENTRY must be defined
#endif
#ifndef VGU_API_EXIT
# error VGU_API_EXIT must be defined
#endif
typedef enum {
VGU_NO_ERROR = 0,
VGU_BAD_HANDLE_ERROR = 0xF000,
VGU_ILLEGAL_ARGUMENT_ERROR = 0xF001,
VGU_OUT_OF_MEMORY_ERROR = 0xF002,
VGU_PATH_CAPABILITY_ERROR = 0xF003,
VGU_BAD_WARP_ERROR = 0xF004,
VGU_ERROR_CODE_FORCE_SIZE = VG_MAX_ENUM
} VGUErrorCode;
typedef enum {
VGU_ARC_OPEN = 0xF100,
VGU_ARC_CHORD = 0xF101,
VGU_ARC_PIE = 0xF102,
VGU_ARC_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGUArcType;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguLine(VGPath path,
VGfloat x0, VGfloat y0,
VGfloat x1, VGfloat y1) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguPolygon(VGPath path,
const VGfloat * points, VGint count,
VGboolean closed) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguRect(VGPath path,
VGfloat x, VGfloat y,
VGfloat width, VGfloat height) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguRoundRect(VGPath path,
VGfloat x, VGfloat y,
VGfloat width, VGfloat height,
VGfloat arcWidth, VGfloat arcHeight) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguEllipse(VGPath path,
VGfloat cx, VGfloat cy,
VGfloat width, VGfloat height) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguArc(VGPath path,
VGfloat x, VGfloat y,
VGfloat width, VGfloat height,
VGfloat startAngle, VGfloat angleExtent,
VGUArcType arcType) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpQuadToSquare(VGfloat sx0, VGfloat sy0,
VGfloat sx1, VGfloat sy1,
VGfloat sx2, VGfloat sy2,
VGfloat sx3, VGfloat sy3,
VGfloat * matrix) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpSquareToQuad(VGfloat dx0, VGfloat dy0,
VGfloat dx1, VGfloat dy1,
VGfloat dx2, VGfloat dy2,
VGfloat dx3, VGfloat dy3,
VGfloat * matrix) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpQuadToQuad(VGfloat dx0, VGfloat dy0,
VGfloat dx1, VGfloat dy1,
VGfloat dx2, VGfloat dy2,
VGfloat dx3, VGfloat dy3,
VGfloat sx0, VGfloat sy0,
VGfloat sx1, VGfloat sy1,
VGfloat sx2, VGfloat sy2,
VGfloat sx3, VGfloat sy3,
VGfloat * matrix) VGU_API_EXIT;
#ifdef __cplusplus
} /* extern "C" */
#endif
#endif /* #ifndef _VGU_H */
/* $Revision: 6810 $ on $Date:: 2008-10-29 07:31:37 -0700 #$ */
/*------------------------------------------------------------------------
*
* VGU 1.1 Reference Implementation
* -------------------------------------
*
* Copyright (c) 2008 The Khronos Group Inc.
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and /or associated documentation files
* (the "Materials "), to deal in the Materials without restriction,
* including without limitation the rights to use, copy, modify, merge,
* publish, distribute, sublicense, and/or sell copies of the Materials,
* and to permit persons to whom the Materials are furnished to do so,
* subject to the following conditions:
*
* The above copyright notice and this permission notice shall be included
* in all copies or substantial portions of the Materials.
*
* THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
* IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
* DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
* OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
* THE USE OR OTHER DEALINGS IN THE MATERIALS.
*
*//**
* \file
* \brief VGU 1.1 API.
*//*-------------------------------------------------------------------*/
#ifndef _VGU_H
#define _VGU_H
#ifdef __cplusplus
extern "C" {
#endif
#include <VG/openvg.h>
#define VGU_VERSION_1_0 1
#define VGU_VERSION_1_1 2
#ifndef VGU_API_CALL
# error VGU_API_CALL must be defined
#endif
#ifndef VGU_API_ENTRY
# error VGU_API_ENTRY must be defined
#endif
#ifndef VGU_API_EXIT
# error VGU_API_EXIT must be defined
#endif
typedef enum {
VGU_NO_ERROR = 0,
VGU_BAD_HANDLE_ERROR = 0xF000,
VGU_ILLEGAL_ARGUMENT_ERROR = 0xF001,
VGU_OUT_OF_MEMORY_ERROR = 0xF002,
VGU_PATH_CAPABILITY_ERROR = 0xF003,
VGU_BAD_WARP_ERROR = 0xF004,
VGU_ERROR_CODE_FORCE_SIZE = VG_MAX_ENUM
} VGUErrorCode;
typedef enum {
VGU_ARC_OPEN = 0xF100,
VGU_ARC_CHORD = 0xF101,
VGU_ARC_PIE = 0xF102,
VGU_ARC_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGUArcType;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguLine(VGPath path,
VGfloat x0, VGfloat y0,
VGfloat x1, VGfloat y1) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguPolygon(VGPath path,
const VGfloat * points, VGint count,
VGboolean closed) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguRect(VGPath path,
VGfloat x, VGfloat y,
VGfloat width, VGfloat height) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguRoundRect(VGPath path,
VGfloat x, VGfloat y,
VGfloat width, VGfloat height,
VGfloat arcWidth, VGfloat arcHeight) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguEllipse(VGPath path,
VGfloat cx, VGfloat cy,
VGfloat width, VGfloat height) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguArc(VGPath path,
VGfloat x, VGfloat y,
VGfloat width, VGfloat height,
VGfloat startAngle, VGfloat angleExtent,
VGUArcType arcType) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpQuadToSquare(VGfloat sx0, VGfloat sy0,
VGfloat sx1, VGfloat sy1,
VGfloat sx2, VGfloat sy2,
VGfloat sx3, VGfloat sy3,
VGfloat * matrix) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpSquareToQuad(VGfloat dx0, VGfloat dy0,
VGfloat dx1, VGfloat dy1,
VGfloat dx2, VGfloat dy2,
VGfloat dx3, VGfloat dy3,
VGfloat * matrix) VGU_API_EXIT;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpQuadToQuad(VGfloat dx0, VGfloat dy0,
VGfloat dx1, VGfloat dy1,
VGfloat dx2, VGfloat dy2,
VGfloat dx3, VGfloat dy3,
VGfloat sx0, VGfloat sy0,
VGfloat sx1, VGfloat sy1,
VGfloat sx2, VGfloat sy2,
VGfloat sx3, VGfloat sy3,
VGfloat * matrix) VGU_API_EXIT;
#ifdef __cplusplus
} /* extern "C" */
#endif
#endif /* #ifndef _VGU_H */

View File

@@ -54,11 +54,13 @@ prefixes32 = SCons.Util.Split("""
i586-mingw32msvc-
i686-mingw32msvc-
i686-pc-mingw32-
i686-w64-mingw32-
""")
prefixes64 = SCons.Util.Split("""
amd64-mingw32-
amd64-mingw32msvc-
amd64-pc-mingw32-
x86_64-w64-mingw32-
""")
def find(env):
@@ -192,5 +194,8 @@ def generate(env):
env.AppendUnique(SHLINKFLAGS = ['-Wl,--enable-stdcall-fixup'])
#env.AppendUnique(SHLINKFLAGS = ['-Wl,--kill-at'])
# Avoid depending on gcc runtime DLLs
env.AppendUnique(LINKFLAGS = ['-static-libgcc'])
def exists(env):
return find(env)

View File

@@ -56,6 +56,8 @@ def quietCommandLines(env):
env['SHLINKCOMSTR'] = " Linking $TARGET ..."
env['LDMODULECOMSTR'] = " Linking $TARGET ..."
env['SWIGCOMSTR'] = " Generating $TARGET ..."
env['LEXCOMSTR'] = " Generating $TARGET ..."
env['YACCCOMSTR'] = " Generating $TARGET ..."
env['CODEGENCOMSTR'] = " Generating $TARGET ..."

217
scons/gallium.py Normal file → Executable file
View File

@@ -35,6 +35,7 @@ import os
import os.path
import re
import subprocess
import platform as _platform
import SCons.Action
import SCons.Builder
@@ -49,30 +50,35 @@ def symlink(target, source, env):
os.symlink(os.path.basename(source), target)
def install(env, source, subdir):
target_dir = os.path.join(env.Dir('#.').srcnode().abspath, env['build'], subdir)
env.Install(target_dir, source)
target_dir = os.path.join(env.Dir('#.').srcnode().abspath, env['build_dir'], subdir)
return env.Install(target_dir, source)
def install_program(env, source):
install(env, source, 'bin')
return install(env, source, 'bin')
def install_shared_library(env, sources, version = ()):
install_dir = os.path.join(env.Dir('#.').srcnode().abspath, env['build'])
targets = []
install_dir = os.path.join(env.Dir('#.').srcnode().abspath, env['build_dir'])
version = tuple(map(str, version))
if env['SHLIBSUFFIX'] == '.dll':
dlls = env.FindIxes(sources, 'SHLIBPREFIX', 'SHLIBSUFFIX')
install(env, dlls, 'bin')
targets += install(env, dlls, 'bin')
libs = env.FindIxes(sources, 'LIBPREFIX', 'LIBSUFFIX')
install(env, libs, 'lib')
targets += install(env, libs, 'lib')
else:
for source in sources:
target_dir = os.path.join(install_dir, 'lib')
target_name = '.'.join((str(source),) + version)
last = env.InstallAs(os.path.join(target_dir, target_name), source)
targets += last
while len(version):
version = version[:-1]
target_name = '.'.join((str(source),) + version)
action = SCons.Action.Action(symlink, "$TARGET -> $SOURCE")
last = env.Command(os.path.join(target_dir, target_name), last, action)
targets += last
return targets
def createInstallMethods(env):
env.AddMethod(install_program, 'InstallProgram')
@@ -98,9 +104,48 @@ def num_jobs():
return 1
def pkg_config_modules(env, name, modules):
'''Simple wrapper for pkg-config.'''
env[name] = False
if env['platform'] == 'windows':
return
if not env.Detect('pkg-config'):
return
if subprocess.call(["pkg-config", "--exists", ' '.join(modules)]) != 0:
return
# Put -I and -L flags directly into the environment, as these don't affect
# the compilation of targets that do not use them
try:
env.ParseConfig('pkg-config --cflags-only-I --libs-only-L ' + ' '.join(modules))
except OSError:
return
# Other flags may affect the compilation of unrelated targets, so store
# them with a prefix, (e.g., XXX_CFLAGS, XXX_LIBS, etc)
try:
flags = env.ParseFlags('!pkg-config --cflags-only-other --libs-only-l --libs-only-other ' + ' '.join(modules))
except OSError:
return
prefix = name.upper() + '_'
for flag_name, flag_value in flags.iteritems():
env[prefix + flag_name] = flag_value
env[name] = True
def generate(env):
"""Common environment generation code"""
# Tell tools which machine to compile for
env['TARGET_ARCH'] = env['machine']
env['MSVS_ARCH'] = env['machine']
# Toolchain
platform = env['platform']
if env['toolchain'] == 'default':
@@ -110,27 +155,36 @@ def generate(env):
env['toolchain'] = 'wcesdk'
env.Tool(env['toolchain'])
if env['platform'] == 'embedded':
# Allow overriding compiler from environment
if os.environ.has_key('CC'):
env['CC'] = os.environ['CC']
# Update CCVERSION to match
pipe = SCons.Action._subproc(env, [env['CC'], '--version'],
stdin = 'devnull',
stderr = 'devnull',
stdout = subprocess.PIPE)
if pipe.wait() == 0:
line = pipe.stdout.readline()
match = re.search(r'[0-9]+(\.[0-9]+)+', line)
if match:
env['CCVERSION'] = match.group(0)
# Allow override compiler and specify additional flags from environment
if os.environ.has_key('CC'):
env['CC'] = os.environ['CC']
# Update CCVERSION to match
pipe = SCons.Action._subproc(env, [env['CC'], '--version'],
stdin = 'devnull',
stderr = 'devnull',
stdout = subprocess.PIPE)
if pipe.wait() == 0:
line = pipe.stdout.readline()
match = re.search(r'[0-9]+(\.[0-9]+)+', line)
if match:
env['CCVERSION'] = match.group(0)
if os.environ.has_key('CFLAGS'):
env['CCFLAGS'] += SCons.Util.CLVar(os.environ['CFLAGS'])
if os.environ.has_key('CXX'):
env['CXX'] = os.environ['CXX']
if os.environ.has_key('CXXFLAGS'):
env['CXXFLAGS'] += SCons.Util.CLVar(os.environ['CXXFLAGS'])
if os.environ.has_key('LDFLAGS'):
env['LINKFLAGS'] += SCons.Util.CLVar(os.environ['LDFLAGS'])
env['gcc'] = 'gcc' in os.path.basename(env['CC']).split('-')
env['msvc'] = env['CC'] == 'cl'
if env['msvc'] and env['toolchain'] == 'default' and env['machine'] == 'x86_64':
# MSVC x64 support is broken in earlier versions of scons
env.EnsurePythonVersion(2, 0)
# shortcuts
debug = env['debug']
machine = env['machine']
platform = env['platform']
x86 = env['machine'] == 'x86'
@@ -138,20 +192,69 @@ def generate(env):
gcc = env['gcc']
msvc = env['msvc']
# Determine whether we are cross compiling; in particular, whether we need
# to compile code generators with a different compiler as the target code.
host_platform = _platform.system().lower()
if host_platform.startswith('cygwin'):
host_platform = 'cygwin'
host_machine = os.environ.get('PROCESSOR_ARCHITEW6432', os.environ.get('PROCESSOR_ARCHITECTURE', _platform.machine()))
host_machine = {
'x86': 'x86',
'i386': 'x86',
'i486': 'x86',
'i586': 'x86',
'i686': 'x86',
'ppc' : 'ppc',
'AMD64': 'x86_64',
'x86_64': 'x86_64',
}.get(host_machine, 'generic')
env['crosscompile'] = platform != host_platform
if machine == 'x86_64' and host_machine != 'x86_64':
env['crosscompile'] = True
env['hostonly'] = False
# Backwards compatability with the debug= profile= options
if env['build'] == 'debug':
if not env['debug']:
print 'scons: warning: debug option is deprecated and will be removed eventually; use instead'
print
print ' scons build=release'
print
env['build'] = 'release'
if env['profile']:
print 'scons: warning: profile option is deprecated and will be removed eventually; use instead'
print
print ' scons build=profile'
print
env['build'] = 'profile'
if False:
# Enforce SConscripts to use the new build variable
env.popitem('debug')
env.popitem('profile')
else:
# Backwards portability with older sconscripts
if env['build'] in ('debug', 'checked'):
env['debug'] = True
env['profile'] = False
if env['build'] == 'profile':
env['debug'] = False
env['profile'] = True
if env['build'] == 'release':
env['debug'] = False
env['profile'] = False
# Put build output in a separate dir, which depends on the current
# configuration. See also http://www.scons.org/wiki/AdvancedBuildExample
build_topdir = 'build'
build_subdir = env['platform']
if env['machine'] != 'generic':
build_subdir += '-' + env['machine']
if env['debug']:
build_subdir += "-debug"
if env['profile']:
build_subdir += "-profile"
if env['build'] != 'release':
build_subdir += '-' + env['build']
build_dir = os.path.join(build_topdir, build_subdir)
# Place the .sconsign file in the build dir too, to avoid issues with
# different scons versions building the same source file
env['build'] = build_dir
env['build_dir'] = build_dir
env.SConsignFile(os.path.join(build_dir, '.sconsign'))
if 'SCONS_CACHE_DIR' in os.environ:
print 'scons: Using build cache in %s.' % (os.environ['SCONS_CACHE_DIR'],)
@@ -163,13 +266,16 @@ def generate(env):
if env.GetOption('num_jobs') <= 1:
env.SetOption('num_jobs', num_jobs())
env.Decider('MD5-timestamp')
env.SetOption('max_drift', 60)
# C preprocessor options
cppdefines = []
if debug:
if env['build'] in ('debug', 'checked'):
cppdefines += ['DEBUG']
else:
cppdefines += ['NDEBUG']
if env['profile']:
if env['build'] == 'profile':
cppdefines += ['PROFILE']
if platform == 'windows':
cppdefines += [
@@ -190,7 +296,7 @@ def generate(env):
'_SCL_SECURE_NO_WARNINGS',
'_SCL_SECURE_NO_DEPRECATE',
]
if debug:
if env['build'] in ('debug', 'checked'):
cppdefines += ['_DEBUG']
if env['toolchain'] == 'winddk':
# Mimic WINDDK's builtin flags. See also:
@@ -217,7 +323,7 @@ def generate(env):
('__BUILDMACHINE__', 'WinDDK'),
('FPO', '0'),
]
if debug:
if env['build'] in ('debug', 'checked'):
cppdefines += [('DBG', 1)]
if platform == 'wince':
cppdefines += [
@@ -253,15 +359,16 @@ def generate(env):
ccflags = [] # C & C++
if gcc:
ccversion = env['CCVERSION']
if debug:
ccflags += ['-O0', '-g3']
if env['build'] == 'debug':
ccflags += ['-O0']
elif ccversion.startswith('4.2.'):
# gcc 4.2.x optimizer is broken
print "warning: gcc 4.2.x optimizer is broken -- disabling optimizations"
ccflags += ['-O0', '-g3']
ccflags += ['-O0']
else:
ccflags += ['-O3', '-g3']
if env['profile']:
ccflags += ['-O3']
ccflags += ['-g3']
if env['build'] in ('checked', 'profile'):
# See http://code.google.com/p/jrfonseca/wiki/Gprof2Dot#Which_options_should_I_pass_to_gcc_when_compiling_for_profiling?
ccflags += [
'-fno-omit-frame-pointer',
@@ -272,12 +379,15 @@ def generate(env):
'-m32',
#'-march=pentium4',
]
if distutils.version.LooseVersion(ccversion) >= distutils.version.LooseVersion('4.2'):
if distutils.version.LooseVersion(ccversion) >= distutils.version.LooseVersion('4.2') \
and (platform != 'windows' or env['build'] == 'debug' or True):
# NOTE: We need to ensure stack is realigned given that we
# produce shared objects, and have no control over the stack
# alignment policy of the application. Therefore we need
# -mstackrealign ore -mincoming-stack-boundary=2.
#
# XXX: -O and -mstackrealign causes stack corruption on MinGW
#
# XXX: We could have SSE without -mstackrealign if we always used
# __attribute__((force_align_arg_pointer)), but that's not
# always the case.
@@ -320,18 +430,24 @@ def generate(env):
# See also:
# - http://msdn.microsoft.com/en-us/library/19z1t1wy.aspx
# - cl /?
if debug:
if env['build'] == 'debug':
ccflags += [
'/Od', # disable optimizations
'/Oi', # enable intrinsic functions
'/Oy-', # disable frame pointer omission
'/GL-', # disable whole program optimization
]
else:
ccflags += [
'/O2', # optimize for speed
]
if env['build'] == 'release':
ccflags += [
'/GL', # enable whole program optimization
]
else:
ccflags += [
'/GL-', # disable whole program optimization
]
ccflags += [
'/fp:fast', # fast floating point
'/W3', # warning level
@@ -389,7 +505,7 @@ def generate(env):
if env['platform'] == 'windows' and msvc:
# Choose the appropriate MSVC CRT
# http://msdn.microsoft.com/en-us/library/2kzt1wy3.aspx
if env['debug']:
if env['build'] in ('debug', 'checked'):
env.Append(CCFLAGS = ['/MTd'])
env.Append(SHCCFLAGS = ['/LDd'])
else:
@@ -421,7 +537,7 @@ def generate(env):
else:
env['_LIBFLAGS'] = '-Wl,--start-group ' + env['_LIBFLAGS'] + ' -Wl,--end-group'
if msvc:
if not env['debug']:
if env['build'] == 'release':
# enable Link-time Code Generation
linkflags += ['/LTCG']
env.Append(ARFLAGS = ['/LTCG'])
@@ -460,7 +576,7 @@ def generate(env):
'/entry:DrvEnableDriver',
]
if env['debug'] or env['profile']:
if env['build'] != 'release':
linkflags += [
'/MAP', # http://msdn.microsoft.com/en-us/library/k7xkk3e2.aspx
]
@@ -474,12 +590,27 @@ def generate(env):
env.Append(LINKFLAGS = linkflags)
env.Append(SHLINKFLAGS = shlinkflags)
# We have C++ in several libraries, so always link with the C++ compiler
if env['gcc']:
env['LINK'] = env['CXX']
# Default libs
env.Append(LIBS = [])
# Load LLVM
# Load tools
env.Tool('lex')
env.Tool('yacc')
if env['llvm']:
env.Tool('llvm')
pkg_config_modules(env, 'x11', ['x11', 'xext'])
pkg_config_modules(env, 'drm', ['libdrm'])
pkg_config_modules(env, 'drm_intel', ['libdrm_intel'])
pkg_config_modules(env, 'drm_radeon', ['libdrm_radeon'])
pkg_config_modules(env, 'xorg', ['xorg-server'])
pkg_config_modules(env, 'kms', ['libkms'])
env['dri'] = env['x11'] and env['drm']
# Custom builders and methods
env.Tool('custom')

View File

@@ -38,6 +38,8 @@ import SCons.Util
def generate(env):
env['llvm'] = False
try:
llvm_dir = os.environ['LLVM']
except KeyError:
@@ -64,13 +66,13 @@ def generate(env):
# XXX: There is no llvm-config on Windows, so assume a standard layout
if llvm_dir is None:
print 'scons: LLVM environment variable must be specified when building for windows'
env.Exit(1)
return
# Try to determine the LLVM version from llvm/Config/config.h
llvm_config = os.path.join(llvm_dir, 'include/llvm/Config/config.h')
if not os.path.exists(llvm_config):
print 'scons: could not find %s' % llvm_config
env.Exit(1)
return
llvm_version_re = re.compile(r'^#define PACKAGE_VERSION "([^"]*)"')
llvm_version = None
for line in open(llvm_config, 'rt'):
@@ -81,7 +83,7 @@ def generate(env):
break
if llvm_version is None:
print 'scons: could not determine the LLVM version from %s' % llvm_config
env.Exit(1)
return
env.Prepend(CPPPATH = [os.path.join(llvm_dir, 'include')])
env.AppendUnique(CPPDEFINES = [
@@ -124,7 +126,7 @@ def generate(env):
# Some of the LLVM C headers use the inline keyword without
# defining it.
env.Append(CPPDEFINES = [('inline', '__inline')])
if env['debug']:
if env['build'] in ('debug', 'checked'):
# LLVM libraries are static, build with /MT, and they
# automatically link agains LIBCMT. When we're doing a
# debug build we'll be linking against LIBCMTD, so disable
@@ -133,22 +135,21 @@ def generate(env):
else:
if not env.Detect('llvm-config'):
print 'scons: llvm-config script not found' % llvm_version
env.Exit(1)
return
llvm_version = env.backtick('llvm-config --version').rstrip()
llvm_version = distutils.version.LooseVersion(llvm_version)
try:
env.ParseConfig('llvm-config --cppflags')
env.ParseConfig('llvm-config --libs jit interpreter nativecodegen bitwriter')
env.ParseConfig('llvm-config --libs')
env.ParseConfig('llvm-config --ldflags')
except OSError:
print 'scons: llvm-config version %s failed' % llvm_version
env.Exit(1)
else:
env['LINK'] = env['CXX']
return
assert llvm_version is not None
env['llvm'] = True
print 'scons: Found LLVM version %s' % llvm_version
env['LLVM_VERSION'] = llvm_version

View File

@@ -1,42 +0,0 @@
"""udis86
Tool-specific initialization for udis86
"""
#
# Copyright (c) 2009 VMware, Inc.
#
# Permission is hereby granted, free of charge, to any person obtaining
# a copy of this software and associated documentation files (the
# "Software"), to deal in the Software without restriction, including
# without limitation the rights to use, copy, modify, merge, publish,
# distribute, sublicense, and/or sell copies of the Software, and to
# permit persons to whom the Software is furnished to do so, subject to
# the following conditions:
#
# The above copyright notice and this permission notice shall be included
# in all copies or substantial portions of the Software.
#
# THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY
# KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE
# WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND
# NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE
# LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION
# OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION
# WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
#
def generate(env):
conf = env.Configure()
if conf.CheckHeader('udis86.h'): # and conf.CheckLib('udis86'):
env.Append(CPPDEFINES = [('HAVE_UDIS86', '1')])
env.Prepend(LIBS = ['udis86'])
conf.Finish()
def exists(env):
return True
# vim:set ts=4 sw=4 et:

View File

@@ -122,7 +122,7 @@ def get_wce600_paths(env):
host_cpu = os.environ.get('_HOSTCPUTYPE', 'i386')
target_cpu = os.environ.get('_TGTCPU', 'x86')
if env['debug']:
if env['build'] == 'debug':
build = 'debug'
else:
build = 'retail'

115
src/Android.mk Normal file
View File

@@ -0,0 +1,115 @@
# Either one of, or both of, MESA_BUILD_CLASSIC and MESA_BUILD_GALLIUM must be
# set. When MESA_BUILD_GALLIUM is not set, EGL consists of
#
# libmesa_classic_egl
# libmesa_egl
#
# and the rules for it can be found in egl/drivers/android/Android.mk.
#
# When MESA_BUILD_GALLIUM is set, EGL consists of
#
# libmesa_st_egl
# libmesa_egl
# libmesa_st_mesa
# libmesa_pipe_<DRIVER>
# libmesa_winsys_<DRIVER>
# libmesa_gallium
# <plus libmesa_classic_egl if MESA_BUILD_CLASSIC is also set>
#
# and the rules for it can be found in gallium/targets/Android.mk
#
# When MESA_BUILD_CLASSIC is set, DRI drivers are created. A DRI driver
# consists of
#
# libmesa_classic_mesa
# libmesa_glsl
# <driver-specific objects>
#
# and the rules for it can be found in mesa/drivers/Android.mk.
#
# As for gralloc, the goal is to provide a single module that is able to
# detect and support the hardware. This is not the case yet though.
LOCAL_PATH := $(call my-dir)
# DRI drivers
MESA_BUILD_CLASSIC := false
MESA_BUILD_I915C := false
MESA_BUILD_I965C := false
# Gallium drivers
MESA_BUILD_GALLIUM := false
MESA_BUILD_I915G := false
MESA_BUILD_R600G := false
MESA_BUILD_SWRAST := false
# gralloc modules
MESA_BUILD_INTEL := false
MESA_BUILD_RADEON := false
MESA_BUILD_VMWGFX := false
MESA_DO_BUILD := false
ifeq ($(strip $(BOARD_USES_I915C)),true)
MESA_BUILD_CLASSIC := true
MESA_BUILD_I915C := true
# gralloc
MESA_BUILD_INTEL := true
MESA_DO_BUILD := true
endif
ifeq ($(strip $(BOARD_USES_I915G)),true)
MESA_BUILD_GALLIUM := true
MESA_BUILD_I915G := true
# gralloc
MESA_BUILD_INTEL := true
MESA_DO_BUILD := true
endif
ifeq ($(strip $(BOARD_USES_I965C)),true)
MESA_BUILD_CLASSIC := true
MESA_BUILD_I965C := true
# gralloc
MESA_BUILD_INTEL := true
MESA_DO_BUILD := true
endif
ifeq ($(strip $(BOARD_USES_R600G)),true)
MESA_BUILD_GALLIUM := true
MESA_BUILD_R600G := true
# gralloc
MESA_BUILD_RADEON := true
MESA_DO_BUILD := true
endif
ifeq ($(strip $(BOARD_USES_VMWGFX)),true)
MESA_BUILD_GALLIUM := true
MESA_BUILD_SWRAST := true
# gralloc
MESA_BUILD_VMWGFX := true
MESA_DO_BUILD := true
endif
ifeq ($(strip $(MESA_DO_BUILD)),true)
# build the real modules
include $(call all-subdir-makefiles)
include $(CLEAR_VARS)
symlink := $(TARGET_OUT_SHARED_LIBRARIES)/hw/gralloc.$(TARGET_PRODUCT)$(TARGET_SHLIB_SUFFIX)
symlink_to := gralloc.mesa$(TARGET_SHLIB_SUFFIX)
$(symlink): PRIVATE_TO := $(symlink_to)
$(symlink): $(TARGET_OUT_SHARED_LIBRARIES)/hw/$(symlink_to)
@echo "Symlink: $@ -> $(PRIVATE_TO)"
@mkdir -p $(dir $@)
@rm -rf $@
$(hide) ln -sf $(PRIVATE_TO) $@
ALL_PREBUILT += $(symlink)
endif # MESA_DO_BUILD

View File

@@ -1,19 +1,32 @@
Import('*')
if 'egl' in env['statetrackers']:
SConscript('mapi/vgapi/SConscript')
if env['platform'] == 'windows':
SConscript('getopt/SConscript')
SConscript('glsl/SConscript')
if env['hostonly']:
# We are just compiling the things necessary on the host for cross
# compilation
Return()
# When env['gles'] is set, the targets defined in mapi/glapi/SConscript are not
# used. libgl-xlib and libgl-gdi adapt themselves to use the targets defined
# in mapi/glapi-shared/SConscript. mesa/SConscript also adapts itself to
# enable OpenGL ES support.
SConscript('mapi/glapi/SConscript')
SConscript('mesa/SConscript')
SConscript('mapi/vgapi/SConscript')
if env['platform'] != 'embedded':
SConscript('egl/main/SConscript')
SConscript('glut/glx/SConscript')
if 'mesa' in env['statetrackers']:
if platform == 'windows':
SConscript('talloc/SConscript')
SConscript('glsl/SConscript')
SConscript('mapi/glapi/SConscript')
SConscript('mesa/SConscript')
if platform != 'embedded':
SConscript('glut/glx/SConscript')
if env['gles']:
SConscript('mapi/shared-glapi/SConscript')
SConscript('gallium/SConscript')

111
src/egl/Android.mk Normal file
View File

@@ -0,0 +1,111 @@
# Android.mk for EGL
LOCAL_PATH := $(call my-dir)
include $(CLEAR_VARS)
# from main/Makefile
SOURCES = \
eglapi.c \
eglarray.c \
eglconfig.c \
eglcontext.c \
eglcurrent.c \
egldisplay.c \
egldriver.c \
eglfallbacks.c \
eglglobals.c \
eglimage.c \
egllog.c \
eglmisc.c \
eglmode.c \
eglscreen.c \
eglstring.c \
eglsurface.c \
eglsync.c
LOCAL_SRC_FILES := \
$(addprefix main/, $(SOURCES))
LOCAL_CFLAGS := \
-DPTHREADS \
-D_EGL_NATIVE_PLATFORM=_EGL_PLATFORM_ANDROID \
-D_EGL_DRIVER_SEARCH_DIR=\"/system/lib/egl\" \
-D_EGL_OS_UNIX=1 \
-fvisibility=hidden \
-Wno-sign-compare
ifeq ($(strip $(MESA_BUILD_CLASSIC)),true)
LOCAL_CFLAGS += -D_EGL_BUILT_IN_DRIVER_ANDROID
endif
ifeq ($(strip $(MESA_BUILD_GALLIUM)),true)
LOCAL_CFLAGS += -D_EGL_BUILT_IN_DRIVER_GALLIUM
endif
LOCAL_C_INCLUDES := \
external/mesa/include
LOCAL_MODULE := libmesa_egl
include $(BUILD_STATIC_LIBRARY)
ifeq ($(strip $(MESA_BUILD_CLASSIC)),true)
include $(CLEAR_VARS)
LOCAL_SRC_FILES := \
drivers/android/egl_android.c \
drivers/android/droid.c \
drivers/android/droid_core.c \
drivers/android/droid_image.c
LOCAL_CFLAGS := \
-D_EGL_MAIN=_eglBuiltInDriverANDROID \
-DDEFAULT_DRIVER_DIR=\"/system/lib/dri\" \
-DPTHREADS \
-fvisibility=hidden \
-Wno-sign-compare
LOCAL_C_INCLUDES := \
external/mesa/include \
external/mesa/src/mapi \
external/mesa/src/egl/main \
external/mesa/src/gralloc \
external/drm \
external/drm/include/drm \
external/mesa/src/mesa/drivers \
external/mesa/src/gallium/include \
external/mesa/src/gallium/winsys
LOCAL_MODULE := libmesa_classic_egl
include $(BUILD_STATIC_LIBRARY)
# build libGLES if gallium is not enabled
ifneq ($(strip $(MESA_BUILD_GALLIUM)),true)
include $(CLEAR_VARS)
LOCAL_SRC_FILES :=
LOCAL_CFLAGS :=
LOCAL_C_INCLUDES :=
LOCAL_STATIC_LIBRARIES :=
LOCAL_WHOLE_STATIC_LIBRARIES := \
libmesa_classic_egl \
libmesa_egl
LOCAL_SHARED_LIBRARIES := \
libglapi \
libdrm \
libdl \
libhardware \
liblog \
libcutils
LOCAL_MODULE := libGLES_mesa
LOCAL_MODULE_PATH := $(TARGET_OUT_SHARED_LIBRARIES)/egl
include $(BUILD_SHARED_LIBRARY)
endif # MESA_BUILD_GALLIUM
endif # MESA_BUILD_CLASSIC

View File

@@ -3,8 +3,13 @@
TOP = ../..
include $(TOP)/configs/current
SUBDIRS = main drivers
SUBDIRS =
ifneq ($(findstring wayland, $(EGL_PLATFORMS)),)
SUBDIRS += wayland
endif
SUBDIRS += drivers main
default: subdirs

View File

@@ -2,6 +2,7 @@
#
# Drivers should define
#
# EGL_BUILTIN, the driver is built-in or external
# EGL_DRIVER, the driver name
# EGL_SOURCES, the driver sources
# EGL_INCLUDES, the include pathes
@@ -12,32 +13,45 @@
#
EGL_DRIVER_PATH = $(TOP)/$(LIB_DIR)/egl/$(EGL_DRIVER)
EGL_DRIVER_PATH = $(TOP)/$(LIB_DIR)/egl/$(EGL_DRIVER).so
EGL_OBJECTS = $(EGL_SOURCES:.c=.o)
# built-in or external
ifeq ($(EGL_BUILTIN),true)
EGL_TARGET = lib$(EGL_DRIVER).a
EGL_INSTALL =
else
EGL_TARGET = $(EGL_DRIVER_PATH)
EGL_INSTALL = install-so
endif
default: depend $(EGL_DRIVER_PATH)
default: depend $(EGL_TARGET)
$(EGL_DRIVER_PATH): $(EGL_DRIVER)
$(EGL_DRIVER_PATH): $(EGL_DRIVER).so
@$(INSTALL) -d $(TOP)/$(LIB_DIR)/egl
$(INSTALL) $< $(TOP)/$(LIB_DIR)/egl
$(EGL_DRIVER): $(EGL_OBJECTS) Makefile $(TOP)/src/egl/drivers/Makefile.template
@$(MKLIB) -o $(EGL_DRIVER) -noprefix \
-linker '$(CC)' -ldflags '$(LDFLAGS)' \
-L$(TOP)/$(LIB_DIR) $(MKLIB_OPTIONS) \
$(EGL_DRIVER).so: $(EGL_OBJECTS) Makefile $(TOP)/src/egl/drivers/Makefile.template
@$(MKLIB) -o $(EGL_DRIVER).so -noprefix \
-linker '$(CC)' -ldflags '-L$(TOP)/$(LIB_DIR) $(LDFLAGS)' \
$(MKLIB_OPTIONS) \
$(EGL_OBJECTS) $(EGL_LIBS) -l$(EGL_LIB)
lib$(EGL_DRIVER).a: $(EGL_OBJECTS) Makefile $(TOP)/src/egl/drivers/Makefile.template
@$(MKLIB) -o $(EGL_DRIVER) -static $(EGL_OBJECTS)
.c.o:
$(CC) -c $(EGL_INCLUDES) $(CFLAGS) $(EGL_CFLAGS) $< -o $@
install: $(EGL_DRIVER_PATH)
install-so: $(EGL_DRIVER_PATH)
$(INSTALL) -d $(DESTDIR)$(EGL_DRIVER_INSTALL_DIR)
$(MINSTALL) $(EGL_DRIVER_PATH) $(DESTDIR)$(EGL_DRIVER_INSTALL_DIR)
install: $(EGL_INSTALL)
clean:
rm -f $(EGL_DRIVER)
rm -f $(EGL_DRIVER).so
rm -f lib$(EGL_DRIVER).a
rm -f $(EGL_OBJECTS)
rm -f depend depend.bak

View File

@@ -0,0 +1,762 @@
/*
* Copyright © 2010 Intel Corporation
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and associated documentation files (the "Software"),
* to deal in the Software without restriction, including without limitation
* the rights to use, copy, modify, merge, publish, distribute, sublicense,
* and/or sell copies of the Software, and to permit persons to whom the
* Software is furnished to do so, subject to the following conditions:
*
* The above copyright notice and this permission notice (including the next
* paragraph) shall be included in all copies or substantial portions of the
* Software.
*
* THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND
* NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT
* HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY,
* WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
* OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER
* DEALINGS IN THE SOFTWARE.
*
* Authors:
* Kristian Høgsberg <krh@bitplanet.net>
*/
#define LOG_TAG "MESA-EGL"
#include <stdlib.h>
#include <string.h>
#include <dlfcn.h>
#include <cutils/log.h>
#include "droid.h"
static const __DRIuseInvalidateExtension use_invalidate = {
{ __DRI_USE_INVALIDATE, 1 }
};
static __DRIimage *
droid_lookup_egl_image(__DRIscreen *screen, void *image, void *data)
{
_EGLDisplay *disp = data;
struct droid_egl_image *dimg;
_EGLImage *img;
(void) screen;
img = _eglLookupImage(image, disp);
if (img == NULL) {
_eglError(EGL_BAD_PARAMETER, "droid_lookup_egl_image");
return NULL;
}
dimg = droid_egl_image(image);
return dimg->dri_image;
}
static const __DRIimageLookupExtension image_lookup_extension = {
{ __DRI_IMAGE_LOOKUP, 1 },
droid_lookup_egl_image
};
static int
get_format_bpp(int native)
{
int bpp;
/* see libpixelflinger/format.cpp */
switch (native) {
case GGL_PIXEL_FORMAT_RGBA_8888:
case GGL_PIXEL_FORMAT_RGBX_8888:
case GGL_PIXEL_FORMAT_BGRA_8888:
bpp = 4;
break;
case GGL_PIXEL_FORMAT_RGB_888:
bpp = 3;
break;
case GGL_PIXEL_FORMAT_RGB_565:
case GGL_PIXEL_FORMAT_RGBA_5551:
case GGL_PIXEL_FORMAT_RGBA_4444:
case GGL_PIXEL_FORMAT_LA_88:
bpp = 2;
break;
case GGL_PIXEL_FORMAT_RGB_332:
case GGL_PIXEL_FORMAT_A_8:
case GGL_PIXEL_FORMAT_L_8:
bpp = 1;
break;
default:
bpp = 0;
break;
}
return bpp;
}
#include <gralloc_gem.h>
int
get_native_buffer_name(struct android_native_buffer_t *buf)
{
struct drm_bo_t *bo;
bo = drm_gem_get(buf->handle);
return (bo) ? bo->name : 0;
}
EGLBoolean
droid_dequeue_buffer(struct droid_egl_surface *dsurf)
{
__DRIbuffer *buf = &dsurf->dri_buffer;
if (dsurf->window->dequeueBuffer(dsurf->window, &dsurf->buffer))
return EGL_FALSE;
dsurf->buffer->common.incRef(&dsurf->buffer->common);
dsurf->window->lockBuffer(dsurf->window, dsurf->buffer);
buf->attachment = __DRI_BUFFER_FAKE_FRONT_LEFT;
buf->name = get_native_buffer_name(dsurf->buffer);
buf->cpp = get_format_bpp(dsurf->buffer->format);
buf->pitch = dsurf->buffer->stride * buf->cpp;
buf->flags = 0;
return EGL_TRUE;
}
EGLBoolean
droid_enqueue_buffer(struct droid_egl_surface *dsurf)
{
dsurf->window->queueBuffer(dsurf->window, dsurf->buffer);
dsurf->buffer->common.decRef(&dsurf->buffer->common);
dsurf->buffer = NULL;
return EGL_TRUE;
}
static void
droid_flush_front_buffer(__DRIdrawable * driDrawable, void *loaderPrivate)
{
}
static __DRIbuffer *
droid_get_buffers_with_format(__DRIdrawable * driDrawable,
int *width, int *height,
unsigned int *attachments, int count,
int *out_count, void *loaderPrivate)
{
struct droid_egl_surface *dsurf = loaderPrivate;
struct droid_egl_display *ddpy =
droid_egl_display(dsurf->base.Resource.Display);
if (!dsurf->buffer) {
if (!droid_dequeue_buffer(dsurf))
return NULL;
}
dsurf->base.Width = dsurf->buffer->width;
dsurf->base.Height = dsurf->buffer->height;
if (width)
*width = dsurf->buffer->width;
if (height)
*height = dsurf->buffer->height;
*out_count = 1;
return &dsurf->dri_buffer;
}
static const EGLint droid_to_egl_attribute_map[] = {
0,
EGL_BUFFER_SIZE, /* __DRI_ATTRIB_BUFFER_SIZE */
EGL_LEVEL, /* __DRI_ATTRIB_LEVEL */
EGL_RED_SIZE, /* __DRI_ATTRIB_RED_SIZE */
EGL_GREEN_SIZE, /* __DRI_ATTRIB_GREEN_SIZE */
EGL_BLUE_SIZE, /* __DRI_ATTRIB_BLUE_SIZE */
EGL_LUMINANCE_SIZE, /* __DRI_ATTRIB_LUMINANCE_SIZE */
EGL_ALPHA_SIZE, /* __DRI_ATTRIB_ALPHA_SIZE */
0, /* __DRI_ATTRIB_ALPHA_MASK_SIZE */
EGL_DEPTH_SIZE, /* __DRI_ATTRIB_DEPTH_SIZE */
EGL_STENCIL_SIZE, /* __DRI_ATTRIB_STENCIL_SIZE */
0, /* __DRI_ATTRIB_ACCUM_RED_SIZE */
0, /* __DRI_ATTRIB_ACCUM_GREEN_SIZE */
0, /* __DRI_ATTRIB_ACCUM_BLUE_SIZE */
0, /* __DRI_ATTRIB_ACCUM_ALPHA_SIZE */
EGL_SAMPLE_BUFFERS, /* __DRI_ATTRIB_SAMPLE_BUFFERS */
EGL_SAMPLES, /* __DRI_ATTRIB_SAMPLES */
0, /* __DRI_ATTRIB_RENDER_TYPE, */
0, /* __DRI_ATTRIB_CONFIG_CAVEAT */
0, /* __DRI_ATTRIB_CONFORMANT */
0, /* __DRI_ATTRIB_DOUBLE_BUFFER */
0, /* __DRI_ATTRIB_STEREO */
0, /* __DRI_ATTRIB_AUX_BUFFERS */
0, /* __DRI_ATTRIB_TRANSPARENT_TYPE */
0, /* __DRI_ATTRIB_TRANSPARENT_INDEX_VALUE */
0, /* __DRI_ATTRIB_TRANSPARENT_RED_VALUE */
0, /* __DRI_ATTRIB_TRANSPARENT_GREEN_VALUE */
0, /* __DRI_ATTRIB_TRANSPARENT_BLUE_VALUE */
0, /* __DRI_ATTRIB_TRANSPARENT_ALPHA_VALUE */
0, /* __DRI_ATTRIB_FLOAT_MODE */
0, /* __DRI_ATTRIB_RED_MASK */
0, /* __DRI_ATTRIB_GREEN_MASK */
0, /* __DRI_ATTRIB_BLUE_MASK */
0, /* __DRI_ATTRIB_ALPHA_MASK */
EGL_MAX_PBUFFER_WIDTH, /* __DRI_ATTRIB_MAX_PBUFFER_WIDTH */
EGL_MAX_PBUFFER_HEIGHT, /* __DRI_ATTRIB_MAX_PBUFFER_HEIGHT */
EGL_MAX_PBUFFER_PIXELS, /* __DRI_ATTRIB_MAX_PBUFFER_PIXELS */
0, /* __DRI_ATTRIB_OPTIMAL_PBUFFER_WIDTH */
0, /* __DRI_ATTRIB_OPTIMAL_PBUFFER_HEIGHT */
0, /* __DRI_ATTRIB_VISUAL_SELECT_GROUP */
0, /* __DRI_ATTRIB_SWAP_METHOD */
EGL_MAX_SWAP_INTERVAL, /* __DRI_ATTRIB_MAX_SWAP_INTERVAL */
EGL_MIN_SWAP_INTERVAL, /* __DRI_ATTRIB_MIN_SWAP_INTERVAL */
0, /* __DRI_ATTRIB_BIND_TO_TEXTURE_RGB */
0, /* __DRI_ATTRIB_BIND_TO_TEXTURE_RGBA */
0, /* __DRI_ATTRIB_BIND_TO_MIPMAP_TEXTURE */
0, /* __DRI_ATTRIB_BIND_TO_TEXTURE_TARGETS */
EGL_Y_INVERTED_NOK, /* __DRI_ATTRIB_YINVERTED */
0, /* __DRI_ATTRIB_FRAMEBUFFER_SRGB_CAPABLE */
};
static struct droid_egl_config *
droid_add_config(_EGLDisplay *dpy, const __DRIconfig *dri_config, int id,
int depth, EGLint surface_type, int rgba_masks[4])
{
struct droid_egl_config *conf;
struct droid_egl_display *ddpy;
_EGLConfig base;
unsigned int attrib, value, double_buffer;
EGLint key;
int dri_masks[4] = { 0, 0, 0, 0 };
int i;
ddpy = dpy->DriverData;
_eglInitConfig(&base, dpy, id);
i = 0;
double_buffer = 0;
while (ddpy->core->indexConfigAttrib(dri_config, i++, &attrib, &value)) {
switch (attrib) {
case __DRI_ATTRIB_RENDER_TYPE:
if (value & __DRI_ATTRIB_RGBA_BIT)
value = EGL_RGB_BUFFER;
else if (value & __DRI_ATTRIB_LUMINANCE_BIT)
value = EGL_LUMINANCE_BUFFER;
else
assert(0);
_eglSetConfigKey(&base, EGL_COLOR_BUFFER_TYPE, value);
break;
case __DRI_ATTRIB_CONFIG_CAVEAT:
if (value & __DRI_ATTRIB_NON_CONFORMANT_CONFIG)
value = EGL_NON_CONFORMANT_CONFIG;
else if (value & __DRI_ATTRIB_SLOW_BIT)
value = EGL_SLOW_CONFIG;
else
value = EGL_NONE;
_eglSetConfigKey(&base, EGL_CONFIG_CAVEAT, value);
break;
case __DRI_ATTRIB_DOUBLE_BUFFER:
double_buffer = value;
break;
case __DRI_ATTRIB_RED_MASK:
dri_masks[0] = value;
break;
case __DRI_ATTRIB_GREEN_MASK:
dri_masks[1] = value;
break;
case __DRI_ATTRIB_BLUE_MASK:
dri_masks[2] = value;
break;
case __DRI_ATTRIB_ALPHA_MASK:
dri_masks[3] = value;
break;
default:
key = droid_to_egl_attribute_map[attrib];
if (key != 0)
_eglSetConfigKey(&base, key, value);
break;
}
}
/* In EGL, double buffer or not isn't a config attribute. Pixmaps
* surfaces are always single buffered, pbuffer surfaces are always
* back buffers and windows can be either, selected by passing an
* attribute at window surface construction time. To support this
* we ignore all double buffer configs and manipulate the buffer we
* return in the getBuffer callback to get the behaviour we want. */
if (double_buffer)
return NULL;
if (depth > 0 && depth != _eglGetConfigKey(&base, EGL_BUFFER_SIZE))
return NULL;
if (memcmp(dri_masks, rgba_masks, sizeof(rgba_masks)))
return NULL;
_eglSetConfigKey(&base, EGL_NATIVE_RENDERABLE, EGL_TRUE);
_eglSetConfigKey(&base, EGL_SURFACE_TYPE, surface_type);
_eglSetConfigKey(&base, EGL_RENDERABLE_TYPE, dpy->ClientAPIs);
_eglSetConfigKey(&base, EGL_CONFORMANT, dpy->ClientAPIs);
if (!_eglValidateConfig(&base, EGL_FALSE)) {
_eglLog(_EGL_DEBUG, "DRI2: failed to validate config %d", id);
return NULL;
}
conf = calloc(1, sizeof(*conf));
if (conf != NULL) {
memcpy(&conf->base, &base, sizeof(base));
conf->dri_config = dri_config;
_eglLinkConfig(&conf->base);
}
return conf;
}
static EGLBoolean
droid_add_configs_for_visuals(_EGLDriver *drv, _EGLDisplay *dpy)
{
struct droid_egl_display *ddpy = droid_egl_display(dpy);
const struct {
int format;
int size;
int rgba_masks[4];
} visuals[] = {
{ GGL_PIXEL_FORMAT_RGBA_8888, 32, { 0xff, 0xff00, 0xff0000, 0xff000000 } },
{ GGL_PIXEL_FORMAT_RGBX_8888, 32, { 0xff, 0xff00, 0xff0000, 0x0 } },
{ GGL_PIXEL_FORMAT_RGB_888, 24, { 0xff, 0xff00, 0xff0000, 0x0 } },
{ GGL_PIXEL_FORMAT_RGB_565, 16, { 0xf800, 0x7e0, 0x1f, 0x0 } },
{ GGL_PIXEL_FORMAT_BGRA_8888, 32, { 0xff0000, 0xff00, 0xff, 0xff000000 } },
{ GGL_PIXEL_FORMAT_A_8, 8, { 0xf800, 0x7e0, 0x1f, 0x0 } },
{ 0, 0, { 0, 0, 0, 0 } }
};
int count, i, j;
count = 0;
for (i = 0; visuals[i].format; i++) {
int format_count = 0;
for (j = 0; ddpy->dri_configs[j]; j++) {
struct droid_egl_config *dconf;
dconf = droid_add_config(dpy, ddpy->dri_configs[j], count + 1,
visuals[i].size, EGL_WINDOW_BIT, visuals[i].rgba_masks);
if (dconf) {
_eglSetConfigKey(&dconf->base,
EGL_NATIVE_VISUAL_TYPE, visuals[i].format);
count++;
format_count++;
}
}
if (!format_count) {
_eglLog(_EGL_DEBUG, "No DRI config supports native format 0x%x",
visuals[i].format);
}
}
return (count != 0);
}
struct droid_extension_match {
const char *name;
int version;
int offset;
};
static struct droid_extension_match droid_driver_extensions[] = {
{ __DRI_CORE, 1, offsetof(struct droid_egl_display, core) },
{ __DRI_DRI2, 1, offsetof(struct droid_egl_display, dri2) },
{ NULL, 0, 0 }
};
static struct droid_extension_match droid_core_extensions[] = {
{ __DRI2_FLUSH, 1, offsetof(struct droid_egl_display, flush) },
{ __DRI_IMAGE, 1, offsetof(struct droid_egl_display, image) },
{ NULL, 0, 0 }
};
extern const __DRIextension *__driDriverExtensions[];
static EGLBoolean
droid_bind_extensions(struct droid_egl_display *ddpy,
struct droid_extension_match *matches,
const __DRIextension **extensions)
{
int i, j, ret = EGL_TRUE;
void *field;
for (i = 0; extensions[i]; i++) {
_eglLog(_EGL_DEBUG, "DRI2: found extension `%s'", extensions[i]->name);
for (j = 0; matches[j].name; j++) {
if (strcmp(extensions[i]->name, matches[j].name) == 0 &&
extensions[i]->version >= matches[j].version) {
field = ((char *) ddpy + matches[j].offset);
*(const __DRIextension **) field = extensions[i];
_eglLog(_EGL_INFO, "DRI2: found extension %s version %d",
extensions[i]->name, extensions[i]->version);
}
}
}
for (j = 0; matches[j].name; j++) {
field = ((char *) ddpy + matches[j].offset);
if (*(const __DRIextension **) field == NULL) {
_eglLog(_EGL_FATAL, "DRI2: did not find extension %s version %d",
matches[j].name, matches[j].version);
ret = EGL_FALSE;
}
}
return ret;
}
static EGLBoolean
droid_create_screen(_EGLDisplay *dpy)
{
struct droid_egl_display *ddpy = droid_egl_display(dpy);
const __DRIextension **extensions;
unsigned int api_mask;
ddpy->dri_screen =
ddpy->dri2->createNewScreen(0, ddpy->fd, ddpy->extensions,
&ddpy->dri_configs, dpy);
if (ddpy->dri_screen == NULL) {
_eglLog(_EGL_WARNING, "failed to create dri screen");
return EGL_FALSE;
}
extensions = ddpy->core->getExtensions(ddpy->dri_screen);
if (!droid_bind_extensions(ddpy, droid_core_extensions, extensions)) {
ddpy->core->destroyScreen(ddpy->dri_screen);
return EGL_FALSE;
}
if (ddpy->dri2->base.version >= 2)
api_mask = ddpy->dri2->getAPIMask(ddpy->dri_screen);
else
api_mask = 1 << __DRI_API_OPENGL;
dpy->ClientAPIs = 0;
if (api_mask & (1 <<__DRI_API_OPENGL))
dpy->ClientAPIs |= EGL_OPENGL_BIT;
if (api_mask & (1 <<__DRI_API_GLES))
dpy->ClientAPIs |= EGL_OPENGL_ES_BIT;
if (api_mask & (1 << __DRI_API_GLES2))
dpy->ClientAPIs |= EGL_OPENGL_ES2_BIT;
if (ddpy->dri2->base.version >= 2) {
dpy->Extensions.KHR_surfaceless_gles1 = EGL_TRUE;
dpy->Extensions.KHR_surfaceless_gles2 = EGL_TRUE;
dpy->Extensions.KHR_surfaceless_opengl = EGL_TRUE;
}
return EGL_TRUE;
}
static EGLBoolean
droid_load_driver(_EGLDisplay *dpy, const char *driver_name)
{
struct droid_egl_display *ddpy = droid_egl_display(dpy);
const __DRIextension **extensions;
char path[PATH_MAX], *base = NULL;
void *handle;
if (geteuid() == getuid()) {
/* don't allow setuid apps to use LIBGL_DRIVERS_PATH */
base = getenv("LIBGL_DRIVERS_PATH");
}
if (!base)
base = DEFAULT_DRIVER_DIR;
snprintf(path, sizeof(path), "%s/%s_dri.so", base, driver_name);
handle = dlopen(path, RTLD_NOW | RTLD_GLOBAL);
if (!handle) {
_eglLog(_EGL_WARNING, "DRI2: failed to load %s: %s", path, dlerror());
return EGL_FALSE;
}
_eglLog(_EGL_DEBUG, "DRI2: dlopen(%s)", path);
extensions = dlsym(handle, __DRI_DRIVER_EXTENSIONS);
if (!extensions) {
_eglLog(_EGL_WARNING, "DRI2: driver exports no extensions");
dlclose(handle);
return EGL_FALSE;
}
if (!droid_bind_extensions(ddpy, droid_driver_extensions, extensions)) {
dlclose(handle);
return EGL_FALSE;
}
ddpy->dri_handle = handle;
return EGL_TRUE;
}
#include <xf86drm.h>
/* for i915 */
#include <i915_drm.h>
#include "dri/intel/intel_chipset.h"
/* for radeon */
#include <radeon_drm.h>
#include "radeon/drm/radeon_drm_public.h"
static const char *
droid_get_driver_name(int fd)
{
drmVersionPtr version;
char *name = NULL;
version = drmGetVersion(fd);
if (!version) {
_eglLog(_EGL_WARNING, "invalid drm fd");
return NULL;
}
if (!version->name) {
_eglLog(_EGL_WARNING, "unable to determine the driver name");
drmFreeVersion(version);
return NULL;
}
if (strcmp(version->name, "i915") == 0) {
struct drm_i915_getparam gp;
int id, ret;
memset(&gp, 0, sizeof(gp));
gp.param = I915_PARAM_CHIPSET_ID;
gp.value = &id;
ret = drmCommandWriteRead(fd, DRM_I915_GETPARAM, &gp, sizeof(gp));
if (ret) {
_eglLog(_EGL_WARNING, "failed to get param for i915");
}
else {
name = (IS_965(id)) ? "i965" : "i915";
}
}
else if (strcmp(version->name, "radeon") == 0) {
struct drm_radeon_info info;
int id, ret;
memset(&info, 0, sizeof(info));
info.request = RADEON_INFO_DEVICE_ID;
info.value = (long) &id;
ret = drmCommandWriteRead(fd, DRM_RADEON_INFO, &info, sizeof(info));
if (ret) {
_eglLog(_EGL_WARNING, "failed to get info for radeon");
}
else {
name = (is_r3xx(id)) ? "r300" : "r600";
}
}
drmFreeVersion(version);
return name;
}
static int
droid_open_device(void)
{
const hw_module_t *mod;
int fd = -1, err;
err = hw_get_module(GRALLOC_HARDWARE_MODULE_ID, &mod);
if (!err) {
const gralloc_module_t *gr = (gralloc_module_t *) mod;
err = -EINVAL;
if (gr->perform)
err = gr->perform(gr, GRALLOC_MODULE_PERFORM_GET_DRM_FD, &fd);
}
if (err || fd < 0) {
_eglLog(_EGL_WARNING, "fail to get drm fd");
fd = -1;
}
return fd;
}
static EGLBoolean
droid_initialize_android(_EGLDriver *drv, _EGLDisplay *dpy)
{
struct droid_egl_display *ddpy;
const char *driver_name;
int fd;
fd = droid_open_device();
if (fd < 0)
return EGL_FALSE;
driver_name = droid_get_driver_name(fd);
if (!driver_name)
return EGL_FALSE;
ddpy = calloc(1, sizeof(*ddpy));
if (!ddpy)
return _eglError(EGL_BAD_ALLOC, "eglInitialize");
ddpy->fd = fd;
dpy->DriverData = (void *) ddpy;
if (!droid_load_driver(dpy, driver_name))
return EGL_FALSE;
ddpy->loader_extension.base.name = __DRI_DRI2_LOADER;
ddpy->loader_extension.base.version = 3;
ddpy->loader_extension.getBuffers = NULL;
ddpy->loader_extension.flushFrontBuffer = droid_flush_front_buffer;
ddpy->loader_extension.getBuffersWithFormat =
droid_get_buffers_with_format;
ddpy->extensions[0] = &ddpy->loader_extension.base;
ddpy->extensions[1] = &image_lookup_extension.base;
ddpy->extensions[2] = &use_invalidate.base;
ddpy->extensions[3] = NULL;
if (!droid_create_screen(dpy)) {
free(ddpy);
return EGL_FALSE;
}
if (!droid_add_configs_for_visuals(drv, dpy)) {
ddpy->core->destroyScreen(ddpy->dri_screen);
free(ddpy);
}
dpy->Extensions.ANDROID_image_native_buffer = EGL_TRUE;
dpy->Extensions.KHR_image_base = EGL_TRUE;
/* we're supporting EGL 1.4 */
dpy->VersionMajor = 1;
dpy->VersionMinor = 4;
return EGL_TRUE;
}
static EGLBoolean
droid_terminate(_EGLDriver *drv, _EGLDisplay *dpy)
{
struct droid_egl_display *ddpy = droid_egl_display(dpy);
_eglReleaseDisplayResources(drv, dpy);
_eglCleanupDisplay(dpy);
ddpy->core->destroyScreen(ddpy->dri_screen);
dlclose(ddpy->dri_handle);
free(ddpy);
dpy->DriverData = NULL;
return EGL_TRUE;
}
static EGLBoolean
droid_initialize(_EGLDriver *drv, _EGLDisplay *dpy)
{
/* not until swrast_dri is supported */
if (dpy->Options.UseFallback)
return EGL_FALSE;
switch (dpy->Platform) {
case _EGL_PLATFORM_ANDROID:
if (dpy->Options.TestOnly)
return EGL_TRUE;
return droid_initialize_android(drv, dpy);
default:
return EGL_FALSE;
}
}
static _EGLProc
droid_get_proc_address(_EGLDriver *drv, const char *procname)
{
struct droid_egl_driver *ddrv = droid_egl_driver(drv);
return ddrv->get_proc_address(procname);
}
static void
droid_log(EGLint level, const char *msg)
{
switch (level) {
case _EGL_DEBUG:
LOGD(msg);
break;
case _EGL_INFO:
LOGI(msg);
break;
case _EGL_WARNING:
LOGW(msg);
break;
case _EGL_FATAL:
LOG_FATAL(msg);
break;
default:
break;
}
}
static void
droid_unload(_EGLDriver *drv)
{
struct droid_egl_driver *ddrv = droid_egl_driver(drv);
free(ddrv);
}
#include "glapi/glapi.h" /* for _glapi_get_proc_address */
static EGLBoolean
droid_load(_EGLDriver *drv)
{
struct droid_egl_driver *ddrv = droid_egl_driver(drv);
ddrv->get_proc_address = (_EGLProc (*)(const char *)) _glapi_get_proc_address;
ddrv->glFlush = (void (*)(void))
ddrv->get_proc_address("glFlush");
ddrv->glFinish = (void (*)(void))
ddrv->get_proc_address("glFinish");
return EGL_TRUE;
}
_EGLDriver *
droid_create_driver(void)
{
struct droid_egl_driver *ddrv;
ddrv = calloc(1, sizeof(*ddrv));
if (!ddrv)
return NULL;
if (!droid_load(&ddrv->base))
return NULL;
_eglSetLogProc(droid_log);
ddrv->base.Name = "Droid";
ddrv->base.Unload = droid_unload;
_eglInitDriverFallbacks(&ddrv->base);
ddrv->base.API.Initialize = droid_initialize;
ddrv->base.API.Terminate = droid_terminate;
ddrv->base.API.GetProcAddress = droid_get_proc_address;
return &ddrv->base;
}

View File

@@ -0,0 +1,129 @@
/*
* Copyright © 2010 Intel Corporation
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and associated documentation files (the "Software"),
* to deal in the Software without restriction, including without limitation
* the rights to use, copy, modify, merge, publish, distribute, sublicense,
* and/or sell copies of the Software, and to permit persons to whom the
* Software is furnished to do so, subject to the following conditions:
*
* The above copyright notice and this permission notice (including the next
* paragraph) shall be included in all copies or substantial portions of the
* Software.
*
* THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND
* NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT
* HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY,
* WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
* OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER
* DEALINGS IN THE SOFTWARE.
*
* Authors:
* Kristian Høgsberg <krh@bitplanet.net>
*/
#ifndef _DROID_H_
#define _DROID_H_
#include <errno.h>
#include <ui/egl/android_natives.h>
#include <ui/android_native_buffer.h>
#include <pixelflinger/format.h>
#include <GL/gl.h>
#include <GL/internal/dri_interface.h>
#include "egldriver.h"
#include "egldisplay.h"
#include "eglcontext.h"
#include "eglsurface.h"
#include "eglconfig.h"
#include "eglimage.h"
#include "eglcurrent.h"
#include "egllog.h"
struct droid_egl_driver
{
_EGLDriver base;
_EGLProc (*get_proc_address)(const char *procname);
void (*glFlush)(void);
void (*glFinish)(void);
};
struct droid_egl_display
{
int fd;
void *dri_handle;
__DRIscreen *dri_screen;
const __DRIconfig **dri_configs;
__DRIcoreExtension *core;
__DRIdri2Extension *dri2;
__DRI2flushExtension *flush;
__DRIimageExtension *image;
__DRIdri2LoaderExtension loader_extension;
const __DRIextension *extensions[8];
};
struct droid_egl_context
{
_EGLContext base;
__DRIcontext *dri_context;
};
struct droid_egl_surface
{
_EGLSurface base;
__DRIdrawable *dri_drawable;
__DRIbuffer dri_buffer;
android_native_window_t *window;
android_native_buffer_t *buffer;
};
struct droid_egl_config
{
_EGLConfig base;
const __DRIconfig *dri_config;
};
struct droid_egl_image
{
_EGLImage base;
__DRIimage *dri_image;
};
/* standard typecasts */
_EGL_DRIVER_STANDARD_TYPECASTS(droid_egl)
_EGL_DRIVER_TYPECAST(droid_egl_image, _EGLImage, obj)
_EGLDriver *
droid_create_driver(void);
void
droid_init_core_functions(_EGLDriver *drv);
void
droid_init_image_functions(_EGLDriver *drv);
EGLBoolean
droid_dequeue_buffer(struct droid_egl_surface *dsurf);
EGLBoolean
droid_enqueue_buffer(struct droid_egl_surface *dsurf);
int
get_native_buffer_name(struct android_native_buffer_t *buf);
#endif /* _DROID_H_ */

View File

@@ -0,0 +1,347 @@
/*
* Copyright © 2010 Intel Corporation
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and associated documentation files (the "Software"),
* to deal in the Software without restriction, including without limitation
* the rights to use, copy, modify, merge, publish, distribute, sublicense,
* and/or sell copies of the Software, and to permit persons to whom the
* Software is furnished to do so, subject to the following conditions:
*
* The above copyright notice and this permission notice (including the next
* paragraph) shall be included in all copies or substantial portions of the
* Software.
*
* THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND
* NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT
* HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY,
* WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
* OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER
* DEALINGS IN THE SOFTWARE.
*
* Authors:
* Kristian Høgsberg <krh@bitplanet.net>
*/
#include "droid.h"
static _EGLContext *
droid_create_context(_EGLDriver *drv, _EGLDisplay *disp, _EGLConfig *conf,
_EGLContext *share_list, const EGLint *attrib_list)
{
struct droid_egl_context *dctx;
struct droid_egl_display *ddpy = droid_egl_display(disp);
struct droid_egl_context *dctx_shared = droid_egl_context(share_list);
struct droid_egl_config *dconf = droid_egl_config(conf);
const __DRIconfig *dri_config;
int api;
(void) drv;
dctx = calloc(1, sizeof *dctx);
if (!dctx) {
_eglError(EGL_BAD_ALLOC, "eglCreateContext");
return NULL;
}
if (!_eglInitContext(&dctx->base, disp, conf, attrib_list))
goto cleanup;
switch (dctx->base.ClientAPI) {
case EGL_OPENGL_ES_API:
switch (dctx->base.ClientVersion) {
case 1:
api = __DRI_API_GLES;
break;
case 2:
api = __DRI_API_GLES2;
break;
default:
_eglError(EGL_BAD_PARAMETER, "eglCreateContext");
return NULL;
}
break;
case EGL_OPENGL_API:
api = __DRI_API_OPENGL;
break;
default:
_eglError(EGL_BAD_PARAMETER, "eglCreateContext");
return NULL;
}
if (conf != NULL)
dri_config = dconf->dri_config;
else
dri_config = NULL;
if (ddpy->dri2->base.version >= 2) {
dctx->dri_context =
ddpy->dri2->createNewContextForAPI(ddpy->dri_screen,
api,
dri_config,
dctx_shared ?
dctx_shared->dri_context : NULL,
dctx);
} else if (api == __DRI_API_OPENGL) {
dctx->dri_context =
ddpy->dri2->createNewContext(ddpy->dri_screen,
dconf->dri_config,
dctx_shared ?
dctx_shared->dri_context : NULL,
dctx);
} else {
/* fail */
}
if (!dctx->dri_context)
goto cleanup;
return &dctx->base;
cleanup:
free(dctx);
return NULL;
}
static EGLBoolean
droid_destroy_context(_EGLDriver *drv, _EGLDisplay *disp, _EGLContext *ctx)
{
struct droid_egl_display *ddpy = droid_egl_display(disp);
struct droid_egl_context *dctx = droid_egl_context(ctx);
(void) drv;
if (!_eglPutContext(ctx))
return EGL_TRUE;
(*ddpy->core->destroyContext)(dctx->dri_context);
free(dctx);
return EGL_TRUE;
}
static _EGLSurface *
droid_create_surface(_EGLDriver *drv, _EGLDisplay *disp, EGLint type,
_EGLConfig *conf, EGLNativeWindowType window,
const EGLint *attrib_list)
{
struct droid_egl_display *ddpy = droid_egl_display(disp);
struct droid_egl_config *dconf = droid_egl_config(conf);
struct droid_egl_surface *dsurf;
int format, vis_type;
(void) drv;
if (!window || window->common.magic != ANDROID_NATIVE_WINDOW_MAGIC) {
_eglError(EGL_BAD_NATIVE_WINDOW, "droid_create_surface");
return NULL;
}
if (window->query(window, NATIVE_WINDOW_FORMAT, &format)) {
_eglError(EGL_BAD_NATIVE_WINDOW, "droid_create_surface");
return NULL;
}
vis_type = _eglGetConfigKey(&dconf->base, EGL_NATIVE_VISUAL_TYPE);
if (format != vis_type) {
_eglLog(_EGL_WARNING, "Native format mismatch: 0x%x != 0x%x",
format, vis_type);
}
dsurf = calloc(1, sizeof *dsurf);
if (!dsurf) {
_eglError(EGL_BAD_ALLOC, "droid_create_surface");
return NULL;
}
if (!_eglInitSurface(&dsurf->base, disp, type, conf, attrib_list))
goto cleanup_surf;
dsurf->dri_drawable =
(*ddpy->dri2->createNewDrawable) (ddpy->dri_screen,
dconf->dri_config, dsurf);
if (dsurf->dri_drawable == NULL) {
_eglError(EGL_BAD_ALLOC, "dri2->createNewDrawable");
goto cleanup_pixmap;
}
window->common.incRef(&window->common);
window->query(window, NATIVE_WINDOW_WIDTH, &dsurf->base.Width);
window->query(window, NATIVE_WINDOW_HEIGHT, &dsurf->base.Height);
dsurf->window = window;
return &dsurf->base;
cleanup_dri_drawable:
ddpy->core->destroyDrawable(dsurf->dri_drawable);
cleanup_pixmap:
cleanup_surf:
free(dsurf);
return NULL;
}
static _EGLSurface *
droid_create_window_surface(_EGLDriver *drv, _EGLDisplay *disp,
_EGLConfig *conf, EGLNativeWindowType window,
const EGLint *attrib_list)
{
return droid_create_surface(drv, disp, EGL_WINDOW_BIT, conf,
window, attrib_list);
}
static _EGLSurface *
droid_create_pixmap_surface(_EGLDriver *drv, _EGLDisplay *disp,
_EGLConfig *conf, EGLNativePixmapType pixmap,
const EGLint *attrib_list)
{
return NULL;
}
static _EGLSurface *
droid_create_pbuffer_surface(_EGLDriver *drv, _EGLDisplay *disp,
_EGLConfig *conf, const EGLint *attrib_list)
{
return NULL;
}
static EGLBoolean
droid_destroy_surface(_EGLDriver *drv, _EGLDisplay *disp, _EGLSurface *surf)
{
struct droid_egl_display *ddpy = droid_egl_display(disp);
struct droid_egl_surface *dsurf = droid_egl_surface(surf);
(void) drv;
if (!_eglPutSurface(surf))
return EGL_TRUE;
(*ddpy->core->destroyDrawable)(dsurf->dri_drawable);
if (dsurf->buffer)
droid_enqueue_buffer(dsurf);
dsurf->window->common.decRef(&dsurf->window->common);
free(surf);
return EGL_TRUE;
}
static EGLBoolean
droid_make_current(_EGLDriver *drv, _EGLDisplay *disp, _EGLSurface *dsurf,
_EGLSurface *rsurf, _EGLContext *ctx)
{
struct droid_egl_driver *ddrv = droid_egl_driver(drv);
struct droid_egl_display *ddpy = droid_egl_display(disp);
struct droid_egl_surface *droid_dsurf = droid_egl_surface(dsurf);
struct droid_egl_surface *droid_rsurf = droid_egl_surface(rsurf);
struct droid_egl_context *dctx = droid_egl_context(ctx);
_EGLContext *old_ctx;
_EGLSurface *old_dsurf, *old_rsurf;
__DRIdrawable *ddraw, *rdraw;
__DRIcontext *cctx;
/* make new bindings */
if (!_eglBindContext(ctx, dsurf, rsurf, &old_ctx, &old_dsurf, &old_rsurf))
return EGL_FALSE;
/* flush before context switch */
if (old_ctx && ddrv->glFlush)
ddrv->glFlush();
ddraw = (droid_dsurf) ? droid_dsurf->dri_drawable : NULL;
rdraw = (droid_rsurf) ? droid_rsurf->dri_drawable : NULL;
cctx = (dctx) ? dctx->dri_context : NULL;
if ((cctx == NULL && ddraw == NULL && rdraw == NULL) ||
ddpy->core->bindContext(cctx, ddraw, rdraw)) {
droid_destroy_surface(drv, disp, old_dsurf);
droid_destroy_surface(drv, disp, old_rsurf);
if (old_ctx) {
/* unbind the old context only when there is no new context bound */
if (!ctx) {
__DRIcontext *old_cctx = droid_egl_context(old_ctx)->dri_context;
ddpy->core->unbindContext(old_cctx);
}
droid_destroy_context(drv, disp, old_ctx);
}
return EGL_TRUE;
} else {
/* undo the previous _eglBindContext */
_eglBindContext(old_ctx, old_dsurf, old_rsurf, &ctx, &dsurf, &rsurf);
assert(&dctx->base == ctx &&
&droid_dsurf->base == dsurf &&
&droid_rsurf->base == rsurf);
_eglPutSurface(dsurf);
_eglPutSurface(rsurf);
_eglPutContext(ctx);
_eglPutSurface(old_dsurf);
_eglPutSurface(old_rsurf);
_eglPutContext(old_ctx);
return EGL_FALSE;
}
}
static EGLBoolean
droid_swap_buffers(_EGLDriver *drv, _EGLDisplay *disp, _EGLSurface *draw)
{
struct droid_egl_driver *ddrv = droid_egl_driver(drv);
struct droid_egl_display *ddpy = droid_egl_display(disp);
struct droid_egl_surface *dsurf = droid_egl_surface(draw);
_EGLContext *ctx;
if (ddrv->glFlush) {
ctx = _eglGetCurrentContext();
if (ctx && ctx->DrawSurface == &dsurf->base)
ddrv->glFlush();
}
(*ddpy->flush->flush)(dsurf->dri_drawable);
if (dsurf->buffer)
droid_enqueue_buffer(dsurf);
(*ddpy->flush->invalidate)(dsurf->dri_drawable);
return EGL_TRUE;
}
static EGLBoolean
droid_wait_client(_EGLDriver *drv, _EGLDisplay *disp, _EGLContext *ctx)
{
struct droid_egl_driver *ddrv = droid_egl_driver(drv);
struct droid_egl_display *ddpy = droid_egl_display(disp);
struct droid_egl_surface *dsurf = droid_egl_surface(ctx->DrawSurface);
if (ddrv->glFinish)
ddrv->glFinish();
if (dsurf)
(*ddpy->flush->flush)(dsurf->dri_drawable);
return EGL_TRUE;
}
void
droid_init_core_functions(_EGLDriver *drv)
{
struct droid_egl_driver *ddrv = droid_egl_driver(drv);
ddrv->base.API.CreateContext = droid_create_context;
ddrv->base.API.DestroyContext = droid_destroy_context;
ddrv->base.API.CreateWindowSurface = droid_create_window_surface;
ddrv->base.API.CreatePixmapSurface = droid_create_pixmap_surface;
ddrv->base.API.CreatePbufferSurface = droid_create_pbuffer_surface;
ddrv->base.API.DestroySurface = droid_destroy_surface;
ddrv->base.API.MakeCurrent = droid_make_current;
ddrv->base.API.SwapBuffers = droid_swap_buffers;
ddrv->base.API.WaitClient = droid_wait_client;
}

View File

@@ -0,0 +1,134 @@
/*
* Copyright © 2010 Intel Corporation
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and associated documentation files (the "Software"),
* to deal in the Software without restriction, including without limitation
* the rights to use, copy, modify, merge, publish, distribute, sublicense,
* and/or sell copies of the Software, and to permit persons to whom the
* Software is furnished to do so, subject to the following conditions:
*
* The above copyright notice and this permission notice (including the next
* paragraph) shall be included in all copies or substantial portions of the
* Software.
*
* THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND
* NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT
* HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY,
* WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
* OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER
* DEALINGS IN THE SOFTWARE.
*
* Authors:
* Kristian Høgsberg <krh@bitplanet.net>
*/
#include "droid.h"
static _EGLImage *
droid_create_image_android_native_buffer(_EGLDisplay *disp,
EGLClientBuffer buffer)
{
struct droid_egl_display *ddpy = droid_egl_display(disp);
struct android_native_buffer_t *buf =
(struct android_native_buffer_t *) buffer;
struct droid_egl_image *dimg;
EGLint format, name;
if (!buf || buf->common.magic != ANDROID_NATIVE_BUFFER_MAGIC ||
buf->common.version != sizeof(*buf)) {
_eglError(EGL_BAD_PARAMETER, "eglCreateEGLImageKHR");
return NULL;
}
name = get_native_buffer_name(buf);
if (!name) {
_eglError(EGL_BAD_PARAMETER, "eglCreateEGLImageKHR");
return NULL;
}
switch (buf->format) {
case HAL_PIXEL_FORMAT_BGRA_8888:
format = __DRI_IMAGE_FORMAT_ARGB8888;
break;
case HAL_PIXEL_FORMAT_RGB_565:
format = __DRI_IMAGE_FORMAT_RGB565;
break;
case HAL_PIXEL_FORMAT_RGBA_8888:
format = __DRI_IMAGE_FORMAT_RGBA8888_REV;
break;
case HAL_PIXEL_FORMAT_RGBX_8888:
case HAL_PIXEL_FORMAT_RGB_888:
case HAL_PIXEL_FORMAT_RGBA_5551:
case HAL_PIXEL_FORMAT_RGBA_4444:
/* unsupported */
default:
_eglLog(_EGL_WARNING, "unsupported native buffer format 0x%x", buf->format);
return NULL;
break;
}
dimg = calloc(1, sizeof(*dimg));
if (!dimg) {
_eglError(EGL_BAD_ALLOC, "droid_create_image_mesa_drm");
return NULL;
}
if (!_eglInitImage(&dimg->base, disp)) {
free(dimg);
return NULL;
}
dimg->dri_image =
ddpy->image->createImageFromName(ddpy->dri_screen,
buf->width,
buf->height,
format,
name,
buf->stride,
dimg);
if (!dimg->dri_image) {
free(dimg);
_eglError(EGL_BAD_ALLOC, "droid_create_image_mesa_drm");
return NULL;
}
return &dimg->base;
}
static _EGLImage *
droid_create_image_khr(_EGLDriver *drv, _EGLDisplay *disp,
_EGLContext *ctx, EGLenum target,
EGLClientBuffer buffer, const EGLint *attr_list)
{
switch (target) {
case EGL_NATIVE_BUFFER_ANDROID:
return droid_create_image_android_native_buffer(disp, buffer);
default:
_eglError(EGL_BAD_PARAMETER, "droid_create_image_khr");
return EGL_NO_IMAGE_KHR;
}
}
static EGLBoolean
droid_destroy_image_khr(_EGLDriver *drv, _EGLDisplay *disp, _EGLImage *image)
{
struct droid_egl_display *ddpy = droid_egl_display(disp);
struct droid_egl_image *dimg = droid_egl_image(image);
ddpy->image->destroyImage(dimg->dri_image);
free(dimg);
return EGL_TRUE;
}
void
droid_init_image_functions(_EGLDriver *drv)
{
struct droid_egl_driver *ddrv = droid_egl_driver(drv);
ddrv->base.API.CreateImageKHR = droid_create_image_khr;
ddrv->base.API.DestroyImageKHR = droid_destroy_image_khr;
}

View File

@@ -0,0 +1,42 @@
/*
* Copyright © 2010 Intel Corporation
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and associated documentation files (the "Software"),
* to deal in the Software without restriction, including without limitation
* the rights to use, copy, modify, merge, publish, distribute, sublicense,
* and/or sell copies of the Software, and to permit persons to whom the
* Software is furnished to do so, subject to the following conditions:
*
* The above copyright notice and this permission notice (including the next
* paragraph) shall be included in all copies or substantial portions of the
* Software.
*
* THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND
* NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT
* HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY,
* WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
* OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER
* DEALINGS IN THE SOFTWARE.
*
* Authors:
* Kristian Høgsberg <krh@bitplanet.net>
*/
#include "droid.h"
_EGLDriver *
_EGL_MAIN(const char *args)
{
_EGLDriver *drv;
drv = droid_create_driver();
if (drv) {
droid_init_core_functions(drv);
droid_init_image_functions(drv);
}
return drv;
}

View File

@@ -3,8 +3,8 @@
TOP = ../../../..
include $(TOP)/configs/current
EGL_DRIVER = egl_dri2.so
EGL_SOURCES = egl_dri2.c
EGL_DRIVER = egl_dri2
EGL_SOURCES = egl_dri2.c platform_x11.c platform_drm.c
EGL_INCLUDES = \
-I$(TOP)/include \
@@ -15,6 +15,22 @@ EGL_INCLUDES = \
$(LIBUDEV_CFLAGS) \
$(LIBDRM_CFLAGS)
EGL_LIBS = $(XCB_DRI2_LIBS) $(LIBUDEV_LIBS) $(LIBDRM_LIBS)
EGL_LIBS = $(XCB_DRI2_LIBS) $(LIBUDEV_LIBS) $(DLOPEN_LIBS) $(LIBDRM_LIB)
EGL_CFLAGS = -D_EGL_MAIN=_eglBuiltInDriverDRI2
EGL_BUILTIN = true
ifeq ($(SHARED_GLAPI),1)
EGL_CFLAGS += -DHAVE_SHARED_GLAPI
endif
ifneq ($(findstring wayland, $(EGL_PLATFORMS)),)
EGL_SOURCES += platform_wayland.c
EGL_INCLUDES += -DHAVE_WAYLAND_PLATFORM $(WAYLAND_CFLAGS) \
-I$(TOP)/src/egl/wayland/wayland-egl \
-I$(TOP)/src/egl/wayland/wayland-drm
EGL_LIBS += $(WAYLAND_LIBS) \
$(TOP)/src/egl/wayland/wayland-drm/libwayland-drm.a
endif
include ../Makefile.template

File diff suppressed because it is too large Load Diff

View File

@@ -0,0 +1,199 @@
/*
* Copyright © 2011 Intel Corporation
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and associated documentation files (the "Software"),
* to deal in the Software without restriction, including without limitation
* the rights to use, copy, modify, merge, publish, distribute, sublicense,
* and/or sell copies of the Software, and to permit persons to whom the
* Software is furnished to do so, subject to the following conditions:
*
* The above copyright notice and this permission notice (including the next
* paragraph) shall be included in all copies or substantial portions of the
* Software.
*
* THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND
* NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT
* HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY,
* WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
* OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER
* DEALINGS IN THE SOFTWARE.
*
* Authors:
* Kristian Høgsberg <krh@bitplanet.net>
*/
#ifndef EGL_DRI2_INCLUDED
#define EGL_DRI2_INCLUDED
#include <xcb/xcb.h>
#include <xcb/dri2.h>
#include <xcb/xfixes.h>
#include <X11/Xlib-xcb.h>
#ifdef HAVE_WAYLAND_PLATFORM
#include <wayland-client.h>
#include "wayland-drm.h"
#include "wayland-egl-priv.h"
#endif
#include <GL/gl.h>
#include <GL/internal/dri_interface.h>
#include "eglconfig.h"
#include "eglcontext.h"
#include "egldisplay.h"
#include "egldriver.h"
#include "eglcurrent.h"
#include "egllog.h"
#include "eglsurface.h"
#include "eglimage.h"
#define ARRAY_SIZE(a) (sizeof(a) / sizeof((a)[0]))
struct dri2_egl_driver
{
_EGLDriver base;
void *handle;
_EGLProc (*get_proc_address)(const char *procname);
void (*glFlush)(void);
};
struct dri2_egl_display
{
xcb_connection_t *conn;
int dri2_major;
int dri2_minor;
__DRIscreen *dri_screen;
const __DRIconfig **driver_configs;
void *driver;
__DRIcoreExtension *core;
__DRIdri2Extension *dri2;
__DRIswrastExtension *swrast;
__DRI2flushExtension *flush;
__DRItexBufferExtension *tex_buffer;
__DRIimageExtension *image;
int fd;
char *device_name;
char *driver_name;
__DRIdri2LoaderExtension dri2_loader_extension;
__DRIswrastLoaderExtension swrast_loader_extension;
const __DRIextension *extensions[3];
#ifdef HAVE_WAYLAND_PLATFORM
struct wl_egl_display *wl_dpy;
struct wl_drm *wl_server_drm;
#endif
int (*authenticate) (_EGLDisplay *disp, uint32_t id);
};
struct dri2_egl_context
{
_EGLContext base;
__DRIcontext *dri_context;
};
#ifdef HAVE_WAYLAND_PLATFORM
enum wayland_buffer_type {
WL_BUFFER_FRONT,
WL_BUFFER_BACK,
WL_BUFFER_COUNT
};
#define __DRI_BUFFER_COUNT 10
#endif
enum dri2_surface_type {
DRI2_WINDOW_SURFACE,
DRI2_PIXMAP_SURFACE,
DRI2_PBUFFER_SURFACE
};
struct dri2_egl_surface
{
_EGLSurface base;
__DRIdrawable *dri_drawable;
xcb_drawable_t drawable;
__DRIbuffer buffers[5];
int buffer_count;
xcb_xfixes_region_t region;
int have_fake_front;
int swap_interval;
int depth;
int bytes_per_pixel;
xcb_gcontext_t gc;
xcb_gcontext_t swapgc;
enum dri2_surface_type type;
#ifdef HAVE_WAYLAND_PLATFORM
struct wl_egl_window *wl_win;
struct wl_egl_pixmap *wl_pix;
struct wl_buffer *wl_drm_buffer[WL_BUFFER_COUNT];
int dx;
int dy;
__DRIbuffer *dri_buffers[__DRI_BUFFER_COUNT];
__DRIbuffer *pending_buffer;
EGLBoolean block_swap_buffers;
#endif
};
struct dri2_egl_buffer {
__DRIbuffer *dri_buffer;
struct dri2_egl_display *dri2_dpy;
};
struct dri2_egl_config
{
_EGLConfig base;
const __DRIconfig *dri_single_config;
const __DRIconfig *dri_double_config;
};
struct dri2_egl_image
{
_EGLImage base;
__DRIimage *dri_image;
};
/* standard typecasts */
_EGL_DRIVER_STANDARD_TYPECASTS(dri2_egl)
_EGL_DRIVER_TYPECAST(dri2_egl_image, _EGLImage, obj)
extern const __DRIimageLookupExtension image_lookup_extension;
extern const __DRIuseInvalidateExtension use_invalidate;
EGLBoolean
dri2_load_driver(_EGLDisplay *disp);
EGLBoolean
dri2_create_screen(_EGLDisplay *disp);
struct dri2_egl_config *
dri2_add_config(_EGLDisplay *disp, const __DRIconfig *dri_config, int id,
int depth, EGLint surface_type, const EGLint *attr_list);
_EGLImage *
dri2_create_image_khr(_EGLDriver *drv, _EGLDisplay *disp,
_EGLContext *ctx, EGLenum target,
EGLClientBuffer buffer, const EGLint *attr_list);
EGLBoolean
dri2_initialize_x11(_EGLDriver *drv, _EGLDisplay *disp);
EGLBoolean
dri2_initialize_drm(_EGLDriver *drv, _EGLDisplay *disp);
EGLBoolean
dri2_initialize_wayland(_EGLDriver *drv, _EGLDisplay *disp);
char *
dri2_get_driver_for_fd(int fd);
#endif /* EGL_DRI2_INCLUDED */

View File

@@ -0,0 +1,737 @@
/*
* Copyright © 2011 Intel Corporation
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and associated documentation files (the "Software"),
* to deal in the Software without restriction, including without limitation
* the rights to use, copy, modify, merge, publish, distribute, sublicense,
* and/or sell copies of the Software, and to permit persons to whom the
* Software is furnished to do so, subject to the following conditions:
*
* The above copyright notice and this permission notice (including the next
* paragraph) shall be included in all copies or substantial portions of the
* Software.
*
* THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND
* NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT
* HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY,
* WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
* OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER
* DEALINGS IN THE SOFTWARE.
*
* Authors:
* Kristian Høgsberg <krh@bitplanet.net>
*/
#include <stdlib.h>
#include <string.h>
#include <stdio.h>
#include <limits.h>
#include <dlfcn.h>
#include <fcntl.h>
#include <errno.h>
#include <unistd.h>
#include <xf86drm.h>
#include <sys/types.h>
#include <sys/stat.h>
#ifdef HAVE_LIBUDEV
#include <libudev.h>
#endif
#include "egl_dri2.h"
#ifdef HAVE_LIBUDEV
struct dri2_driver_map {
int vendor_id;
const char *driver;
const int *chip_ids;
int num_chips_ids;
};
const int i915_chip_ids[] = {
0x3577, /* PCI_CHIP_I830_M */
0x2562, /* PCI_CHIP_845_G */
0x3582, /* PCI_CHIP_I855_GM */
0x2572, /* PCI_CHIP_I865_G */
0x2582, /* PCI_CHIP_I915_G */
0x258a, /* PCI_CHIP_E7221_G */
0x2592, /* PCI_CHIP_I915_GM */
0x2772, /* PCI_CHIP_I945_G */
0x27a2, /* PCI_CHIP_I945_GM */
0x27ae, /* PCI_CHIP_I945_GME */
0x29b2, /* PCI_CHIP_Q35_G */
0x29c2, /* PCI_CHIP_G33_G */
0x29d2, /* PCI_CHIP_Q33_G */
0xa001, /* PCI_CHIP_IGD_G */
0xa011, /* Pineview */
};
const int i965_chip_ids[] = {
0x0042, /* PCI_CHIP_ILD_G */
0x0046, /* PCI_CHIP_ILM_G */
0x0102, /* PCI_CHIP_SANDYBRIDGE_GT1 */
0x0106, /* PCI_CHIP_SANDYBRIDGE_M_GT1 */
0x010a, /* PCI_CHIP_SANDYBRIDGE_S */
0x0112, /* PCI_CHIP_SANDYBRIDGE_GT2 */
0x0116, /* PCI_CHIP_SANDYBRIDGE_M_GT2 */
0x0122, /* PCI_CHIP_SANDYBRIDGE_GT2_PLUS */
0x0126, /* PCI_CHIP_SANDYBRIDGE_M_GT2_PLUS */
0x29a2, /* PCI_CHIP_I965_G */
0x2992, /* PCI_CHIP_I965_Q */
0x2982, /* PCI_CHIP_I965_G_1 */
0x2972, /* PCI_CHIP_I946_GZ */
0x2a02, /* PCI_CHIP_I965_GM */
0x2a12, /* PCI_CHIP_I965_GME */
0x2a42, /* PCI_CHIP_GM45_GM */
0x2e02, /* PCI_CHIP_IGD_E_G */
0x2e12, /* PCI_CHIP_Q45_G */
0x2e22, /* PCI_CHIP_G45_G */
0x2e32, /* PCI_CHIP_G41_G */
0x2e42, /* PCI_CHIP_B43_G */
0x2e92, /* PCI_CHIP_B43_G1 */
};
const int r100_chip_ids[] = {
0x4C57, /* PCI_CHIP_RADEON_LW */
0x4C58, /* PCI_CHIP_RADEON_LX */
0x4C59, /* PCI_CHIP_RADEON_LY */
0x4C5A, /* PCI_CHIP_RADEON_LZ */
0x5144, /* PCI_CHIP_RADEON_QD */
0x5145, /* PCI_CHIP_RADEON_QE */
0x5146, /* PCI_CHIP_RADEON_QF */
0x5147, /* PCI_CHIP_RADEON_QG */
0x5159, /* PCI_CHIP_RADEON_QY */
0x515A, /* PCI_CHIP_RADEON_QZ */
0x5157, /* PCI_CHIP_RV200_QW */
0x5158, /* PCI_CHIP_RV200_QX */
0x515E, /* PCI_CHIP_RN50_515E */
0x5969, /* PCI_CHIP_RN50_5969 */
0x4136, /* PCI_CHIP_RS100_4136 */
0x4336, /* PCI_CHIP_RS100_4336 */
0x4137, /* PCI_CHIP_RS200_4137 */
0x4337, /* PCI_CHIP_RS200_4337 */
0x4237, /* PCI_CHIP_RS250_4237 */
0x4437, /* PCI_CHIP_RS250_4437 */
};
const int r200_chip_ids[] = {
0x5148, /* PCI_CHIP_R200_QH */
0x514C, /* PCI_CHIP_R200_QL */
0x514D, /* PCI_CHIP_R200_QM */
0x4242, /* PCI_CHIP_R200_BB */
0x4966, /* PCI_CHIP_RV250_If */
0x4967, /* PCI_CHIP_RV250_Ig */
0x4C64, /* PCI_CHIP_RV250_Ld */
0x4C66, /* PCI_CHIP_RV250_Lf */
0x4C67, /* PCI_CHIP_RV250_Lg */
0x5960, /* PCI_CHIP_RV280_5960 */
0x5961, /* PCI_CHIP_RV280_5961 */
0x5962, /* PCI_CHIP_RV280_5962 */
0x5964, /* PCI_CHIP_RV280_5964 */
0x5965, /* PCI_CHIP_RV280_5965 */
0x5C61, /* PCI_CHIP_RV280_5C61 */
0x5C63, /* PCI_CHIP_RV280_5C63 */
0x5834, /* PCI_CHIP_RS300_5834 */
0x5835, /* PCI_CHIP_RS300_5835 */
0x7834, /* PCI_CHIP_RS350_7834 */
0x7835, /* PCI_CHIP_RS350_7835 */
};
const int r300_chip_ids[] = {
0x4144, /* PCI_CHIP_R300_AD */
0x4145, /* PCI_CHIP_R300_AE */
0x4146, /* PCI_CHIP_R300_AF */
0x4147, /* PCI_CHIP_R300_AG */
0x4E44, /* PCI_CHIP_R300_ND */
0x4E45, /* PCI_CHIP_R300_NE */
0x4E46, /* PCI_CHIP_R300_NF */
0x4E47, /* PCI_CHIP_R300_NG */
0x4E48, /* PCI_CHIP_R350_NH */
0x4E49, /* PCI_CHIP_R350_NI */
0x4E4B, /* PCI_CHIP_R350_NK */
0x4148, /* PCI_CHIP_R350_AH */
0x4149, /* PCI_CHIP_R350_AI */
0x414A, /* PCI_CHIP_R350_AJ */
0x414B, /* PCI_CHIP_R350_AK */
0x4E4A, /* PCI_CHIP_R360_NJ */
0x4150, /* PCI_CHIP_RV350_AP */
0x4151, /* PCI_CHIP_RV350_AQ */
0x4152, /* PCI_CHIP_RV350_AR */
0x4153, /* PCI_CHIP_RV350_AS */
0x4154, /* PCI_CHIP_RV350_AT */
0x4155, /* PCI_CHIP_RV350_AU */
0x4156, /* PCI_CHIP_RV350_AV */
0x4E50, /* PCI_CHIP_RV350_NP */
0x4E51, /* PCI_CHIP_RV350_NQ */
0x4E52, /* PCI_CHIP_RV350_NR */
0x4E53, /* PCI_CHIP_RV350_NS */
0x4E54, /* PCI_CHIP_RV350_NT */
0x4E56, /* PCI_CHIP_RV350_NV */
0x5460, /* PCI_CHIP_RV370_5460 */
0x5462, /* PCI_CHIP_RV370_5462 */
0x5464, /* PCI_CHIP_RV370_5464 */
0x5B60, /* PCI_CHIP_RV370_5B60 */
0x5B62, /* PCI_CHIP_RV370_5B62 */
0x5B63, /* PCI_CHIP_RV370_5B63 */
0x5B64, /* PCI_CHIP_RV370_5B64 */
0x5B65, /* PCI_CHIP_RV370_5B65 */
0x3150, /* PCI_CHIP_RV380_3150 */
0x3152, /* PCI_CHIP_RV380_3152 */
0x3154, /* PCI_CHIP_RV380_3154 */
0x3155, /* PCI_CHIP_RV380_3155 */
0x3E50, /* PCI_CHIP_RV380_3E50 */
0x3E54, /* PCI_CHIP_RV380_3E54 */
0x4A48, /* PCI_CHIP_R420_JH */
0x4A49, /* PCI_CHIP_R420_JI */
0x4A4A, /* PCI_CHIP_R420_JJ */
0x4A4B, /* PCI_CHIP_R420_JK */
0x4A4C, /* PCI_CHIP_R420_JL */
0x4A4D, /* PCI_CHIP_R420_JM */
0x4A4E, /* PCI_CHIP_R420_JN */
0x4A4F, /* PCI_CHIP_R420_JO */
0x4A50, /* PCI_CHIP_R420_JP */
0x4A54, /* PCI_CHIP_R420_JT */
0x5548, /* PCI_CHIP_R423_UH */
0x5549, /* PCI_CHIP_R423_UI */
0x554A, /* PCI_CHIP_R423_UJ */
0x554B, /* PCI_CHIP_R423_UK */
0x5550, /* PCI_CHIP_R423_5550 */
0x5551, /* PCI_CHIP_R423_UQ */
0x5552, /* PCI_CHIP_R423_UR */
0x5554, /* PCI_CHIP_R423_UT */
0x5D57, /* PCI_CHIP_R423_5D57 */
0x554C, /* PCI_CHIP_R430_554C */
0x554D, /* PCI_CHIP_R430_554D */
0x554E, /* PCI_CHIP_R430_554E */
0x554F, /* PCI_CHIP_R430_554F */
0x5D48, /* PCI_CHIP_R430_5D48 */
0x5D49, /* PCI_CHIP_R430_5D49 */
0x5D4A, /* PCI_CHIP_R430_5D4A */
0x5D4C, /* PCI_CHIP_R480_5D4C */
0x5D4D, /* PCI_CHIP_R480_5D4D */
0x5D4E, /* PCI_CHIP_R480_5D4E */
0x5D4F, /* PCI_CHIP_R480_5D4F */
0x5D50, /* PCI_CHIP_R480_5D50 */
0x5D52, /* PCI_CHIP_R480_5D52 */
0x4B49, /* PCI_CHIP_R481_4B49 */
0x4B4A, /* PCI_CHIP_R481_4B4A */
0x4B4B, /* PCI_CHIP_R481_4B4B */
0x4B4C, /* PCI_CHIP_R481_4B4C */
0x564A, /* PCI_CHIP_RV410_564A */
0x564B, /* PCI_CHIP_RV410_564B */
0x564F, /* PCI_CHIP_RV410_564F */
0x5652, /* PCI_CHIP_RV410_5652 */
0x5653, /* PCI_CHIP_RV410_5653 */
0x5657, /* PCI_CHIP_RV410_5657 */
0x5E48, /* PCI_CHIP_RV410_5E48 */
0x5E4A, /* PCI_CHIP_RV410_5E4A */
0x5E4B, /* PCI_CHIP_RV410_5E4B */
0x5E4C, /* PCI_CHIP_RV410_5E4C */
0x5E4D, /* PCI_CHIP_RV410_5E4D */
0x5E4F, /* PCI_CHIP_RV410_5E4F */
0x5A41, /* PCI_CHIP_RS400_5A41 */
0x5A42, /* PCI_CHIP_RS400_5A42 */
0x5A61, /* PCI_CHIP_RC410_5A61 */
0x5A62, /* PCI_CHIP_RC410_5A62 */
0x5954, /* PCI_CHIP_RS480_5954 */
0x5955, /* PCI_CHIP_RS480_5955 */
0x5974, /* PCI_CHIP_RS482_5974 */
0x5975, /* PCI_CHIP_RS482_5975 */
0x7100, /* PCI_CHIP_R520_7100 */
0x7101, /* PCI_CHIP_R520_7101 */
0x7102, /* PCI_CHIP_R520_7102 */
0x7103, /* PCI_CHIP_R520_7103 */
0x7104, /* PCI_CHIP_R520_7104 */
0x7105, /* PCI_CHIP_R520_7105 */
0x7106, /* PCI_CHIP_R520_7106 */
0x7108, /* PCI_CHIP_R520_7108 */
0x7109, /* PCI_CHIP_R520_7109 */
0x710A, /* PCI_CHIP_R520_710A */
0x710B, /* PCI_CHIP_R520_710B */
0x710C, /* PCI_CHIP_R520_710C */
0x710E, /* PCI_CHIP_R520_710E */
0x710F, /* PCI_CHIP_R520_710F */
0x7140, /* PCI_CHIP_RV515_7140 */
0x7141, /* PCI_CHIP_RV515_7141 */
0x7142, /* PCI_CHIP_RV515_7142 */
0x7143, /* PCI_CHIP_RV515_7143 */
0x7144, /* PCI_CHIP_RV515_7144 */
0x7145, /* PCI_CHIP_RV515_7145 */
0x7146, /* PCI_CHIP_RV515_7146 */
0x7147, /* PCI_CHIP_RV515_7147 */
0x7149, /* PCI_CHIP_RV515_7149 */
0x714A, /* PCI_CHIP_RV515_714A */
0x714B, /* PCI_CHIP_RV515_714B */
0x714C, /* PCI_CHIP_RV515_714C */
0x714D, /* PCI_CHIP_RV515_714D */
0x714E, /* PCI_CHIP_RV515_714E */
0x714F, /* PCI_CHIP_RV515_714F */
0x7151, /* PCI_CHIP_RV515_7151 */
0x7152, /* PCI_CHIP_RV515_7152 */
0x7153, /* PCI_CHIP_RV515_7153 */
0x715E, /* PCI_CHIP_RV515_715E */
0x715F, /* PCI_CHIP_RV515_715F */
0x7180, /* PCI_CHIP_RV515_7180 */
0x7181, /* PCI_CHIP_RV515_7181 */
0x7183, /* PCI_CHIP_RV515_7183 */
0x7186, /* PCI_CHIP_RV515_7186 */
0x7187, /* PCI_CHIP_RV515_7187 */
0x7188, /* PCI_CHIP_RV515_7188 */
0x718A, /* PCI_CHIP_RV515_718A */
0x718B, /* PCI_CHIP_RV515_718B */
0x718C, /* PCI_CHIP_RV515_718C */
0x718D, /* PCI_CHIP_RV515_718D */
0x718F, /* PCI_CHIP_RV515_718F */
0x7193, /* PCI_CHIP_RV515_7193 */
0x7196, /* PCI_CHIP_RV515_7196 */
0x719B, /* PCI_CHIP_RV515_719B */
0x719F, /* PCI_CHIP_RV515_719F */
0x7200, /* PCI_CHIP_RV515_7200 */
0x7210, /* PCI_CHIP_RV515_7210 */
0x7211, /* PCI_CHIP_RV515_7211 */
0x71C0, /* PCI_CHIP_RV530_71C0 */
0x71C1, /* PCI_CHIP_RV530_71C1 */
0x71C2, /* PCI_CHIP_RV530_71C2 */
0x71C3, /* PCI_CHIP_RV530_71C3 */
0x71C4, /* PCI_CHIP_RV530_71C4 */
0x71C5, /* PCI_CHIP_RV530_71C5 */
0x71C6, /* PCI_CHIP_RV530_71C6 */
0x71C7, /* PCI_CHIP_RV530_71C7 */
0x71CD, /* PCI_CHIP_RV530_71CD */
0x71CE, /* PCI_CHIP_RV530_71CE */
0x71D2, /* PCI_CHIP_RV530_71D2 */
0x71D4, /* PCI_CHIP_RV530_71D4 */
0x71D5, /* PCI_CHIP_RV530_71D5 */
0x71D6, /* PCI_CHIP_RV530_71D6 */
0x71DA, /* PCI_CHIP_RV530_71DA */
0x71DE, /* PCI_CHIP_RV530_71DE */
0x7281, /* PCI_CHIP_RV560_7281 */
0x7283, /* PCI_CHIP_RV560_7283 */
0x7287, /* PCI_CHIP_RV560_7287 */
0x7290, /* PCI_CHIP_RV560_7290 */
0x7291, /* PCI_CHIP_RV560_7291 */
0x7293, /* PCI_CHIP_RV560_7293 */
0x7297, /* PCI_CHIP_RV560_7297 */
0x7280, /* PCI_CHIP_RV570_7280 */
0x7288, /* PCI_CHIP_RV570_7288 */
0x7289, /* PCI_CHIP_RV570_7289 */
0x728B, /* PCI_CHIP_RV570_728B */
0x728C, /* PCI_CHIP_RV570_728C */
0x7240, /* PCI_CHIP_R580_7240 */
0x7243, /* PCI_CHIP_R580_7243 */
0x7244, /* PCI_CHIP_R580_7244 */
0x7245, /* PCI_CHIP_R580_7245 */
0x7246, /* PCI_CHIP_R580_7246 */
0x7247, /* PCI_CHIP_R580_7247 */
0x7248, /* PCI_CHIP_R580_7248 */
0x7249, /* PCI_CHIP_R580_7249 */
0x724A, /* PCI_CHIP_R580_724A */
0x724B, /* PCI_CHIP_R580_724B */
0x724C, /* PCI_CHIP_R580_724C */
0x724D, /* PCI_CHIP_R580_724D */
0x724E, /* PCI_CHIP_R580_724E */
0x724F, /* PCI_CHIP_R580_724F */
0x7284, /* PCI_CHIP_R580_7284 */
0x793F, /* PCI_CHIP_RS600_793F */
0x7941, /* PCI_CHIP_RS600_7941 */
0x7942, /* PCI_CHIP_RS600_7942 */
0x791E, /* PCI_CHIP_RS690_791E */
0x791F, /* PCI_CHIP_RS690_791F */
0x796C, /* PCI_CHIP_RS740_796C */
0x796D, /* PCI_CHIP_RS740_796D */
0x796E, /* PCI_CHIP_RS740_796E */
0x796F, /* PCI_CHIP_RS740_796F */
};
const int r600_chip_ids[] = {
0x9400, /* PCI_CHIP_R600_9400 */
0x9401, /* PCI_CHIP_R600_9401 */
0x9402, /* PCI_CHIP_R600_9402 */
0x9403, /* PCI_CHIP_R600_9403 */
0x9405, /* PCI_CHIP_R600_9405 */
0x940A, /* PCI_CHIP_R600_940A */
0x940B, /* PCI_CHIP_R600_940B */
0x940F, /* PCI_CHIP_R600_940F */
0x94C0, /* PCI_CHIP_RV610_94C0 */
0x94C1, /* PCI_CHIP_RV610_94C1 */
0x94C3, /* PCI_CHIP_RV610_94C3 */
0x94C4, /* PCI_CHIP_RV610_94C4 */
0x94C5, /* PCI_CHIP_RV610_94C5 */
0x94C6, /* PCI_CHIP_RV610_94C6 */
0x94C7, /* PCI_CHIP_RV610_94C7 */
0x94C8, /* PCI_CHIP_RV610_94C8 */
0x94C9, /* PCI_CHIP_RV610_94C9 */
0x94CB, /* PCI_CHIP_RV610_94CB */
0x94CC, /* PCI_CHIP_RV610_94CC */
0x94CD, /* PCI_CHIP_RV610_94CD */
0x9580, /* PCI_CHIP_RV630_9580 */
0x9581, /* PCI_CHIP_RV630_9581 */
0x9583, /* PCI_CHIP_RV630_9583 */
0x9586, /* PCI_CHIP_RV630_9586 */
0x9587, /* PCI_CHIP_RV630_9587 */
0x9588, /* PCI_CHIP_RV630_9588 */
0x9589, /* PCI_CHIP_RV630_9589 */
0x958A, /* PCI_CHIP_RV630_958A */
0x958B, /* PCI_CHIP_RV630_958B */
0x958C, /* PCI_CHIP_RV630_958C */
0x958D, /* PCI_CHIP_RV630_958D */
0x958E, /* PCI_CHIP_RV630_958E */
0x958F, /* PCI_CHIP_RV630_958F */
0x9500, /* PCI_CHIP_RV670_9500 */
0x9501, /* PCI_CHIP_RV670_9501 */
0x9504, /* PCI_CHIP_RV670_9504 */
0x9505, /* PCI_CHIP_RV670_9505 */
0x9506, /* PCI_CHIP_RV670_9506 */
0x9507, /* PCI_CHIP_RV670_9507 */
0x9508, /* PCI_CHIP_RV670_9508 */
0x9509, /* PCI_CHIP_RV670_9509 */
0x950F, /* PCI_CHIP_RV670_950F */
0x9511, /* PCI_CHIP_RV670_9511 */
0x9515, /* PCI_CHIP_RV670_9515 */
0x9517, /* PCI_CHIP_RV670_9517 */
0x9519, /* PCI_CHIP_RV670_9519 */
0x95C0, /* PCI_CHIP_RV620_95C0 */
0x95C2, /* PCI_CHIP_RV620_95C2 */
0x95C4, /* PCI_CHIP_RV620_95C4 */
0x95C5, /* PCI_CHIP_RV620_95C5 */
0x95C6, /* PCI_CHIP_RV620_95C6 */
0x95C7, /* PCI_CHIP_RV620_95C7 */
0x95C9, /* PCI_CHIP_RV620_95C9 */
0x95CC, /* PCI_CHIP_RV620_95CC */
0x95CD, /* PCI_CHIP_RV620_95CD */
0x95CE, /* PCI_CHIP_RV620_95CE */
0x95CF, /* PCI_CHIP_RV620_95CF */
0x9590, /* PCI_CHIP_RV635_9590 */
0x9591, /* PCI_CHIP_RV635_9591 */
0x9593, /* PCI_CHIP_RV635_9593 */
0x9595, /* PCI_CHIP_RV635_9595 */
0x9596, /* PCI_CHIP_RV635_9596 */
0x9597, /* PCI_CHIP_RV635_9597 */
0x9598, /* PCI_CHIP_RV635_9598 */
0x9599, /* PCI_CHIP_RV635_9599 */
0x959B, /* PCI_CHIP_RV635_959B */
0x9610, /* PCI_CHIP_RS780_9610 */
0x9611, /* PCI_CHIP_RS780_9611 */
0x9612, /* PCI_CHIP_RS780_9612 */
0x9613, /* PCI_CHIP_RS780_9613 */
0x9614, /* PCI_CHIP_RS780_9614 */
0x9615, /* PCI_CHIP_RS780_9615 */
0x9616, /* PCI_CHIP_RS780_9616 */
0x9710, /* PCI_CHIP_RS880_9710 */
0x9711, /* PCI_CHIP_RS880_9711 */
0x9712, /* PCI_CHIP_RS880_9712 */
0x9713, /* PCI_CHIP_RS880_9713 */
0x9714, /* PCI_CHIP_RS880_9714 */
0x9715, /* PCI_CHIP_RS880_9715 */
0x9440, /* PCI_CHIP_RV770_9440 */
0x9441, /* PCI_CHIP_RV770_9441 */
0x9442, /* PCI_CHIP_RV770_9442 */
0x9443, /* PCI_CHIP_RV770_9443 */
0x9444, /* PCI_CHIP_RV770_9444 */
0x9446, /* PCI_CHIP_RV770_9446 */
0x944A, /* PCI_CHIP_RV770_944A */
0x944B, /* PCI_CHIP_RV770_944B */
0x944C, /* PCI_CHIP_RV770_944C */
0x944E, /* PCI_CHIP_RV770_944E */
0x9450, /* PCI_CHIP_RV770_9450 */
0x9452, /* PCI_CHIP_RV770_9452 */
0x9456, /* PCI_CHIP_RV770_9456 */
0x945A, /* PCI_CHIP_RV770_945A */
0x945B, /* PCI_CHIP_RV770_945B */
0x945E, /* PCI_CHIP_RV770_945E */
0x9460, /* PCI_CHIP_RV790_9460 */
0x9462, /* PCI_CHIP_RV790_9462 */
0x946A, /* PCI_CHIP_RV770_946A */
0x946B, /* PCI_CHIP_RV770_946B */
0x947A, /* PCI_CHIP_RV770_947A */
0x947B, /* PCI_CHIP_RV770_947B */
0x9480, /* PCI_CHIP_RV730_9480 */
0x9487, /* PCI_CHIP_RV730_9487 */
0x9488, /* PCI_CHIP_RV730_9488 */
0x9489, /* PCI_CHIP_RV730_9489 */
0x948A, /* PCI_CHIP_RV730_948A */
0x948F, /* PCI_CHIP_RV730_948F */
0x9490, /* PCI_CHIP_RV730_9490 */
0x9491, /* PCI_CHIP_RV730_9491 */
0x9495, /* PCI_CHIP_RV730_9495 */
0x9498, /* PCI_CHIP_RV730_9498 */
0x949C, /* PCI_CHIP_RV730_949C */
0x949E, /* PCI_CHIP_RV730_949E */
0x949F, /* PCI_CHIP_RV730_949F */
0x9540, /* PCI_CHIP_RV710_9540 */
0x9541, /* PCI_CHIP_RV710_9541 */
0x9542, /* PCI_CHIP_RV710_9542 */
0x954E, /* PCI_CHIP_RV710_954E */
0x954F, /* PCI_CHIP_RV710_954F */
0x9552, /* PCI_CHIP_RV710_9552 */
0x9553, /* PCI_CHIP_RV710_9553 */
0x9555, /* PCI_CHIP_RV710_9555 */
0x9557, /* PCI_CHIP_RV710_9557 */
0x955F, /* PCI_CHIP_RV710_955F */
0x94A0, /* PCI_CHIP_RV740_94A0 */
0x94A1, /* PCI_CHIP_RV740_94A1 */
0x94A3, /* PCI_CHIP_RV740_94A3 */
0x94B1, /* PCI_CHIP_RV740_94B1 */
0x94B3, /* PCI_CHIP_RV740_94B3 */
0x94B4, /* PCI_CHIP_RV740_94B4 */
0x94B5, /* PCI_CHIP_RV740_94B5 */
0x94B9, /* PCI_CHIP_RV740_94B9 */
0x68E0, /* PCI_CHIP_CEDAR_68E0 */
0x68E1, /* PCI_CHIP_CEDAR_68E1 */
0x68E4, /* PCI_CHIP_CEDAR_68E4 */
0x68E5, /* PCI_CHIP_CEDAR_68E5 */
0x68E8, /* PCI_CHIP_CEDAR_68E8 */
0x68E9, /* PCI_CHIP_CEDAR_68E9 */
0x68F1, /* PCI_CHIP_CEDAR_68F1 */
0x68F8, /* PCI_CHIP_CEDAR_68F8 */
0x68F9, /* PCI_CHIP_CEDAR_68F9 */
0x68FE, /* PCI_CHIP_CEDAR_68FE */
0x68C0, /* PCI_CHIP_REDWOOD_68C0 */
0x68C1, /* PCI_CHIP_REDWOOD_68C1 */
0x68C8, /* PCI_CHIP_REDWOOD_68C8 */
0x68C9, /* PCI_CHIP_REDWOOD_68C9 */
0x68D8, /* PCI_CHIP_REDWOOD_68D8 */
0x68D9, /* PCI_CHIP_REDWOOD_68D9 */
0x68DA, /* PCI_CHIP_REDWOOD_68DA */
0x68DE, /* PCI_CHIP_REDWOOD_68DE */
0x68A0, /* PCI_CHIP_JUNIPER_68A0 */
0x68A1, /* PCI_CHIP_JUNIPER_68A1 */
0x68A8, /* PCI_CHIP_JUNIPER_68A8 */
0x68A9, /* PCI_CHIP_JUNIPER_68A9 */
0x68B0, /* PCI_CHIP_JUNIPER_68B0 */
0x68B8, /* PCI_CHIP_JUNIPER_68B8 */
0x68B9, /* PCI_CHIP_JUNIPER_68B9 */
0x68BE, /* PCI_CHIP_JUNIPER_68BE */
0x6880, /* PCI_CHIP_CYPRESS_6880 */
0x6888, /* PCI_CHIP_CYPRESS_6888 */
0x6889, /* PCI_CHIP_CYPRESS_6889 */
0x688A, /* PCI_CHIP_CYPRESS_688A */
0x6898, /* PCI_CHIP_CYPRESS_6898 */
0x6899, /* PCI_CHIP_CYPRESS_6899 */
0x689E, /* PCI_CHIP_CYPRESS_689E */
0x689C, /* PCI_CHIP_HEMLOCK_689C */
0x689D, /* PCI_CHIP_HEMLOCK_689D */
0x9802, /* PCI_CHIP_PALM_9802 */
0x9803, /* PCI_CHIP_PALM_9803 */
0x9804, /* PCI_CHIP_PALM_9804 */
0x9805, /* PCI_CHIP_PALM_9805 */
0x6720, /* PCI_CHIP_BARTS_6720 */
0x6721, /* PCI_CHIP_BARTS_6721 */
0x6722, /* PCI_CHIP_BARTS_6722 */
0x6723, /* PCI_CHIP_BARTS_6723 */
0x6724, /* PCI_CHIP_BARTS_6724 */
0x6725, /* PCI_CHIP_BARTS_6725 */
0x6726, /* PCI_CHIP_BARTS_6726 */
0x6727, /* PCI_CHIP_BARTS_6727 */
0x6728, /* PCI_CHIP_BARTS_6728 */
0x6729, /* PCI_CHIP_BARTS_6729 */
0x6738, /* PCI_CHIP_BARTS_6738 */
0x6739, /* PCI_CHIP_BARTS_6738 */
0x6740, /* PCI_CHIP_TURKS_6740 */
0x6741, /* PCI_CHIP_TURKS_6741 */
0x6742, /* PCI_CHIP_TURKS_6742 */
0x6743, /* PCI_CHIP_TURKS_6743 */
0x6744, /* PCI_CHIP_TURKS_6744 */
0x6745, /* PCI_CHIP_TURKS_6745 */
0x6746, /* PCI_CHIP_TURKS_6746 */
0x6747, /* PCI_CHIP_TURKS_6747 */
0x6748, /* PCI_CHIP_TURKS_6748 */
0x6749, /* PCI_CHIP_TURKS_6749 */
0x6750, /* PCI_CHIP_TURKS_6750 */
0x6758, /* PCI_CHIP_TURKS_6758 */
0x6759, /* PCI_CHIP_TURKS_6759 */
0x6760, /* PCI_CHIP_CAICOS_6760 */
0x6761, /* PCI_CHIP_CAICOS_6761 */
0x6762, /* PCI_CHIP_CAICOS_6762 */
0x6763, /* PCI_CHIP_CAICOS_6763 */
0x6764, /* PCI_CHIP_CAICOS_6764 */
0x6765, /* PCI_CHIP_CAICOS_6765 */
0x6766, /* PCI_CHIP_CAICOS_6766 */
0x6767, /* PCI_CHIP_CAICOS_6767 */
0x6768, /* PCI_CHIP_CAICOS_6768 */
0x6770, /* PCI_CHIP_CAICOS_6770 */
0x6779, /* PCI_CHIP_CAICOS_6779 */
};
const struct dri2_driver_map driver_map[] = {
{ 0x8086, "i915", i915_chip_ids, ARRAY_SIZE(i915_chip_ids) },
{ 0x8086, "i965", i965_chip_ids, ARRAY_SIZE(i965_chip_ids) },
{ 0x1002, "radeon", r100_chip_ids, ARRAY_SIZE(r100_chip_ids) },
{ 0x1002, "r200", r200_chip_ids, ARRAY_SIZE(r200_chip_ids) },
{ 0x1002, "r300", r300_chip_ids, ARRAY_SIZE(r300_chip_ids) },
{ 0x1002, "r600", r600_chip_ids, ARRAY_SIZE(r600_chip_ids) },
{ 0x10de, "nouveau", NULL, -1 },
};
static char *
dri2_get_device_name(int fd)
{
struct udev *udev;
struct udev_device *device;
struct stat buf;
char *device_name;
udev = udev_new();
if (fstat(fd, &buf) < 0) {
_eglLog(_EGL_WARNING, "EGL-DRI2: failed to stat fd %d", fd);
goto out;
}
device = udev_device_new_from_devnum(udev, 'c', buf.st_rdev);
if (device == NULL) {
_eglLog(_EGL_WARNING,
"EGL-DRI2: could not create udev device for fd %d", fd);
goto out;
}
device_name = udev_device_get_devnode(device);
if (!device_name)
goto out;
device_name = strdup(device_name);
out:
udev_device_unref(device);
udev_unref(udev);
return device_name;
}
char *
dri2_get_driver_for_fd(int fd)
{
struct udev *udev;
struct udev_device *device, *parent;
struct stat buf;
const char *pci_id;
char *driver = NULL;
int vendor_id, chip_id, i, j;
udev = udev_new();
if (fstat(fd, &buf) < 0) {
_eglLog(_EGL_WARNING, "EGL-DRI2: failed to stat fd %d", fd);
goto out;
}
device = udev_device_new_from_devnum(udev, 'c', buf.st_rdev);
if (device == NULL) {
_eglLog(_EGL_WARNING,
"EGL-DRI2: could not create udev device for fd %d", fd);
goto out;
}
parent = udev_device_get_parent(device);
if (parent == NULL) {
_eglLog(_EGL_WARNING, "DRI2: could not get parent device");
goto out;
}
pci_id = udev_device_get_property_value(parent, "PCI_ID");
if (pci_id == NULL || sscanf(pci_id, "%x:%x", &vendor_id, &chip_id) != 2) {
_eglLog(_EGL_WARNING, "EGL-DRI2: malformed or no PCI ID");
goto out;
}
for (i = 0; i < ARRAY_SIZE(driver_map); i++) {
if (vendor_id != driver_map[i].vendor_id)
continue;
if (driver_map[i].num_chips_ids == -1) {
driver = strdup(driver_map[i].driver);
_eglLog(_EGL_DEBUG, "pci id for %d: %04x:%04x, driver %s",
fd, vendor_id, chip_id, driver);
goto out;
}
for (j = 0; j < driver_map[i].num_chips_ids; j++)
if (driver_map[i].chip_ids[j] == chip_id) {
driver = strdup(driver_map[i].driver);
_eglLog(_EGL_DEBUG, "pci id for %d: %04x:%04x, driver %s",
fd, vendor_id, chip_id, driver);
goto out;
}
}
out:
udev_device_unref(device);
udev_unref(udev);
return driver;
}
static int
dri2_drm_authenticate(_EGLDisplay *disp, uint32_t id)
{
struct dri2_egl_display *dri2_dpy = dri2_egl_display(disp);
return drmAuthMagic(dri2_dpy->fd, id);
}
EGLBoolean
dri2_initialize_drm(_EGLDriver *drv, _EGLDisplay *disp)
{
struct dri2_egl_display *dri2_dpy;
int i;
dri2_dpy = malloc(sizeof *dri2_dpy);
if (!dri2_dpy)
return _eglError(EGL_BAD_ALLOC, "eglInitialize");
memset(dri2_dpy, 0, sizeof *dri2_dpy);
disp->DriverData = (void *) dri2_dpy;
dri2_dpy->fd = (int) disp->PlatformDisplay;
dri2_dpy->driver_name = dri2_get_driver_for_fd(dri2_dpy->fd);
if (dri2_dpy->driver_name == NULL)
return _eglError(EGL_BAD_ALLOC, "DRI2: failed to get driver name");
dri2_dpy->device_name = dri2_get_device_name(dri2_dpy->fd);
if (dri2_dpy->device_name == NULL) {
_eglError(EGL_BAD_ALLOC, "DRI2: failed to get device name");
goto cleanup_driver_name;
}
if (!dri2_load_driver(disp))
goto cleanup_device_name;
dri2_dpy->extensions[0] = &image_lookup_extension.base;
dri2_dpy->extensions[1] = &use_invalidate.base;
dri2_dpy->extensions[2] = NULL;
if (!dri2_create_screen(disp))
goto cleanup_driver;
for (i = 0; dri2_dpy->driver_configs[i]; i++)
dri2_add_config(disp, dri2_dpy->driver_configs[i], i + 1, 0, 0, NULL);
disp->Extensions.MESA_drm_image = EGL_TRUE;
disp->Extensions.KHR_image_base = EGL_TRUE;
disp->Extensions.KHR_gl_renderbuffer_image = EGL_TRUE;
disp->Extensions.KHR_gl_texture_2D_image = EGL_TRUE;
#ifdef HAVE_WAYLAND_PLATFORM
disp->Extensions.WL_bind_wayland_display = EGL_TRUE;
#endif
dri2_dpy->authenticate = dri2_drm_authenticate;
/* we're supporting EGL 1.4 */
disp->VersionMajor = 1;
disp->VersionMinor = 4;
return EGL_TRUE;
cleanup_driver:
dlclose(dri2_dpy->driver);
cleanup_device_name:
free(dri2_dpy->device_name);
cleanup_driver_name:
free(dri2_dpy->driver_name);
return EGL_FALSE;
}
#endif

View File

@@ -0,0 +1,707 @@
/*
* Copyright © 2011 Intel Corporation
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and associated documentation files (the "Software"),
* to deal in the Software without restriction, including without limitation
* the rights to use, copy, modify, merge, publish, distribute, sublicense,
* and/or sell copies of the Software, and to permit persons to whom the
* Software is furnished to do so, subject to the following conditions:
*
* The above copyright notice and this permission notice (including the next
* paragraph) shall be included in all copies or substantial portions of the
* Software.
*
* THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND
* NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT
* HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY,
* WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
* OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER
* DEALINGS IN THE SOFTWARE.
*
* Authors:
* Kristian Høgsberg <krh@bitplanet.net>
* Benjamin Franzke <benjaminfranzke@googlemail.com>
*/
#include <stdlib.h>
#include <string.h>
#include <limits.h>
#include <dlfcn.h>
#include <errno.h>
#include <unistd.h>
#include "egl_dri2.h"
#include <wayland-client.h>
#include "wayland-drm-client-protocol.h"
static void
sync_callback(void *data)
{
int *done = data;
*done = 1;
}
static void
force_roundtrip(struct wl_display *display)
{
int done = 0;
wl_display_sync_callback(display, sync_callback, &done);
wl_display_iterate(display, WL_DISPLAY_WRITABLE);
while (!done)
wl_display_iterate(display, WL_DISPLAY_READABLE);
}
/**
* Called via eglCreateWindowSurface(), drv->API.CreateWindowSurface().
*/
static _EGLSurface *
dri2_create_surface(_EGLDriver *drv, _EGLDisplay *disp, EGLint type,
_EGLConfig *conf, EGLNativeWindowType window,
const EGLint *attrib_list)
{
struct dri2_egl_display *dri2_dpy = dri2_egl_display(disp);
struct dri2_egl_config *dri2_conf = dri2_egl_config(conf);
struct dri2_egl_surface *dri2_surf;
struct dri2_egl_buffer *dri2_buf;
int i;
(void) drv;
dri2_surf = malloc(sizeof *dri2_surf);
if (!dri2_surf) {
_eglError(EGL_BAD_ALLOC, "dri2_create_surface");
return NULL;
}
if (!_eglInitSurface(&dri2_surf->base, disp, type, conf, attrib_list))
goto cleanup_surf;
for (i = 0; i < WL_BUFFER_COUNT; ++i)
dri2_surf->wl_drm_buffer[i] = NULL;
for (i = 0; i < __DRI_BUFFER_COUNT; ++i)
dri2_surf->dri_buffers[i] = NULL;
dri2_surf->pending_buffer = NULL;
dri2_surf->block_swap_buffers = EGL_FALSE;
switch (type) {
case EGL_WINDOW_BIT:
dri2_surf->wl_win = (struct wl_egl_window *) window;
dri2_surf->type = DRI2_WINDOW_SURFACE;
dri2_surf->base.Width = -1;
dri2_surf->base.Height = -1;
break;
case EGL_PIXMAP_BIT:
dri2_surf->wl_pix = (struct wl_egl_pixmap *) window;
dri2_surf->type = DRI2_PIXMAP_SURFACE;
dri2_surf->base.Width = dri2_surf->wl_pix->width;
dri2_surf->base.Height = dri2_surf->wl_pix->height;
if (dri2_surf->wl_pix->name > 0) {
dri2_buf = dri2_surf->wl_pix->driver_private;
dri2_surf->dri_buffers[__DRI_BUFFER_FRONT_LEFT] = dri2_buf->dri_buffer;
}
break;
default:
goto cleanup_surf;
}
dri2_surf->dri_drawable =
(*dri2_dpy->dri2->createNewDrawable) (dri2_dpy->dri_screen,
type == EGL_WINDOW_BIT ?
dri2_conf->dri_double_config :
dri2_conf->dri_single_config,
dri2_surf);
if (dri2_surf->dri_drawable == NULL) {
_eglError(EGL_BAD_ALLOC, "dri2->createNewDrawable");
goto cleanup_dri_drawable;
}
return &dri2_surf->base;
cleanup_dri_drawable:
dri2_dpy->core->destroyDrawable(dri2_surf->dri_drawable);
cleanup_surf:
free(dri2_surf);
return NULL;
}
/**
* Called via eglCreateWindowSurface(), drv->API.CreateWindowSurface().
*/
static _EGLSurface *
dri2_create_window_surface(_EGLDriver *drv, _EGLDisplay *disp,
_EGLConfig *conf, EGLNativeWindowType window,
const EGLint *attrib_list)
{
return dri2_create_surface(drv, disp, EGL_WINDOW_BIT, conf,
window, attrib_list);
}
static _EGLSurface *
dri2_create_pixmap_surface(_EGLDriver *drv, _EGLDisplay *disp,
_EGLConfig *conf, EGLNativePixmapType pixmap,
const EGLint *attrib_list)
{
return dri2_create_surface(drv, disp, EGL_PIXMAP_BIT, conf,
pixmap, attrib_list);
}
/**
* Called via eglDestroySurface(), drv->API.DestroySurface().
*/
static EGLBoolean
dri2_destroy_surface(_EGLDriver *drv, _EGLDisplay *disp, _EGLSurface *surf)
{
struct dri2_egl_display *dri2_dpy = dri2_egl_display(disp);
struct dri2_egl_surface *dri2_surf = dri2_egl_surface(surf);
int i;
(void) drv;
if (!_eglPutSurface(surf))
return EGL_TRUE;
(*dri2_dpy->core->destroyDrawable)(dri2_surf->dri_drawable);
for (i = 0; i < WL_BUFFER_COUNT; ++i)
if (dri2_surf->wl_drm_buffer[i])
wl_buffer_destroy(dri2_surf->wl_drm_buffer[i]);
for (i = 0; i < __DRI_BUFFER_COUNT; ++i)
if (dri2_surf->dri_buffers[i] && !(i == __DRI_BUFFER_FRONT_LEFT &&
dri2_surf->type == DRI2_PIXMAP_SURFACE))
dri2_dpy->dri2->releaseBuffer(dri2_dpy->dri_screen,
dri2_surf->dri_buffers[i]);
free(surf);
return EGL_TRUE;
}
static void
dri2_wl_egl_pixmap_destroy(struct wl_egl_pixmap *egl_pixmap)
{
struct dri2_egl_buffer *dri2_buf = egl_pixmap->driver_private;
assert(dri2_buf);
dri2_buf->dri2_dpy->dri2->releaseBuffer(dri2_buf->dri2_dpy->dri_screen,
dri2_buf->dri_buffer);
free(dri2_buf);
egl_pixmap->driver_private = NULL;
egl_pixmap->destroy = NULL;
egl_pixmap->name = 0;
}
static void
dri2_process_back_buffer(struct dri2_egl_surface *dri2_surf, unsigned format)
{
struct dri2_egl_display *dri2_dpy =
dri2_egl_display(dri2_surf->base.Resource.Display);
(void) format;
switch (dri2_surf->type) {
case DRI2_WINDOW_SURFACE:
/* allocate a front buffer for our double-buffered window*/
dri2_surf->dri_buffers[__DRI_BUFFER_FRONT_LEFT] =
dri2_dpy->dri2->allocateBuffer(dri2_dpy->dri_screen,
__DRI_BUFFER_FRONT_LEFT, format,
dri2_surf->base.Width, dri2_surf->base.Height);
break;
default:
break;
}
}
static void
dri2_process_front_buffer(struct dri2_egl_surface *dri2_surf, unsigned format)
{
struct dri2_egl_display *dri2_dpy =
dri2_egl_display(dri2_surf->base.Resource.Display);
struct dri2_egl_buffer *dri2_buf;
switch (dri2_surf->type) {
case DRI2_PIXMAP_SURFACE:
dri2_buf = malloc(sizeof *dri2_buf);
if (!dri2_buf)
return;
dri2_buf->dri_buffer = dri2_surf->dri_buffers[__DRI_BUFFER_FRONT_LEFT];
dri2_buf->dri2_dpy = dri2_dpy;
dri2_surf->wl_pix->name = dri2_buf->dri_buffer->name;
dri2_surf->wl_pix->stride = dri2_buf->dri_buffer->pitch;
dri2_surf->wl_pix->driver_private = dri2_buf;
dri2_surf->wl_pix->destroy = dri2_wl_egl_pixmap_destroy;
break;
default:
break;
}
}
static void
dri2_release_pending_buffer(void *data)
{
struct dri2_egl_surface *dri2_surf = data;
struct dri2_egl_display *dri2_dpy =
dri2_egl_display(dri2_surf->base.Resource.Display);
/* FIXME: print internal error */
if (!dri2_surf->pending_buffer)
return;
dri2_dpy->dri2->releaseBuffer(dri2_dpy->dri_screen,
dri2_surf->pending_buffer);
dri2_surf->pending_buffer = NULL;
}
static void
dri2_release_buffers(struct dri2_egl_surface *dri2_surf)
{
struct dri2_egl_display *dri2_dpy =
dri2_egl_display(dri2_surf->base.Resource.Display);
int i;
for (i = 0; i < __DRI_BUFFER_COUNT; ++i) {
if (dri2_surf->dri_buffers[i]) {
switch (i) {
case __DRI_BUFFER_FRONT_LEFT:
if (dri2_surf->pending_buffer)
force_roundtrip(dri2_dpy->wl_dpy->display);
dri2_surf->pending_buffer = dri2_surf->dri_buffers[i];
wl_display_sync_callback(dri2_dpy->wl_dpy->display,
dri2_release_pending_buffer, dri2_surf);
break;
default:
dri2_dpy->dri2->releaseBuffer(dri2_dpy->dri_screen,
dri2_surf->dri_buffers[i]);
break;
}
dri2_surf->dri_buffers[i] = NULL;
}
}
}
static __DRIbuffer *
dri2_get_buffers_with_format(__DRIdrawable * driDrawable,
int *width, int *height,
unsigned int *attachments, int count,
int *out_count, void *loaderPrivate)
{
struct dri2_egl_surface *dri2_surf = loaderPrivate;
struct dri2_egl_display *dri2_dpy =
dri2_egl_display(dri2_surf->base.Resource.Display);
int i;
if (dri2_surf->type == DRI2_WINDOW_SURFACE &&
(dri2_surf->base.Width != dri2_surf->wl_win->width ||
dri2_surf->base.Height != dri2_surf->wl_win->height)) {
dri2_release_buffers(dri2_surf);
dri2_surf->base.Width = dri2_surf->wl_win->width;
dri2_surf->base.Height = dri2_surf->wl_win->height;
dri2_surf->dx = dri2_surf->wl_win->dx;
dri2_surf->dy = dri2_surf->wl_win->dy;
for (i = 0; i < WL_BUFFER_COUNT; ++i) {
if (dri2_surf->wl_drm_buffer[i])
wl_buffer_destroy(dri2_surf->wl_drm_buffer[i]);
dri2_surf->wl_drm_buffer[i] = NULL;
}
}
dri2_surf->buffer_count = 0;
for (i = 0; i < 2*count; i+=2) {
assert(attachments[i] < __DRI_BUFFER_COUNT);
assert(dri2_surf->buffer_count < 5);
if (dri2_surf->dri_buffers[attachments[i]] == NULL) {
dri2_surf->dri_buffers[attachments[i]] =
dri2_dpy->dri2->allocateBuffer(dri2_dpy->dri_screen,
attachments[i], attachments[i+1],
dri2_surf->base.Width, dri2_surf->base.Height);
if (!dri2_surf->dri_buffers[attachments[i]])
continue;
if (attachments[i] == __DRI_BUFFER_FRONT_LEFT)
dri2_process_front_buffer(dri2_surf, attachments[i+1]);
else if (attachments[i] == __DRI_BUFFER_BACK_LEFT)
dri2_process_back_buffer(dri2_surf, attachments[i+1]);
}
memcpy(&dri2_surf->buffers[dri2_surf->buffer_count],
dri2_surf->dri_buffers[attachments[i]],
sizeof(__DRIbuffer));
dri2_surf->buffer_count++;
}
assert(dri2_surf->type == DRI2_PIXMAP_SURFACE ||
dri2_surf->dri_buffers[__DRI_BUFFER_BACK_LEFT]);
*out_count = dri2_surf->buffer_count;
if (dri2_surf->buffer_count == 0)
return NULL;
*width = dri2_surf->base.Width;
*height = dri2_surf->base.Height;
return dri2_surf->buffers;
}
static __DRIbuffer *
dri2_get_buffers(__DRIdrawable * driDrawable,
int *width, int *height,
unsigned int *attachments, int count,
int *out_count, void *loaderPrivate)
{
unsigned int *attachments_with_format;
__DRIbuffer *buffer;
const unsigned int format = 32;
int i;
attachments_with_format = calloc(count * 2, sizeof(unsigned int));
if (!attachments_with_format) {
*out_count = 0;
return NULL;
}
for (i = 0; i < count; ++i) {
attachments_with_format[2*i] = attachments[i];
attachments_with_format[2*i + 1] = format;
}
buffer =
dri2_get_buffers_with_format(driDrawable,
width, height,
attachments_with_format, count,
out_count, loaderPrivate);
free(attachments_with_format);
return buffer;
}
static void
dri2_flush_front_buffer(__DRIdrawable * driDrawable, void *loaderPrivate)
{
(void) driDrawable;
/* FIXME: Does EGL support front buffer rendering at all? */
#if 0
struct dri2_egl_surface *dri2_surf = loaderPrivate;
dri2WaitGL(dri2_surf);
#else
(void) loaderPrivate;
#endif
}
static struct wl_buffer *
wayland_create_buffer(struct dri2_egl_surface *dri2_surf, __DRIbuffer *buffer)
{
struct dri2_egl_display *dri2_dpy =
dri2_egl_display(dri2_surf->base.Resource.Display);
return wl_drm_create_buffer(dri2_dpy->wl_dpy->drm, buffer->name,
dri2_surf->base.Width, dri2_surf->base.Height,
buffer->pitch, dri2_surf->wl_win->visual);
}
static void
wayland_frame_callback(void *data, uint32_t time)
{
struct dri2_egl_surface *dri2_surf = data;
dri2_surf->block_swap_buffers = EGL_FALSE;
}
static inline void
pointer_swap(const void **p1, const void **p2)
{
const void *tmp = *p1;
*p1 = *p2;
*p2 = tmp;
}
/**
* Called via eglSwapBuffers(), drv->API.SwapBuffers().
*/
static EGLBoolean
dri2_swap_buffers(_EGLDriver *drv, _EGLDisplay *disp, _EGLSurface *draw)
{
struct dri2_egl_display *dri2_dpy = dri2_egl_display(disp);
struct dri2_egl_surface *dri2_surf = dri2_egl_surface(draw);
struct dri2_egl_driver *dri2_drv = dri2_egl_driver(drv);
while (dri2_surf->block_swap_buffers)
wl_display_iterate(dri2_dpy->wl_dpy->display, WL_DISPLAY_READABLE);
dri2_surf->block_swap_buffers = EGL_TRUE;
wl_display_frame_callback(dri2_dpy->wl_dpy->display,
wayland_frame_callback, dri2_surf);
if (dri2_surf->type == DRI2_WINDOW_SURFACE) {
pointer_swap(
(const void **) &dri2_surf->dri_buffers[__DRI_BUFFER_FRONT_LEFT],
(const void **) &dri2_surf->dri_buffers[__DRI_BUFFER_BACK_LEFT]);
dri2_surf->dri_buffers[__DRI_BUFFER_FRONT_LEFT]->attachment =
__DRI_BUFFER_FRONT_LEFT;
dri2_surf->dri_buffers[__DRI_BUFFER_BACK_LEFT]->attachment =
__DRI_BUFFER_BACK_LEFT;
pointer_swap((const void **) &dri2_surf->wl_drm_buffer[WL_BUFFER_FRONT],
(const void **) &dri2_surf->wl_drm_buffer[WL_BUFFER_BACK]);
if (!dri2_surf->wl_drm_buffer[WL_BUFFER_FRONT])
dri2_surf->wl_drm_buffer[WL_BUFFER_FRONT] =
wayland_create_buffer(dri2_surf,
dri2_surf->dri_buffers[__DRI_BUFFER_FRONT_LEFT]);
wl_surface_attach(dri2_surf->wl_win->surface,
dri2_surf->wl_drm_buffer[WL_BUFFER_FRONT],
dri2_surf->dx, dri2_surf->dy);
dri2_surf->wl_win->attached_width = dri2_surf->base.Width;
dri2_surf->wl_win->attached_height = dri2_surf->base.Height;
/* reset resize growing parameters */
dri2_surf->dx = 0;
dri2_surf->dy = 0;
wl_surface_damage(dri2_surf->wl_win->surface, 0, 0,
dri2_surf->base.Width, dri2_surf->base.Height);
}
_EGLContext *ctx;
if (dri2_drv->glFlush) {
ctx = _eglGetCurrentContext();
if (ctx && ctx->DrawSurface == &dri2_surf->base)
dri2_drv->glFlush();
}
(*dri2_dpy->flush->flush)(dri2_surf->dri_drawable);
(*dri2_dpy->flush->invalidate)(dri2_surf->dri_drawable);
return EGL_TRUE;
}
/**
* Called via eglCreateImageKHR(), drv->API.CreateImageKHR().
*/
static _EGLImage *
dri2_create_image_khr_pixmap(_EGLDisplay *disp, _EGLContext *ctx,
EGLClientBuffer buffer, const EGLint *attr_list)
{
struct dri2_egl_display *dri2_dpy = dri2_egl_display(disp);
struct wl_egl_pixmap *wl_egl_pixmap = (struct wl_egl_pixmap *) buffer;
struct dri2_egl_buffer *dri2_buf;
EGLint wl_attr_list[] = {
EGL_WIDTH, 0,
EGL_HEIGHT, 0,
EGL_DRM_BUFFER_STRIDE_MESA, 0,
EGL_DRM_BUFFER_FORMAT_MESA, EGL_DRM_BUFFER_FORMAT_ARGB32_MESA,
EGL_NONE
};
dri2_buf = malloc(sizeof *dri2_buf);
if (!dri2_buf)
return NULL;
dri2_buf->dri2_dpy = dri2_dpy;
dri2_buf->dri_buffer =
dri2_dpy->dri2->allocateBuffer(dri2_dpy->dri_screen,
__DRI_BUFFER_FRONT_LEFT, 32,
wl_egl_pixmap->width,
wl_egl_pixmap->height);
wl_egl_pixmap->name = dri2_buf->dri_buffer->name;
wl_egl_pixmap->stride = dri2_buf->dri_buffer->pitch;
wl_egl_pixmap->destroy = dri2_wl_egl_pixmap_destroy;
wl_egl_pixmap->driver_private = dri2_buf;
wl_attr_list[1] = wl_egl_pixmap->width;
wl_attr_list[3] = wl_egl_pixmap->height;
wl_attr_list[5] = wl_egl_pixmap->stride / 4;
return dri2_create_image_khr(disp->Driver, disp, ctx, EGL_DRM_BUFFER_MESA,
(EGLClientBuffer)(intptr_t) wl_egl_pixmap->name, wl_attr_list);
}
static _EGLImage *
dri2_wayland_create_image_khr(_EGLDriver *drv, _EGLDisplay *disp,
_EGLContext *ctx, EGLenum target,
EGLClientBuffer buffer, const EGLint *attr_list)
{
(void) drv;
switch (target) {
case EGL_NATIVE_PIXMAP_KHR:
return dri2_create_image_khr_pixmap(disp, ctx, buffer, attr_list);
default:
return dri2_create_image_khr(drv, disp, ctx, target, buffer, attr_list);
}
}
static int
dri2_wayland_authenticate(_EGLDisplay *disp, uint32_t id)
{
struct dri2_egl_display *dri2_dpy = dri2_egl_display(disp);
int ret = 0;
dri2_dpy->wl_dpy->authenticated = false;
wl_drm_authenticate(dri2_dpy->wl_dpy->drm, id);
force_roundtrip(dri2_dpy->wl_dpy->display);
if (!dri2_dpy->wl_dpy->authenticated)
ret = -1;
/* reset authenticated */
dri2_dpy->wl_dpy->authenticated = true;
return ret;
}
/**
* Called via eglTerminate(), drv->API.Terminate().
*/
static EGLBoolean
dri2_terminate(_EGLDriver *drv, _EGLDisplay *disp)
{
struct dri2_egl_display *dri2_dpy = dri2_egl_display(disp);
_eglReleaseDisplayResources(drv, disp);
_eglCleanupDisplay(disp);
dri2_dpy->core->destroyScreen(dri2_dpy->dri_screen);
close(dri2_dpy->fd);
dlclose(dri2_dpy->driver);
free(dri2_dpy->driver_name);
free(dri2_dpy);
disp->DriverData = NULL;
return EGL_TRUE;
}
EGLBoolean
dri2_initialize_wayland(_EGLDriver *drv, _EGLDisplay *disp)
{
struct dri2_egl_display *dri2_dpy;
int i;
drv->API.CreateWindowSurface = dri2_create_window_surface;
drv->API.CreatePixmapSurface = dri2_create_pixmap_surface;
drv->API.DestroySurface = dri2_destroy_surface;
drv->API.SwapBuffers = dri2_swap_buffers;
drv->API.CreateImageKHR = dri2_wayland_create_image_khr;
drv->API.Terminate = dri2_terminate;
dri2_dpy = malloc(sizeof *dri2_dpy);
if (!dri2_dpy)
return _eglError(EGL_BAD_ALLOC, "eglInitialize");
memset(dri2_dpy, 0, sizeof *dri2_dpy);
disp->DriverData = (void *) dri2_dpy;
dri2_dpy->wl_dpy = disp->PlatformDisplay;
if (dri2_dpy->wl_dpy->fd == -1)
force_roundtrip(dri2_dpy->wl_dpy->display);
if (dri2_dpy->wl_dpy->fd == -1)
goto cleanup_dpy;
dri2_dpy->fd = dup(dri2_dpy->wl_dpy->fd);
if (dri2_dpy->fd < 0) {
_eglError(EGL_BAD_ALLOC, "DRI2: failed to dup fd");
goto cleanup_dpy;
}
if (!dri2_dpy->wl_dpy->authenticated)
force_roundtrip(dri2_dpy->wl_dpy->display);
if (!dri2_dpy->wl_dpy->authenticated)
goto cleanup_dpy;
dri2_dpy->driver_name = dri2_get_driver_for_fd(dri2_dpy->fd);
if (dri2_dpy->driver_name == NULL) {
_eglError(EGL_BAD_ALLOC, "DRI2: failed to get driver name");
goto cleanup_fd;
}
dri2_dpy->device_name = strdup(dri2_dpy->wl_dpy->device_name);
if (dri2_dpy->device_name == NULL) {
_eglError(EGL_BAD_ALLOC, "DRI2: failed to get device name");
goto cleanup_driver_name;
}
if (!dri2_load_driver(disp))
goto cleanup_device_name;
dri2_dpy->dri2_loader_extension.base.name = __DRI_DRI2_LOADER;
dri2_dpy->dri2_loader_extension.base.version = 3;
dri2_dpy->dri2_loader_extension.getBuffers = dri2_get_buffers;
dri2_dpy->dri2_loader_extension.flushFrontBuffer = dri2_flush_front_buffer;
dri2_dpy->dri2_loader_extension.getBuffersWithFormat =
dri2_get_buffers_with_format;
dri2_dpy->extensions[0] = &dri2_dpy->dri2_loader_extension.base;
dri2_dpy->extensions[1] = &image_lookup_extension.base;
dri2_dpy->extensions[2] = NULL;
if (!dri2_create_screen(disp))
goto cleanup_driver;
for (i = 0; dri2_dpy->driver_configs[i]; i++)
dri2_add_config(disp, dri2_dpy->driver_configs[i], i + 1, 0,
EGL_WINDOW_BIT | EGL_PIXMAP_BIT, NULL);
disp->Extensions.MESA_drm_image = EGL_TRUE;
disp->Extensions.KHR_image_base = EGL_TRUE;
disp->Extensions.KHR_image_pixmap = EGL_TRUE;
disp->Extensions.KHR_gl_renderbuffer_image = EGL_TRUE;
disp->Extensions.KHR_gl_texture_2D_image = EGL_TRUE;
disp->Extensions.WL_bind_wayland_display = EGL_TRUE;
dri2_dpy->authenticate = dri2_wayland_authenticate;
/* we're supporting EGL 1.4 */
disp->VersionMajor = 1;
disp->VersionMinor = 4;
return EGL_TRUE;
cleanup_driver:
dlclose(dri2_dpy->driver);
cleanup_device_name:
free(dri2_dpy->device_name);
cleanup_driver_name:
free(dri2_dpy->driver_name);
cleanup_fd:
close(dri2_dpy->fd);
cleanup_dpy:
free(dri2_dpy);
return EGL_FALSE;
}

File diff suppressed because it is too large Load Diff

View File

@@ -3,7 +3,7 @@
TOP = ../../../..
include $(TOP)/configs/current
EGL_DRIVER = egl_glx.so
EGL_DRIVER = egl_glx
EGL_SOURCES = egl_glx.c
EGL_INCLUDES = \
@@ -11,6 +11,9 @@ EGL_INCLUDES = \
-I$(TOP)/src/egl/main
EGL_CFLAGS = $(X11_CFLAGS)
EGL_LIBS = $(X11_LIBS) -lGL
EGL_LIBS = $(X11_LIBS) $(DLOPEN_LIBS)
EGL_CFLAGS += -D_EGL_MAIN=_eglBuiltInDriverGLX
EGL_BUILTIN = true
include ../Makefile.template

File diff suppressed because it is too large Load Diff

View File

@@ -36,6 +36,7 @@ SOURCES = \
eglcurrent.c \
egldisplay.c \
egldriver.c \
eglfallbacks.c \
eglglobals.c \
eglimage.c \
egllog.c \
@@ -51,12 +52,31 @@ OBJECTS = $(SOURCES:.c=.o)
# use dl*() to load drivers
LOCAL_CFLAGS = -D_EGL_OS_UNIX=1
LOCAL_LIBS =
# egl_dri2 and egl_glx are built-ins
ifeq ($(filter dri2, $(EGL_DRIVERS_DIRS)),dri2)
LOCAL_CFLAGS += -D_EGL_BUILT_IN_DRIVER_DRI2
LOCAL_LIBS += $(TOP)/src/egl/drivers/dri2/libegl_dri2.a
ifneq ($(findstring wayland, $(EGL_PLATFORMS)),)
LOCAL_LIBS += $(TOP)/src/egl/wayland/wayland-drm/libwayland-drm.a
endif
EGL_LIB_DEPS += $(XCB_DRI2_LIBS) $(LIBUDEV_LIBS) $(DLOPEN_LIBS) $(LIBDRM_LIB) $(WAYLAND_LIBS)
endif
ifeq ($(filter glx, $(EGL_DRIVERS_DIRS)),glx)
LOCAL_CFLAGS += -D_EGL_BUILT_IN_DRIVER_GLX
LOCAL_LIBS += $(TOP)/src/egl/drivers/glx/libegl_glx.a
EGL_LIB_DEPS += $(X11_LIBS) $(DLOPEN_LIBS)
endif
# translate --with-egl-platforms to _EGLPlatformType
EGL_NATIVE_PLATFORM=_EGL_INVALID_PLATFORM
ifeq ($(firstword $(EGL_PLATFORMS)),x11)
EGL_NATIVE_PLATFORM=_EGL_PLATFORM_X11
endif
ifeq ($(firstword $(EGL_PLATFORMS)),wayland)
EGL_NATIVE_PLATFORM=_EGL_PLATFORM_WAYLAND
endif
ifeq ($(firstword $(EGL_PLATFORMS)),drm)
EGL_NATIVE_PLATFORM=_EGL_PLATFORM_DRM
endif
@@ -79,11 +99,12 @@ default: depend library
# EGL Library
library: $(TOP)/$(LIB_DIR)/$(EGL_LIB_NAME)
$(TOP)/$(LIB_DIR)/$(EGL_LIB_NAME): $(OBJECTS)
$(TOP)/$(LIB_DIR)/$(EGL_LIB_NAME): $(OBJECTS) $(LOCAL_LIBS)
$(MKLIB) -o $(EGL_LIB) -linker '$(CC)' -ldflags '$(LDFLAGS)' \
-major $(EGL_MAJOR) -minor $(EGL_MINOR) \
-install $(TOP)/$(LIB_DIR) $(MKLIB_OPTIONS) \
$(EGL_LIB_DEPS) $(OBJECTS)
-L$(TOP)/$(LIB_DIR) $(EGL_LIB_DEPS) \
$(OBJECTS) $(LOCAL_LIBS)
install-headers:
$(INSTALL) -d $(DESTDIR)$(INSTALL_INC_DIR)/KHR

View File

@@ -4,48 +4,53 @@
Import('*')
if env['platform'] != 'winddk':
env = env.Clone()
env = env.Clone()
env.Append(CPPDEFINES = [
'_EGL_BUILT_IN_DRIVER_GALLIUM',
'_EGL_DRIVER_SEARCH_DIR=\\"\\"',
])
env.Append(CPPDEFINES = [
'_EGL_NATIVE_PLATFORM=_EGL_PLATFORM_WINDOWS',
'_EGL_DRIVER_SEARCH_DIR=\\"\\"',
'_EGL_OS_WINDOWS',
'_EGL_GET_CORE_ADDRESSES',
'KHRONOS_DLL_EXPORTS',
])
if env['platform'] == 'windows':
env.Append(CPPDEFINES = [
'_EGL_NATIVE_PLATFORM=_EGL_PLATFORM_WINDOWS',
'_EGL_OS_WINDOWS',
'_EGL_GET_CORE_ADDRESSES',
'KHRONOS_DLL_EXPORTS',
])
else:
env.Append(CPPDEFINES = [
'_EGL_NATIVE_PLATFORM=_EGL_PLATFORM_X11',
'_EGL_OS_UNIX',
])
env.Append(CPPPATH = [
'#/include',
])
env.Append(CPPPATH = [
'#/include',
])
egl_sources = [
'eglapi.c',
'eglarray.c',
'eglconfig.c',
'eglcontext.c',
'eglcurrent.c',
'egldisplay.c',
'egldriver.c',
'eglglobals.c',
'eglimage.c',
'egllog.c',
'eglmisc.c',
'eglmode.c',
'eglscreen.c',
'eglstring.c',
'eglsurface.c',
'eglsync.c',
]
egl_sources = [
'eglapi.c',
'eglarray.c',
'eglconfig.c',
'eglcontext.c',
'eglcurrent.c',
'egldisplay.c',
'egldriver.c',
'eglfallbacks.c',
'eglglobals.c',
'eglimage.c',
'egllog.c',
'eglmisc.c',
'eglmode.c',
'eglscreen.c',
'eglstring.c',
'eglsurface.c',
'eglsync.c',
]
egl = env.SharedLibrary(
target = 'libEGL',
source = egl_sources + ['egl.def'],
)
egl = env.ConvenienceLibrary(
target = 'egl',
source = egl_sources,
)
env.InstallSharedLibrary(egl, version=(1, 4, 0))
egl = [env.FindIxes(egl, 'LIBPREFIX', 'LIBSUFFIX')]
Export('egl')
Export('egl')

View File

@@ -57,7 +57,6 @@
#include <stdlib.h>
#include <string.h>
#include "eglstring.h"
#include "eglcontext.h"
#include "egldisplay.h"
#include "egltypedefs.h"
@@ -294,16 +293,14 @@ eglInitialize(EGLDisplay dpy, EGLint *major, EGLint *minor)
if (!_eglMatchDriver(disp, EGL_FALSE))
RETURN_EGL_ERROR(disp, EGL_NOT_INITIALIZED, EGL_FALSE);
_eglsnprintf(disp->Version, sizeof(disp->Version), "%d.%d (%s)",
disp->APImajor, disp->APIminor, disp->Driver->Name);
/* limit to APIs supported by core */
disp->ClientAPIsMask &= _EGL_API_ALL_BITS;
disp->ClientAPIs &= _EGL_API_ALL_BITS;
}
/* Update applications version of major and minor if not NULL */
if ((major != NULL) && (minor != NULL)) {
*major = disp->APImajor;
*minor = disp->APIminor;
*major = disp->VersionMajor;
*minor = disp->VersionMinor;
}
RETURN_EGL_SUCCESS(disp, EGL_TRUE);
@@ -402,16 +399,21 @@ eglCreateContext(EGLDisplay dpy, EGLConfig config, EGLContext share_list,
_EGLContext *context;
EGLContext ret;
if (config)
_EGL_CHECK_CONFIG(disp, conf, EGL_NO_CONTEXT, drv);
else
_EGL_CHECK_DISPLAY(disp, EGL_NO_CONTEXT, drv);
_EGL_CHECK_DISPLAY(disp, EGL_NO_CONTEXT, drv);
if (!config) {
/* config may be NULL if surfaceless */
if (!disp->Extensions.KHR_surfaceless_gles1 &&
!disp->Extensions.KHR_surfaceless_gles2 &&
!disp->Extensions.KHR_surfaceless_opengl)
RETURN_EGL_ERROR(disp, EGL_BAD_CONFIG, EGL_NO_CONTEXT);
}
if (!share && share_list != EGL_NO_CONTEXT)
RETURN_EGL_ERROR(disp, EGL_BAD_CONTEXT, EGL_NO_CONTEXT);
context = drv->API.CreateContext(drv, disp, conf, share, attrib_list);
ret = (context) ? _eglLinkContext(context, disp) : EGL_NO_CONTEXT;
ret = (context) ? _eglLinkContext(context) : EGL_NO_CONTEXT;
RETURN_EGL_EVAL(disp, ret);
}
@@ -459,9 +461,19 @@ eglMakeCurrent(EGLDisplay dpy, EGLSurface draw, EGLSurface read,
if (!context && ctx != EGL_NO_CONTEXT)
RETURN_EGL_ERROR(disp, EGL_BAD_CONTEXT, EGL_FALSE);
if ((!draw_surf && draw != EGL_NO_SURFACE) ||
(!read_surf && read != EGL_NO_SURFACE))
RETURN_EGL_ERROR(disp, EGL_BAD_SURFACE, EGL_FALSE);
if (!draw_surf || !read_surf) {
/* surfaces may be NULL if surfaceless */
if (!disp->Extensions.KHR_surfaceless_gles1 &&
!disp->Extensions.KHR_surfaceless_gles2 &&
!disp->Extensions.KHR_surfaceless_opengl)
RETURN_EGL_ERROR(disp, EGL_BAD_SURFACE, EGL_FALSE);
if ((!draw_surf && draw != EGL_NO_SURFACE) ||
(!read_surf && read != EGL_NO_SURFACE))
RETURN_EGL_ERROR(disp, EGL_BAD_SURFACE, EGL_FALSE);
if (draw_surf || read_surf)
RETURN_EGL_ERROR(disp, EGL_BAD_MATCH, EGL_FALSE);
}
ret = drv->API.MakeCurrent(drv, disp, draw_surf, read_surf, context);
@@ -500,7 +512,7 @@ eglCreateWindowSurface(EGLDisplay dpy, EGLConfig config,
RETURN_EGL_ERROR(disp, EGL_BAD_NATIVE_WINDOW, EGL_NO_SURFACE);
surf = drv->API.CreateWindowSurface(drv, disp, conf, window, attrib_list);
ret = (surf) ? _eglLinkSurface(surf, disp) : EGL_NO_SURFACE;
ret = (surf) ? _eglLinkSurface(surf) : EGL_NO_SURFACE;
RETURN_EGL_EVAL(disp, ret);
}
@@ -521,7 +533,7 @@ eglCreatePixmapSurface(EGLDisplay dpy, EGLConfig config,
RETURN_EGL_ERROR(disp, EGL_BAD_NATIVE_PIXMAP, EGL_NO_SURFACE);
surf = drv->API.CreatePixmapSurface(drv, disp, conf, pixmap, attrib_list);
ret = (surf) ? _eglLinkSurface(surf, disp) : EGL_NO_SURFACE;
ret = (surf) ? _eglLinkSurface(surf) : EGL_NO_SURFACE;
RETURN_EGL_EVAL(disp, ret);
}
@@ -540,7 +552,7 @@ eglCreatePbufferSurface(EGLDisplay dpy, EGLConfig config,
_EGL_CHECK_CONFIG(disp, conf, EGL_NO_SURFACE, drv);
surf = drv->API.CreatePbufferSurface(drv, disp, conf, attrib_list);
ret = (surf) ? _eglLinkSurface(surf, disp) : EGL_NO_SURFACE;
ret = (surf) ? _eglLinkSurface(surf) : EGL_NO_SURFACE;
RETURN_EGL_EVAL(disp, ret);
}
@@ -633,11 +645,12 @@ eglSwapInterval(EGLDisplay dpy, EGLint interval)
_EGL_CHECK_DISPLAY(disp, EGL_FALSE, drv);
if (!ctx || !_eglIsContextLinked(ctx) || ctx->Resource.Display != disp)
if (_eglGetContextHandle(ctx) == EGL_NO_CONTEXT ||
ctx->Resource.Display != disp)
RETURN_EGL_ERROR(disp, EGL_BAD_CONTEXT, EGL_FALSE);
surf = ctx->DrawSurface;
if (!_eglIsSurfaceLinked(surf))
if (_eglGetSurfaceHandle(surf) == EGL_NO_SURFACE)
RETURN_EGL_ERROR(disp, EGL_BAD_SURFACE, EGL_FALSE);
ret = drv->API.SwapInterval(drv, disp, surf, interval);
@@ -658,7 +671,8 @@ eglSwapBuffers(EGLDisplay dpy, EGLSurface surface)
_EGL_CHECK_SURFACE(disp, surf, EGL_FALSE, drv);
/* surface must be bound to current context in EGL 1.4 */
if (!ctx || !_eglIsContextLinked(ctx) || surf != ctx->DrawSurface)
if (_eglGetContextHandle(ctx) == EGL_NO_CONTEXT ||
surf != ctx->DrawSurface)
RETURN_EGL_ERROR(disp, EGL_BAD_SURFACE, EGL_FALSE);
ret = drv->API.SwapBuffers(drv, disp, surf);
@@ -699,7 +713,8 @@ eglWaitClient(void)
_eglLockMutex(&disp->Mutex);
/* let bad current context imply bad current surface */
if (!_eglIsContextLinked(ctx) || !_eglIsSurfaceLinked(ctx->DrawSurface))
if (_eglGetContextHandle(ctx) == EGL_NO_CONTEXT ||
_eglGetSurfaceHandle(ctx->DrawSurface) == EGL_NO_SURFACE)
RETURN_EGL_ERROR(disp, EGL_BAD_CURRENT_SURFACE, EGL_FALSE);
/* a valid current context implies an initialized current display */
@@ -748,7 +763,8 @@ eglWaitNative(EGLint engine)
_eglLockMutex(&disp->Mutex);
/* let bad current context imply bad current surface */
if (!_eglIsContextLinked(ctx) || !_eglIsSurfaceLinked(ctx->DrawSurface))
if (_eglGetContextHandle(ctx) == EGL_NO_CONTEXT ||
_eglGetSurfaceHandle(ctx->DrawSurface) == EGL_NO_SURFACE)
RETURN_EGL_ERROR(disp, EGL_BAD_CURRENT_SURFACE, EGL_FALSE);
/* a valid current context implies an initialized current display */
@@ -897,6 +913,13 @@ eglGetProcAddress(const char *procname)
#ifdef EGL_MESA_drm_image
{ "eglCreateDRMImageMESA", (_EGLProc) eglCreateDRMImageMESA },
{ "eglExportDRMImageMESA", (_EGLProc) eglExportDRMImageMESA },
#endif
#ifdef EGL_WL_bind_display
{ "eglBindWaylandDisplayWL", (_EGLProc) eglBindWaylandDisplayWL },
{ "eglUnbindWaylandDisplayWL", (_EGLProc) eglUnbindWaylandDisplayWL },
#endif
#ifdef EGL_ANDROID_swap_rectangle
{ "eglSetSwapRectangleANDROID", (_EGLProc) eglSetSwapRectangleANDROID },
#endif
{ NULL, NULL }
};
@@ -1028,7 +1051,7 @@ eglCreateScreenSurfaceMESA(EGLDisplay dpy, EGLConfig config,
_EGL_CHECK_CONFIG(disp, conf, EGL_NO_SURFACE, drv);
surf = drv->API.CreateScreenSurfaceMESA(drv, disp, conf, attrib_list);
ret = (surf) ? _eglLinkSurface(surf, disp) : EGL_NO_SURFACE;
ret = (surf) ? _eglLinkSurface(surf) : EGL_NO_SURFACE;
RETURN_EGL_EVAL(disp, ret);
}
@@ -1220,7 +1243,7 @@ eglCreatePbufferFromClientBuffer(EGLDisplay dpy, EGLenum buftype,
surf = drv->API.CreatePbufferFromClientBuffer(drv, disp, buftype, buffer,
conf, attrib_list);
ret = (surf) ? _eglLinkSurface(surf, disp) : EGL_NO_SURFACE;
ret = (surf) ? _eglLinkSurface(surf) : EGL_NO_SURFACE;
RETURN_EGL_EVAL(disp, ret);
}
@@ -1276,12 +1299,14 @@ eglCreateImageKHR(EGLDisplay dpy, EGLContext ctx, EGLenum target,
EGLImageKHR ret;
_EGL_CHECK_DISPLAY(disp, EGL_NO_IMAGE_KHR, drv);
if (!disp->Extensions.KHR_image_base)
RETURN_EGL_EVAL(disp, EGL_NO_IMAGE_KHR);
if (!context && ctx != EGL_NO_CONTEXT)
RETURN_EGL_ERROR(disp, EGL_BAD_CONTEXT, EGL_NO_IMAGE_KHR);
img = drv->API.CreateImageKHR(drv,
disp, context, target, buffer, attr_list);
ret = (img) ? _eglLinkImage(img, disp) : EGL_NO_IMAGE_KHR;
ret = (img) ? _eglLinkImage(img) : EGL_NO_IMAGE_KHR;
RETURN_EGL_EVAL(disp, ret);
}
@@ -1296,6 +1321,8 @@ eglDestroyImageKHR(EGLDisplay dpy, EGLImageKHR image)
EGLBoolean ret;
_EGL_CHECK_DISPLAY(disp, EGL_FALSE, drv);
if (!disp->Extensions.KHR_image_base)
RETURN_EGL_EVAL(disp, EGL_FALSE);
if (!img)
RETURN_EGL_ERROR(disp, EGL_BAD_PARAMETER, EGL_FALSE);
@@ -1321,9 +1348,11 @@ eglCreateSyncKHR(EGLDisplay dpy, EGLenum type, const EGLint *attrib_list)
EGLSyncKHR ret;
_EGL_CHECK_DISPLAY(disp, EGL_NO_SYNC_KHR, drv);
if (!disp->Extensions.KHR_reusable_sync)
RETURN_EGL_EVAL(disp, EGL_NO_SYNC_KHR);
sync = drv->API.CreateSyncKHR(drv, disp, type, attrib_list);
ret = (sync) ? _eglLinkSync(sync, disp) : EGL_NO_SYNC_KHR;
ret = (sync) ? _eglLinkSync(sync) : EGL_NO_SYNC_KHR;
RETURN_EGL_EVAL(disp, ret);
}
@@ -1338,6 +1367,8 @@ eglDestroySyncKHR(EGLDisplay dpy, EGLSyncKHR sync)
EGLBoolean ret;
_EGL_CHECK_SYNC(disp, s, EGL_FALSE, drv);
assert(disp->Extensions.KHR_reusable_sync);
_eglUnlinkSync(s);
ret = drv->API.DestroySyncKHR(drv, disp, s);
@@ -1354,6 +1385,7 @@ eglClientWaitSyncKHR(EGLDisplay dpy, EGLSyncKHR sync, EGLint flags, EGLTimeKHR t
EGLint ret;
_EGL_CHECK_SYNC(disp, s, EGL_FALSE, drv);
assert(disp->Extensions.KHR_reusable_sync);
ret = drv->API.ClientWaitSyncKHR(drv, disp, s, flags, timeout);
RETURN_EGL_EVAL(disp, ret);
@@ -1369,6 +1401,7 @@ eglSignalSyncKHR(EGLDisplay dpy, EGLSyncKHR sync, EGLenum mode)
EGLBoolean ret;
_EGL_CHECK_SYNC(disp, s, EGL_FALSE, drv);
assert(disp->Extensions.KHR_reusable_sync);
ret = drv->API.SignalSyncKHR(drv, disp, s, mode);
RETURN_EGL_EVAL(disp, ret);
@@ -1384,6 +1417,7 @@ eglGetSyncAttribKHR(EGLDisplay dpy, EGLSyncKHR sync, EGLint attribute, EGLint *v
EGLBoolean ret;
_EGL_CHECK_SYNC(disp, s, EGL_FALSE, drv);
assert(disp->Extensions.KHR_reusable_sync);
ret = drv->API.GetSyncAttribKHR(drv, disp, s, attribute, value);
RETURN_EGL_EVAL(disp, ret);
@@ -1407,14 +1441,15 @@ eglSwapBuffersRegionNOK(EGLDisplay dpy, EGLSurface surface,
_EGL_CHECK_SURFACE(disp, surf, EGL_FALSE, drv);
if (!disp->Extensions.NOK_swap_region)
RETURN_EGL_EVAL(disp, EGL_FALSE);
/* surface must be bound to current context in EGL 1.4 */
if (!ctx || !_eglIsContextLinked(ctx) || surf != ctx->DrawSurface)
if (_eglGetContextHandle(ctx) == EGL_NO_CONTEXT ||
surf != ctx->DrawSurface)
RETURN_EGL_ERROR(disp, EGL_BAD_SURFACE, EGL_FALSE);
if (drv->API.SwapBuffersRegionNOK)
ret = drv->API.SwapBuffersRegionNOK(drv, disp, surf, numRects, rects);
else
ret = drv->API.SwapBuffers(drv, disp, surf);
ret = drv->API.SwapBuffersRegionNOK(drv, disp, surf, numRects, rects);
RETURN_EGL_EVAL(disp, ret);
}
@@ -1433,9 +1468,11 @@ eglCreateDRMImageMESA(EGLDisplay dpy, const EGLint *attr_list)
EGLImageKHR ret;
_EGL_CHECK_DISPLAY(disp, EGL_NO_IMAGE_KHR, drv);
if (!disp->Extensions.MESA_drm_image)
RETURN_EGL_EVAL(disp, EGL_NO_IMAGE_KHR);
img = drv->API.CreateDRMImageMESA(drv, disp, attr_list);
ret = (img) ? _eglLinkImage(img, disp) : EGL_NO_IMAGE_KHR;
ret = (img) ? _eglLinkImage(img) : EGL_NO_IMAGE_KHR;
RETURN_EGL_EVAL(disp, ret);
}
@@ -1450,6 +1487,8 @@ eglExportDRMImageMESA(EGLDisplay dpy, EGLImageKHR image,
EGLBoolean ret;
_EGL_CHECK_DISPLAY(disp, EGL_FALSE, drv);
assert(disp->Extensions.MESA_drm_image);
if (!img)
RETURN_EGL_ERROR(disp, EGL_BAD_PARAMETER, EGL_FALSE);
@@ -1459,3 +1498,65 @@ eglExportDRMImageMESA(EGLDisplay dpy, EGLImageKHR image,
}
#endif
#ifdef EGL_WL_bind_wayland_display
struct wl_display;
EGLBoolean EGLAPIENTRY
eglBindWaylandDisplayWL(EGLDisplay dpy, struct wl_display *display)
{
_EGLDisplay *disp = _eglLockDisplay(dpy);
_EGLDriver *drv;
EGLBoolean ret;
_EGL_CHECK_DISPLAY(disp, EGL_FALSE, drv);
assert(disp->Extensions.WL_bind_wayland_display);
if (!display)
RETURN_EGL_ERROR(disp, EGL_BAD_PARAMETER, EGL_FALSE);
ret = drv->API.BindWaylandDisplayWL(drv, disp, display);
RETURN_EGL_EVAL(disp, ret);
}
EGLBoolean EGLAPIENTRY
eglUnbindWaylandDisplayWL(EGLDisplay dpy, struct wl_display *display)
{
_EGLDisplay *disp = _eglLockDisplay(dpy);
_EGLDriver *drv;
EGLBoolean ret;
_EGL_CHECK_DISPLAY(disp, EGL_FALSE, drv);
assert(disp->Extensions.WL_bind_wayland_display);
if (!display)
RETURN_EGL_ERROR(disp, EGL_BAD_PARAMETER, EGL_FALSE);
ret = drv->API.UnbindWaylandDisplayWL(drv, disp, display);
RETURN_EGL_EVAL(disp, ret);
}
#endif
#ifdef EGL_ANDROID_swap_rectangle
EGLBoolean EGLAPIENTRY
eglSetSwapRectangleANDROID(EGLDisplay dpy, EGLSurface draw,
EGLint left, EGLint top,
EGLint width, EGLint height)
{
_EGLDisplay *disp = _eglLockDisplay(dpy);
_EGLSurface *surf = _eglLookupSurface(draw, disp);
_EGLDriver *drv;
EGLBoolean ret;
_EGL_CHECK_SURFACE(disp, surf, EGL_FALSE, drv);
if (!disp->Extensions.ANDROID_swap_rectangle)
RETURN_EGL_EVAL(disp, EGL_FALSE);
ret = drv->API.SetSwapRectangleANDROID(drv, disp, surf, left, top, width, height);
RETURN_EGL_EVAL(disp, ret);
}
#endif

View File

@@ -12,7 +12,7 @@ typedef void (*_EGLProc)(void);
*/
/* driver funcs */
typedef EGLBoolean (*Initialize_t)(_EGLDriver *, _EGLDisplay *dpy, EGLint *major, EGLint *minor);
typedef EGLBoolean (*Initialize_t)(_EGLDriver *, _EGLDisplay *dpy);
typedef EGLBoolean (*Terminate_t)(_EGLDriver *, _EGLDisplay *dpy);
/* config funcs */
@@ -95,6 +95,16 @@ typedef _EGLImage *(*CreateDRMImageMESA_t)(_EGLDriver *drv, _EGLDisplay *disp, c
typedef EGLBoolean (*ExportDRMImageMESA_t)(_EGLDriver *drv, _EGLDisplay *disp, _EGLImage *img, EGLint *name, EGLint *handle, EGLint *stride);
#endif
#ifdef EGL_WL_bind_wayland_display
struct wl_display;
typedef EGLBoolean (*BindWaylandDisplayWL_t)(_EGLDriver *drv, _EGLDisplay *disp, struct wl_display *display);
typedef EGLBoolean (*UnbindWaylandDisplayWL_t)(_EGLDriver *drv, _EGLDisplay *disp, struct wl_display *display);
#endif
#ifdef EGL_ANDROID_swap_rectangle
typedef EGLBoolean (*SetSwapRectangleANDROID_t)(_EGLDriver *drv, _EGLDisplay *disp, _EGLSurface *draw, EGLint left, EGLint top, EGLint width, EGLint height);
#endif
/**
* The API dispatcher jumps through these functions
*/
@@ -169,6 +179,15 @@ struct _egl_api
CreateDRMImageMESA_t CreateDRMImageMESA;
ExportDRMImageMESA_t ExportDRMImageMESA;
#endif
#ifdef EGL_WL_bind_wayland_display
BindWaylandDisplayWL_t BindWaylandDisplayWL;
UnbindWaylandDisplayWL_t UnbindWaylandDisplayWL;
#endif
#ifdef EGL_ANDROID_swap_rectangle
SetSwapRectangleANDROID_t SetSwapRectangleANDROID;
#endif
};
#endif /* EGLAPI_INCLUDED */

View File

@@ -118,38 +118,39 @@ _eglFindArray(_EGLArray *array, void *elem)
/**
* Filter an array and return the filtered data. The returned data pointer
* should be freed.
* Filter an array and return the number of filtered elements.
*/
void **
_eglFilterArray(_EGLArray *array, EGLint *size,
EGLint
_eglFilterArray(_EGLArray *array, void **data, EGLint size,
_EGLArrayForEach filter, void *filter_data)
{
void **data;
EGLint count = 0, i;
if (!array) {
*size = 0;
return malloc(0);
}
data = malloc(array->Size * sizeof(array->Elements[0]));
if (!data)
return NULL;
if (!array)
return 0;
if (filter) {
for (i = 0; i < array->Size; i++) {
if (filter(array->Elements[i], filter_data))
data[count++] = array->Elements[i];
if (filter(array->Elements[i], filter_data)) {
if (data && count < size)
data[count] = array->Elements[i];
count++;
}
if (data && count >= size)
break;
}
}
else {
memcpy(data, array->Elements, array->Size * sizeof(array->Elements[0]));
if (data) {
count = (size < array->Size) ? size : array->Size;
memcpy(data, array->Elements, count * sizeof(array->Elements[0]));
}
else {
count = array->Size;
}
}
*size = count;
return data;
return count;
}

View File

@@ -37,8 +37,8 @@ void *
_eglFindArray(_EGLArray *array, void *elem);
void **
_eglFilterArray(_EGLArray *array, EGLint *size,
PUBLIC EGLint
_eglFilterArray(_EGLArray *array, void **data, EGLint size,
_EGLArrayForEach filter, void *filter_data);

View File

@@ -24,34 +24,34 @@
* IDs are from 1 to N respectively.
*/
void
_eglInitConfig(_EGLConfig *config, _EGLDisplay *dpy, EGLint id)
_eglInitConfig(_EGLConfig *conf, _EGLDisplay *dpy, EGLint id)
{
memset(config, 0, sizeof(*config));
memset(conf, 0, sizeof(*conf));
config->Display = dpy;
conf->Display = dpy;
/* some attributes take non-zero default values */
SET_CONFIG_ATTRIB(config, EGL_CONFIG_ID, id);
SET_CONFIG_ATTRIB(config, EGL_CONFIG_CAVEAT, EGL_NONE);
SET_CONFIG_ATTRIB(config, EGL_TRANSPARENT_TYPE, EGL_NONE);
SET_CONFIG_ATTRIB(config, EGL_NATIVE_VISUAL_TYPE, EGL_NONE);
#ifdef EGL_VERSION_1_2
SET_CONFIG_ATTRIB(config, EGL_COLOR_BUFFER_TYPE, EGL_RGB_BUFFER);
#endif /* EGL_VERSION_1_2 */
conf->ConfigID = id;
conf->ConfigCaveat = EGL_NONE;
conf->TransparentType = EGL_NONE;
conf->NativeVisualType = EGL_NONE;
conf->ColorBufferType = EGL_RGB_BUFFER;
}
/**
* Link a config to a display and return the handle of the link.
* Link a config to its display and return the handle of the link.
* The handle can be passed to client directly.
*
* Note that we just save the ptr to the config (we don't copy the config).
*/
EGLConfig
_eglAddConfig(_EGLDisplay *dpy, _EGLConfig *conf)
PUBLIC EGLConfig
_eglLinkConfig(_EGLConfig *conf)
{
_EGLDisplay *dpy = conf->Display;
/* sanity check */
assert(GET_CONFIG_ATTRIB(conf, EGL_CONFIG_ID) > 0);
assert(dpy && conf->ConfigID > 0);
if (!dpy->Configs) {
dpy->Configs = _eglCreateArray("Config", 16);
@@ -59,23 +59,29 @@ _eglAddConfig(_EGLDisplay *dpy, _EGLConfig *conf)
return (EGLConfig) NULL;
}
conf->Display = dpy;
_eglAppendArray(dpy->Configs, (void *) conf);
return (EGLConfig) conf;
}
EGLBoolean
_eglCheckConfigHandle(EGLConfig config, _EGLDisplay *dpy)
/**
* Lookup a handle to find the linked config.
* Return NULL if the handle has no corresponding linked config.
*/
_EGLConfig *
_eglLookupConfig(EGLConfig config, _EGLDisplay *dpy)
{
_EGLConfig *conf;
if (!dpy)
return NULL;
conf = (_EGLConfig *) _eglFindArray(dpy->Configs, (void *) config);
if (conf)
assert(conf->Display == dpy);
return (conf != NULL);
return conf;
}
@@ -104,6 +110,7 @@ static const struct {
EGLint default_value;
} _eglValidationTable[] =
{
/* core */
{ EGL_BUFFER_SIZE, ATTRIB_TYPE_INTEGER,
ATTRIB_CRITERION_ATLEAST,
0 },
@@ -200,22 +207,13 @@ static const struct {
{ EGL_TRANSPARENT_BLUE_VALUE, ATTRIB_TYPE_INTEGER,
ATTRIB_CRITERION_EXACT,
EGL_DONT_CARE },
/* these are not real attributes */
{ EGL_MATCH_NATIVE_PIXMAP, ATTRIB_TYPE_PSEUDO,
ATTRIB_CRITERION_SPECIAL,
EGL_NONE },
/* there is a gap before EGL_SAMPLES */
{ 0x3030, ATTRIB_TYPE_PSEUDO,
ATTRIB_CRITERION_IGNORE,
0 },
{ EGL_NONE, ATTRIB_TYPE_PSEUDO,
ATTRIB_CRITERION_IGNORE,
0 },
/* extensions */
{ EGL_Y_INVERTED_NOK, ATTRIB_TYPE_BOOLEAN,
ATTRIB_CRITERION_EXACT,
EGL_DONT_CARE },
EGL_DONT_CARE }
};
@@ -232,18 +230,13 @@ _eglValidateConfig(const _EGLConfig *conf, EGLBoolean for_matching)
{
EGLint i, attr, val;
EGLBoolean valid = EGL_TRUE;
EGLint red_size = 0, green_size = 0, blue_size = 0, luminance_size = 0;
EGLint alpha_size = 0, buffer_size = 0;
/* all attributes should have been listed */
assert(ARRAY_SIZE(_eglValidationTable) == _EGL_CONFIG_NUM_ATTRIBS);
/* check attributes by their types */
for (i = 0; i < ARRAY_SIZE(_eglValidationTable); i++) {
EGLint mask;
attr = _eglValidationTable[i].attr;
val = GET_CONFIG_ATTRIB(conf, attr);
val = _eglGetConfigKey(conf, attr);
switch (_eglValidationTable[i].type) {
case ATTRIB_TYPE_INTEGER:
@@ -255,30 +248,14 @@ _eglValidateConfig(const _EGLConfig *conf, EGLBoolean for_matching)
break;
case EGL_SAMPLE_BUFFERS:
/* there can be at most 1 sample buffer */
if (val > 1)
if (val > 1 || val < 0)
valid = EGL_FALSE;
break;
case EGL_RED_SIZE:
red_size = val;
break;
case EGL_GREEN_SIZE:
green_size = val;
break;
case EGL_BLUE_SIZE:
blue_size = val;
break;
case EGL_LUMINANCE_SIZE:
luminance_size = val;
break;
case EGL_ALPHA_SIZE:
alpha_size = val;
break;
case EGL_BUFFER_SIZE:
buffer_size = val;
default:
if (val < 0)
valid = EGL_FALSE;
break;
}
if (val < 0)
valid = EGL_FALSE;
break;
case ATTRIB_TYPE_BOOLEAN:
if (val != EGL_TRUE && val != EGL_FALSE)
@@ -366,17 +343,18 @@ _eglValidateConfig(const _EGLConfig *conf, EGLBoolean for_matching)
/* now check for conflicting attribute values */
switch (GET_CONFIG_ATTRIB(conf, EGL_COLOR_BUFFER_TYPE)) {
switch (conf->ColorBufferType) {
case EGL_RGB_BUFFER:
if (luminance_size)
if (conf->LuminanceSize)
valid = EGL_FALSE;
if (red_size + green_size + blue_size + alpha_size != buffer_size)
if (conf->RedSize + conf->GreenSize +
conf->BlueSize + conf->AlphaSize != conf->BufferSize)
valid = EGL_FALSE;
break;
case EGL_LUMINANCE_BUFFER:
if (red_size || green_size || blue_size)
if (conf->RedSize || conf->GreenSize || conf->BlueSize)
valid = EGL_FALSE;
if (luminance_size + alpha_size != buffer_size)
if (conf->LuminanceSize + conf->AlphaSize != conf->BufferSize)
valid = EGL_FALSE;
break;
}
@@ -385,23 +363,19 @@ _eglValidateConfig(const _EGLConfig *conf, EGLBoolean for_matching)
return EGL_FALSE;
}
val = GET_CONFIG_ATTRIB(conf, EGL_SAMPLE_BUFFERS);
if (!val && GET_CONFIG_ATTRIB(conf, EGL_SAMPLES))
if (!conf->SampleBuffers && conf->Samples)
valid = EGL_FALSE;
if (!valid) {
_eglLog(_EGL_DEBUG, "conflicting samples and sample buffers");
return EGL_FALSE;
}
val = GET_CONFIG_ATTRIB(conf, EGL_SURFACE_TYPE);
if (!(val & EGL_WINDOW_BIT)) {
if (GET_CONFIG_ATTRIB(conf, EGL_NATIVE_VISUAL_ID) != 0 ||
GET_CONFIG_ATTRIB(conf, EGL_NATIVE_VISUAL_TYPE) != EGL_NONE)
if (!(conf->SurfaceType & EGL_WINDOW_BIT)) {
if (conf->NativeVisualID != 0 || conf->NativeVisualType != EGL_NONE)
valid = EGL_FALSE;
}
if (!(val & EGL_PBUFFER_BIT)) {
if (GET_CONFIG_ATTRIB(conf, EGL_BIND_TO_TEXTURE_RGB) ||
GET_CONFIG_ATTRIB(conf, EGL_BIND_TO_TEXTURE_RGBA))
if (!(conf->SurfaceType & EGL_PBUFFER_BIT)) {
if (conf->BindToTextureRGB || conf->BindToTextureRGBA)
valid = EGL_FALSE;
}
if (!valid) {
@@ -433,11 +407,11 @@ _eglMatchConfig(const _EGLConfig *conf, const _EGLConfig *criteria)
continue;
attr = _eglValidationTable[i].attr;
cmp = GET_CONFIG_ATTRIB(criteria, attr);
cmp = _eglGetConfigKey(criteria, attr);
if (cmp == EGL_DONT_CARE)
continue;
val = GET_CONFIG_ATTRIB(conf, attr);
val = _eglGetConfigKey(conf, attr);
switch (_eglValidationTable[i].criterion) {
case ATTRIB_CRITERION_EXACT:
if (val != cmp)
@@ -478,16 +452,11 @@ _eglMatchConfig(const _EGLConfig *conf, const _EGLConfig *criteria)
static INLINE EGLBoolean
_eglIsConfigAttribValid(_EGLConfig *conf, EGLint attr)
{
if (_eglIndexConfig(conf, attr) < 0)
if (_eglOffsetOfConfig(attr) < 0)
return EGL_FALSE;
/* there are some holes in the range */
switch (attr) {
case 0x3030 /* a gap before EGL_SAMPLES */:
case EGL_NONE:
#ifdef EGL_VERSION_1_4
case EGL_MATCH_NATIVE_PIXMAP:
#endif
return EGL_FALSE;
case EGL_Y_INVERTED_NOK:
return conf->Display->Extensions.NOK_texture_from_pixmap;
@@ -503,18 +472,18 @@ _eglIsConfigAttribValid(_EGLConfig *conf, EGLint attr)
* Return EGL_FALSE if any of the attribute is invalid.
*/
EGLBoolean
_eglParseConfigAttribList(_EGLConfig *conf, const EGLint *attrib_list)
_eglParseConfigAttribList(_EGLConfig *conf, _EGLDisplay *dpy,
const EGLint *attrib_list)
{
EGLint attr, val, i;
EGLint config_id = 0, level = 0;
EGLBoolean has_native_visual_type = EGL_FALSE;
EGLBoolean has_transparent_color = EGL_FALSE;
_eglInitConfig(conf, dpy, EGL_DONT_CARE);
/* reset to default values */
for (i = 0; i < ARRAY_SIZE(_eglValidationTable); i++) {
attr = _eglValidationTable[i].attr;
val = _eglValidationTable[i].default_value;
SET_CONFIG_ATTRIB(conf, attr, val);
_eglSetConfigKey(conf, attr, val);
}
/* parse the list */
@@ -524,59 +493,33 @@ _eglParseConfigAttribList(_EGLConfig *conf, const EGLint *attrib_list)
if (!_eglIsConfigAttribValid(conf, attr))
return EGL_FALSE;
SET_CONFIG_ATTRIB(conf, attr, val);
/* rememeber some attributes for post-processing */
switch (attr) {
case EGL_CONFIG_ID:
config_id = val;
break;
case EGL_LEVEL:
level = val;
break;
case EGL_NATIVE_VISUAL_TYPE:
has_native_visual_type = EGL_TRUE;
break;
case EGL_TRANSPARENT_RED_VALUE:
case EGL_TRANSPARENT_GREEN_VALUE:
case EGL_TRANSPARENT_BLUE_VALUE:
has_transparent_color = EGL_TRUE;
break;
default:
break;
}
_eglSetConfigKey(conf, attr, val);
}
if (!_eglValidateConfig(conf, EGL_TRUE))
return EGL_FALSE;
/* the spec says that EGL_LEVEL cannot be EGL_DONT_CARE */
if (level == EGL_DONT_CARE)
if (conf->Level == EGL_DONT_CARE)
return EGL_FALSE;
/* ignore other attributes when EGL_CONFIG_ID is given */
if (config_id > 0) {
_eglResetConfigKeys(conf, EGL_DONT_CARE);
SET_CONFIG_ATTRIB(conf, EGL_CONFIG_ID, config_id);
if (conf->ConfigID != EGL_DONT_CARE) {
for (i = 0; i < ARRAY_SIZE(_eglValidationTable); i++) {
attr = _eglValidationTable[i].attr;
if (attr != EGL_CONFIG_ID)
_eglSetConfigKey(conf, attr, EGL_DONT_CARE);
}
}
else {
if (has_native_visual_type) {
val = GET_CONFIG_ATTRIB(conf, EGL_SURFACE_TYPE);
if (!(val & EGL_WINDOW_BIT))
SET_CONFIG_ATTRIB(conf, EGL_NATIVE_VISUAL_TYPE, EGL_DONT_CARE);
}
if (!(conf->SurfaceType & EGL_WINDOW_BIT))
conf->NativeVisualType = EGL_DONT_CARE;
if (has_transparent_color) {
val = GET_CONFIG_ATTRIB(conf, EGL_TRANSPARENT_TYPE);
if (val == EGL_NONE) {
SET_CONFIG_ATTRIB(conf, EGL_TRANSPARENT_RED_VALUE,
EGL_DONT_CARE);
SET_CONFIG_ATTRIB(conf, EGL_TRANSPARENT_GREEN_VALUE,
EGL_DONT_CARE);
SET_CONFIG_ATTRIB(conf, EGL_TRANSPARENT_BLUE_VALUE,
EGL_DONT_CARE);
}
if (conf->TransparentType == EGL_NONE) {
conf->TransparentRedValue = EGL_DONT_CARE;
conf->TransparentGreenValue = EGL_DONT_CARE;
conf->TransparentBlueValue = EGL_DONT_CARE;
}
}
@@ -610,7 +553,6 @@ _eglCompareConfigs(const _EGLConfig *conf1, const _EGLConfig *conf2,
EGL_ALPHA_MASK_SIZE,
};
EGLint val1, val2;
EGLBoolean rgb_buffer;
EGLint i;
if (conf1 == conf2)
@@ -619,44 +561,41 @@ _eglCompareConfigs(const _EGLConfig *conf1, const _EGLConfig *conf2,
/* the enum values have the desired ordering */
assert(EGL_NONE < EGL_SLOW_CONFIG);
assert(EGL_SLOW_CONFIG < EGL_NON_CONFORMANT_CONFIG);
val1 = GET_CONFIG_ATTRIB(conf1, EGL_CONFIG_CAVEAT);
val2 = GET_CONFIG_ATTRIB(conf2, EGL_CONFIG_CAVEAT);
if (val1 != val2)
return (val1 - val2);
val1 = conf1->ConfigCaveat - conf2->ConfigCaveat;
if (val1)
return val1;
/* the enum values have the desired ordering */
assert(EGL_RGB_BUFFER < EGL_LUMINANCE_BUFFER);
val1 = GET_CONFIG_ATTRIB(conf1, EGL_COLOR_BUFFER_TYPE);
val2 = GET_CONFIG_ATTRIB(conf2, EGL_COLOR_BUFFER_TYPE);
if (val1 != val2)
return (val1 - val2);
rgb_buffer = (val1 == EGL_RGB_BUFFER);
val1 = conf1->ColorBufferType - conf2->ColorBufferType;
if (val1)
return val1;
if (criteria) {
val1 = val2 = 0;
if (rgb_buffer) {
if (GET_CONFIG_ATTRIB(criteria, EGL_RED_SIZE) > 0) {
val1 += GET_CONFIG_ATTRIB(conf1, EGL_RED_SIZE);
val2 += GET_CONFIG_ATTRIB(conf2, EGL_RED_SIZE);
if (conf1->ColorBufferType == EGL_RGB_BUFFER) {
if (criteria->RedSize > 0) {
val1 += conf1->RedSize;
val2 += conf2->RedSize;
}
if (GET_CONFIG_ATTRIB(criteria, EGL_GREEN_SIZE) > 0) {
val1 += GET_CONFIG_ATTRIB(conf1, EGL_GREEN_SIZE);
val2 += GET_CONFIG_ATTRIB(conf2, EGL_GREEN_SIZE);
if (criteria->GreenSize > 0) {
val1 += conf1->GreenSize;
val2 += conf2->GreenSize;
}
if (GET_CONFIG_ATTRIB(criteria, EGL_BLUE_SIZE) > 0) {
val1 += GET_CONFIG_ATTRIB(conf1, EGL_BLUE_SIZE);
val2 += GET_CONFIG_ATTRIB(conf2, EGL_BLUE_SIZE);
if (criteria->BlueSize > 0) {
val1 += conf1->BlueSize;
val2 += conf2->BlueSize;
}
}
else {
if (GET_CONFIG_ATTRIB(criteria, EGL_LUMINANCE_SIZE) > 0) {
val1 += GET_CONFIG_ATTRIB(conf1, EGL_LUMINANCE_SIZE);
val2 += GET_CONFIG_ATTRIB(conf2, EGL_LUMINANCE_SIZE);
if (criteria->LuminanceSize > 0) {
val1 += conf1->LuminanceSize;
val2 += conf2->LuminanceSize;
}
}
if (GET_CONFIG_ATTRIB(criteria, EGL_ALPHA_SIZE) > 0) {
val1 += GET_CONFIG_ATTRIB(conf1, EGL_ALPHA_SIZE);
val2 += GET_CONFIG_ATTRIB(conf2, EGL_ALPHA_SIZE);
if (criteria->AlphaSize > 0) {
val1 += conf1->AlphaSize;
val2 += conf2->AlphaSize;
}
}
else {
@@ -669,24 +608,15 @@ _eglCompareConfigs(const _EGLConfig *conf1, const _EGLConfig *conf2,
return (val2 - val1);
for (i = 0; i < ARRAY_SIZE(compare_attribs); i++) {
val1 = GET_CONFIG_ATTRIB(conf1, compare_attribs[i]);
val2 = GET_CONFIG_ATTRIB(conf2, compare_attribs[i]);
val1 = _eglGetConfigKey(conf1, compare_attribs[i]);
val2 = _eglGetConfigKey(conf2, compare_attribs[i]);
if (val1 != val2)
return (val1 - val2);
}
/* EGL_NATIVE_VISUAL_TYPE cannot be compared here */
if (compare_id) {
val1 = GET_CONFIG_ATTRIB(conf1, EGL_CONFIG_ID);
val2 = GET_CONFIG_ATTRIB(conf2, EGL_CONFIG_ID);
assert(val1 != val2);
}
else {
val1 = val2 = 0;
}
return (val1 - val2);
return (compare_id) ? (conf1->ConfigID - conf2->ConfigID) : 0;
}
@@ -764,15 +694,25 @@ _eglChooseConfig(_EGLDriver *drv, _EGLDisplay *disp, const EGLint *attrib_list,
if (!num_configs)
return _eglError(EGL_BAD_PARAMETER, "eglChooseConfigs");
_eglInitConfig(&criteria, disp, 0);
if (!_eglParseConfigAttribList(&criteria, attrib_list))
if (!_eglParseConfigAttribList(&criteria, disp, attrib_list))
return _eglError(EGL_BAD_ATTRIBUTE, "eglChooseConfig");
configList = (_EGLConfig **) _eglFilterArray(disp->Configs, &count,
/* get the number of matched configs */
count = _eglFilterArray(disp->Configs, NULL, 0,
(_EGLArrayForEach) _eglMatchConfig, (void *) &criteria);
if (!count) {
*num_configs = count;
return EGL_TRUE;
}
configList = malloc(sizeof(*configList) * count);
if (!configList)
return _eglError(EGL_BAD_ALLOC, "eglChooseConfig(out of memory)");
/* get the matched configs */
_eglFilterArray(disp->Configs, (void **) configList, count,
(_EGLArrayForEach) _eglMatchConfig, (void *) &criteria);
/* perform sorting of configs */
if (configs && count) {
_eglSortConfigs((const _EGLConfig **) configList, count,
@@ -802,7 +742,7 @@ _eglGetConfigAttrib(_EGLDriver *drv, _EGLDisplay *dpy, _EGLConfig *conf,
if (!value)
return _eglError(EGL_BAD_PARAMETER, "eglGetConfigAttrib");
*value = GET_CONFIG_ATTRIB(conf, attribute);
*value = _eglGetConfigKey(conf, attribute);
return EGL_TRUE;
}

View File

@@ -3,72 +3,107 @@
#include <assert.h>
#include <stddef.h>
#include "egltypedefs.h"
#define _EGL_CONFIG_FIRST_ATTRIB EGL_BUFFER_SIZE
#define _EGL_CONFIG_LAST_ATTRIB EGL_CONFORMANT
#define _EGL_CONFIG_NUM_CONTIGUOUS_ATTRIBS \
(_EGL_CONFIG_LAST_ATTRIB - _EGL_CONFIG_FIRST_ATTRIB + 1)
/* Attributes outside the contiguous block:
*
* EGL_Y_INVERTED_NOK
*/
#define _EGL_CONFIG_FIRST_EXTRA_ATTRIB _EGL_CONFIG_NUM_CONTIGUOUS_ATTRIBS
#define _EGL_CONFIG_NUM_EXTRA_ATTRIBS 1
#define _EGL_CONFIG_NUM_ATTRIBS \
_EGL_CONFIG_NUM_CONTIGUOUS_ATTRIBS + _EGL_CONFIG_NUM_EXTRA_ATTRIBS
/* update _eglValidationTable and _eglOffsetOfConfig before updating this
* struct */
struct _egl_config
{
_EGLDisplay *Display;
EGLint Storage[_EGL_CONFIG_NUM_ATTRIBS];
/* core */
EGLint BufferSize;
EGLint AlphaSize;
EGLint BlueSize;
EGLint GreenSize;
EGLint RedSize;
EGLint DepthSize;
EGLint StencilSize;
EGLint ConfigCaveat;
EGLint ConfigID;
EGLint Level;
EGLint MaxPbufferHeight;
EGLint MaxPbufferPixels;
EGLint MaxPbufferWidth;
EGLint NativeRenderable;
EGLint NativeVisualID;
EGLint NativeVisualType;
EGLint Samples;
EGLint SampleBuffers;
EGLint SurfaceType;
EGLint TransparentType;
EGLint TransparentBlueValue;
EGLint TransparentGreenValue;
EGLint TransparentRedValue;
EGLint BindToTextureRGB;
EGLint BindToTextureRGBA;
EGLint MinSwapInterval;
EGLint MaxSwapInterval;
EGLint LuminanceSize;
EGLint AlphaMaskSize;
EGLint ColorBufferType;
EGLint RenderableType;
EGLint MatchNativePixmap;
EGLint Conformant;
/* extensions */
EGLint YInvertedNOK;
};
/**
* Macros for source level compatibility.
*/
#define SET_CONFIG_ATTRIB(CONF, ATTR, VAL) _eglSetConfigKey(CONF, ATTR, VAL)
#define GET_CONFIG_ATTRIB(CONF, ATTR) _eglGetConfigKey(CONF, ATTR)
/**
* Given a key, return an index into the storage of the config.
* Return -1 if the key is invalid.
* Map an EGL attribute enum to the offset of the member in _EGLConfig.
*/
static INLINE EGLint
_eglIndexConfig(const _EGLConfig *conf, EGLint key)
_eglOffsetOfConfig(EGLint attr)
{
(void) conf;
if (key >= _EGL_CONFIG_FIRST_ATTRIB &&
key < _EGL_CONFIG_FIRST_ATTRIB + _EGL_CONFIG_NUM_CONTIGUOUS_ATTRIBS)
return key - _EGL_CONFIG_FIRST_ATTRIB;
switch (key) {
case EGL_Y_INVERTED_NOK:
return _EGL_CONFIG_FIRST_EXTRA_ATTRIB;
switch (attr) {
#define ATTRIB_MAP(attr, memb) case attr: return offsetof(_EGLConfig, memb)
/* core */
ATTRIB_MAP(EGL_BUFFER_SIZE, BufferSize);
ATTRIB_MAP(EGL_ALPHA_SIZE, AlphaSize);
ATTRIB_MAP(EGL_BLUE_SIZE, BlueSize);
ATTRIB_MAP(EGL_GREEN_SIZE, GreenSize);
ATTRIB_MAP(EGL_RED_SIZE, RedSize);
ATTRIB_MAP(EGL_DEPTH_SIZE, DepthSize);
ATTRIB_MAP(EGL_STENCIL_SIZE, StencilSize);
ATTRIB_MAP(EGL_CONFIG_CAVEAT, ConfigCaveat);
ATTRIB_MAP(EGL_CONFIG_ID, ConfigID);
ATTRIB_MAP(EGL_LEVEL, Level);
ATTRIB_MAP(EGL_MAX_PBUFFER_HEIGHT, MaxPbufferHeight);
ATTRIB_MAP(EGL_MAX_PBUFFER_PIXELS, MaxPbufferPixels);
ATTRIB_MAP(EGL_MAX_PBUFFER_WIDTH, MaxPbufferWidth);
ATTRIB_MAP(EGL_NATIVE_RENDERABLE, NativeRenderable);
ATTRIB_MAP(EGL_NATIVE_VISUAL_ID, NativeVisualID);
ATTRIB_MAP(EGL_NATIVE_VISUAL_TYPE, NativeVisualType);
ATTRIB_MAP(EGL_SAMPLES, Samples);
ATTRIB_MAP(EGL_SAMPLE_BUFFERS, SampleBuffers);
ATTRIB_MAP(EGL_SURFACE_TYPE, SurfaceType);
ATTRIB_MAP(EGL_TRANSPARENT_TYPE, TransparentType);
ATTRIB_MAP(EGL_TRANSPARENT_BLUE_VALUE, TransparentBlueValue);
ATTRIB_MAP(EGL_TRANSPARENT_GREEN_VALUE, TransparentGreenValue);
ATTRIB_MAP(EGL_TRANSPARENT_RED_VALUE, TransparentRedValue);
ATTRIB_MAP(EGL_BIND_TO_TEXTURE_RGB, BindToTextureRGB);
ATTRIB_MAP(EGL_BIND_TO_TEXTURE_RGBA, BindToTextureRGBA);
ATTRIB_MAP(EGL_MIN_SWAP_INTERVAL, MinSwapInterval);
ATTRIB_MAP(EGL_MAX_SWAP_INTERVAL, MaxSwapInterval);
ATTRIB_MAP(EGL_LUMINANCE_SIZE, LuminanceSize);
ATTRIB_MAP(EGL_ALPHA_MASK_SIZE, AlphaMaskSize);
ATTRIB_MAP(EGL_COLOR_BUFFER_TYPE, ColorBufferType);
ATTRIB_MAP(EGL_RENDERABLE_TYPE, RenderableType);
ATTRIB_MAP(EGL_MATCH_NATIVE_PIXMAP, MatchNativePixmap);
ATTRIB_MAP(EGL_CONFORMANT, Conformant);
/* extensions */
ATTRIB_MAP(EGL_Y_INVERTED_NOK, YInvertedNOK);
#undef ATTRIB_MAP
default:
return -1;
}
}
/**
* Reset all keys in the config to a given value.
*/
static INLINE void
_eglResetConfigKeys(_EGLConfig *conf, EGLint val)
{
EGLint i;
for (i = 0; i < _EGL_CONFIG_NUM_ATTRIBS; i++)
conf->Storage[i] = val;
}
/**
* Update a config for a given key.
*
@@ -79,9 +114,9 @@ _eglResetConfigKeys(_EGLConfig *conf, EGLint val)
static INLINE void
_eglSetConfigKey(_EGLConfig *conf, EGLint key, EGLint val)
{
EGLint idx = _eglIndexConfig(conf, key);
assert(idx >= 0);
conf->Storage[idx] = val;
EGLint offset = _eglOffsetOfConfig(key);
assert(offset >= 0);
*((EGLint *) ((char *) conf + offset)) = val;
}
@@ -91,9 +126,9 @@ _eglSetConfigKey(_EGLConfig *conf, EGLint key, EGLint val)
static INLINE EGLint
_eglGetConfigKey(const _EGLConfig *conf, EGLint key)
{
EGLint idx = _eglIndexConfig(conf, key);
assert(idx >= 0);
return conf->Storage[idx];
EGLint offset = _eglOffsetOfConfig(key);
assert(offset >= 0);
return *((EGLint *) ((char *) conf + offset));
}
@@ -102,34 +137,20 @@ _eglInitConfig(_EGLConfig *config, _EGLDisplay *dpy, EGLint id);
PUBLIC EGLConfig
_eglAddConfig(_EGLDisplay *dpy, _EGLConfig *conf);
_eglLinkConfig(_EGLConfig *conf);
extern EGLBoolean
_eglCheckConfigHandle(EGLConfig config, _EGLDisplay *dpy);
extern _EGLConfig *
_eglLookupConfig(EGLConfig config, _EGLDisplay *dpy);
/**
* Lookup a handle to find the linked config.
* Return NULL if the handle has no corresponding linked config.
*/
static INLINE _EGLConfig *
_eglLookupConfig(EGLConfig config, _EGLDisplay *dpy)
{
_EGLConfig *conf = (_EGLConfig *) config;
if (!dpy || !_eglCheckConfigHandle(config, dpy))
conf = NULL;
return conf;
}
/**
* Return the handle of a linked config, or NULL.
* Return the handle of a linked config.
*/
static INLINE EGLConfig
_eglGetConfigHandle(_EGLConfig *conf)
{
return (EGLConfig) ((conf && conf->Display) ? conf : NULL);
return (EGLConfig) conf;
}
@@ -142,7 +163,8 @@ _eglMatchConfig(const _EGLConfig *conf, const _EGLConfig *criteria);
PUBLIC EGLBoolean
_eglParseConfigAttribList(_EGLConfig *conf, const EGLint *attrib_list);
_eglParseConfigAttribList(_EGLConfig *conf, _EGLDisplay *dpy,
const EGLint *attrib_list);
PUBLIC EGLint

View File

@@ -103,8 +103,7 @@ _eglInitContext(_EGLContext *ctx, _EGLDisplay *dpy, _EGLConfig *conf,
return EGL_FALSE;
}
memset(ctx, 0, sizeof(_EGLContext));
ctx->Resource.Display = dpy;
_eglInitResource(&ctx->Resource, sizeof(*ctx), dpy);
ctx->ClientAPI = api;
ctx->Config = conf;
ctx->WindowRenderBuffer = EGL_NONE;
@@ -113,13 +112,12 @@ _eglInitContext(_EGLContext *ctx, _EGLDisplay *dpy, _EGLConfig *conf,
err = _eglParseContextAttribList(ctx, attrib_list);
if (err == EGL_SUCCESS && ctx->Config) {
EGLint renderable_type, api_bit;
EGLint api_bit;
renderable_type = GET_CONFIG_ATTRIB(ctx->Config, EGL_RENDERABLE_TYPE);
api_bit = _eglGetContextAPIBit(ctx);
if (!(renderable_type & api_bit)) {
if (!(ctx->Config->RenderableType & api_bit)) {
_eglLog(_EGL_DEBUG, "context api is 0x%x while config supports 0x%x",
api_bit, renderable_type);
api_bit, ctx->Config->RenderableType);
err = EGL_BAD_CONFIG;
}
}
@@ -130,29 +128,6 @@ _eglInitContext(_EGLContext *ctx, _EGLDisplay *dpy, _EGLConfig *conf,
}
/**
* Just a placeholder/demo function. Real driver will never use this!
*/
_EGLContext *
_eglCreateContext(_EGLDriver *drv, _EGLDisplay *dpy, _EGLConfig *conf,
_EGLContext *share_list, const EGLint *attrib_list)
{
return NULL;
}
/**
* Default fallback routine - drivers should usually override this.
*/
EGLBoolean
_eglDestroyContext(_EGLDriver *drv, _EGLDisplay *dpy, _EGLContext *ctx)
{
if (!_eglIsContextBound(ctx))
free(ctx);
return EGL_TRUE;
}
#ifdef EGL_VERSION_1_2
static EGLint
_eglQueryContextRenderBuffer(_EGLContext *ctx)
@@ -183,7 +158,9 @@ _eglQueryContext(_EGLDriver *drv, _EGLDisplay *dpy, _EGLContext *c,
switch (attribute) {
case EGL_CONFIG_ID:
*value = GET_CONFIG_ATTRIB(c->Config, EGL_CONFIG_ID);
if (!c->Config)
return _eglError(EGL_BAD_ATTRIBUTE, "eglQueryContext");
*value = c->Config->ConfigID;
break;
case EGL_CONTEXT_CLIENT_VERSION:
*value = c->ClientVersion;
@@ -272,10 +249,6 @@ _eglCheckMakeCurrent(_EGLContext *ctx, _EGLSurface *draw, _EGLSurface *read)
if (!surfaceless && (draw == NULL || read == NULL))
return _eglError(EGL_BAD_MATCH, "eglMakeCurrent");
/* context stealing from another thread is not allowed */
if (ctx->Binding && ctx->Binding != t)
return _eglError(EGL_BAD_ACCESS, "eglMakeCurrent");
/*
* The spec says
*
@@ -283,16 +256,23 @@ _eglCheckMakeCurrent(_EGLContext *ctx, _EGLSurface *draw, _EGLSurface *read)
* bound to contexts in another thread, an EGL_BAD_ACCESS error is
* generated."
*
* But it also says
* and
*
* "at most one context may be bound to a particular surface at a given
* time"
*
* The latter is more restrictive so we can check only the latter case.
*/
if ((draw && draw->CurrentContext && draw->CurrentContext != ctx) ||
(read && read->CurrentContext && read->CurrentContext != ctx))
if (ctx->Binding && ctx->Binding != t)
return _eglError(EGL_BAD_ACCESS, "eglMakeCurrent");
if (draw && draw->CurrentContext && draw->CurrentContext != ctx) {
if (draw->CurrentContext->Binding != t ||
draw->CurrentContext->ClientAPI != ctx->ClientAPI)
return _eglError(EGL_BAD_ACCESS, "eglMakeCurrent");
}
if (read && read->CurrentContext && read->CurrentContext != ctx) {
if (read->CurrentContext->Binding != t ||
read->CurrentContext->ClientAPI != ctx->ClientAPI)
return _eglError(EGL_BAD_ACCESS, "eglMakeCurrent");
}
/* simply require the configs to be equal */
if ((draw && draw->Config != ctx->Config) ||
@@ -323,79 +303,65 @@ _eglCheckMakeCurrent(_EGLContext *ctx, _EGLSurface *draw, _EGLSurface *read)
/**
* Bind the context to the current thread and given surfaces. Return the
* "orphaned" context and surfaces. Each argument is both input and output.
* previous bound context and surfaces. The caller should unreference the
* returned context and surfaces.
*
* Making a second call with the resources returned by the first call
* unsurprisingly undoes the first call, except for the resouce reference
* counts.
*/
EGLBoolean
_eglBindContext(_EGLContext **ctx, _EGLSurface **draw, _EGLSurface **read)
_eglBindContext(_EGLContext *ctx, _EGLSurface *draw, _EGLSurface *read,
_EGLContext **old_ctx,
_EGLSurface **old_draw, _EGLSurface **old_read)
{
_EGLThreadInfo *t = _eglGetCurrentThread();
_EGLContext *newCtx = *ctx, *oldCtx;
_EGLSurface *newDraw = *draw, *newRead = *read;
_EGLContext *prev_ctx;
_EGLSurface *prev_draw, *prev_read;
if (!_eglCheckMakeCurrent(newCtx, newDraw, newRead))
if (!_eglCheckMakeCurrent(ctx, draw, read))
return EGL_FALSE;
/* increment refcounts before binding */
_eglGetContext(ctx);
_eglGetSurface(draw);
_eglGetSurface(read);
/* bind the new context */
oldCtx = _eglBindContextToThread(newCtx, t);
prev_ctx = _eglBindContextToThread(ctx, t);
/* break old bindings */
if (oldCtx) {
*ctx = oldCtx;
*draw = oldCtx->DrawSurface;
*read = oldCtx->ReadSurface;
/* break previous bindings */
if (prev_ctx) {
prev_draw = prev_ctx->DrawSurface;
prev_read = prev_ctx->ReadSurface;
if (*draw)
(*draw)->CurrentContext = NULL;
if (*read)
(*read)->CurrentContext = NULL;
if (prev_draw)
prev_draw->CurrentContext = NULL;
if (prev_read)
prev_read->CurrentContext = NULL;
oldCtx->DrawSurface = NULL;
oldCtx->ReadSurface = NULL;
prev_ctx->DrawSurface = NULL;
prev_ctx->ReadSurface = NULL;
}
else {
prev_draw = prev_read = NULL;
}
/* establish new bindings */
if (newCtx) {
if (newDraw)
newDraw->CurrentContext = newCtx;
if (newRead)
newRead->CurrentContext = newCtx;
if (ctx) {
if (draw)
draw->CurrentContext = ctx;
if (read)
read->CurrentContext = ctx;
newCtx->DrawSurface = newDraw;
newCtx->ReadSurface = newRead;
ctx->DrawSurface = draw;
ctx->ReadSurface = read;
}
/* an old context or surface is not orphaned if it is still bound */
if (*ctx == newCtx)
*ctx = NULL;
if (*draw == newDraw || *draw == newRead)
*draw = NULL;
if (*read == newDraw || *read == newRead)
*read = NULL;
assert(old_ctx && old_draw && old_read);
*old_ctx = prev_ctx;
*old_draw = prev_draw;
*old_read = prev_read;
return EGL_TRUE;
}
/**
* Just a placeholder/demo function. Drivers should override this.
*/
EGLBoolean
_eglMakeCurrent(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *draw,
_EGLSurface *read, _EGLContext *ctx)
{
return EGL_FALSE;
}
/**
* This is defined by the EGL_MESA_copy_context extension.
*/
EGLBoolean
_eglCopyContextMESA(_EGLDriver *drv, EGLDisplay dpy, EGLContext source,
EGLContext dest, EGLint mask)
{
/* This function will always have to be overridden/implemented in the
* device driver. If the driver is based on Mesa, use _mesa_copy_context().
*/
return EGL_FALSE;
}

View File

@@ -34,51 +34,46 @@ _eglInitContext(_EGLContext *ctx, _EGLDisplay *dpy,
_EGLConfig *config, const EGLint *attrib_list);
extern _EGLContext *
_eglCreateContext(_EGLDriver *drv, _EGLDisplay *dpy, _EGLConfig *conf, _EGLContext *share_list, const EGLint *attrib_list);
extern EGLBoolean
_eglDestroyContext(_EGLDriver *drv, _EGLDisplay *dpy, _EGLContext *ctx);
extern EGLBoolean
_eglQueryContext(_EGLDriver *drv, _EGLDisplay *dpy, _EGLContext *ctx, EGLint attribute, EGLint *value);
PUBLIC EGLBoolean
_eglBindContext(_EGLContext **ctx, _EGLSurface **draw, _EGLSurface **read);
extern EGLBoolean
_eglMakeCurrent(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *draw, _EGLSurface *read, _EGLContext *ctx);
extern EGLBoolean
_eglCopyContextMESA(_EGLDriver *drv, EGLDisplay dpy, EGLContext source, EGLContext dest, EGLint mask);
_eglBindContext(_EGLContext *ctx, _EGLSurface *draw, _EGLSurface *read,
_EGLContext **old_ctx,
_EGLSurface **old_draw, _EGLSurface **old_read);
/**
* Return true if the context is bound to a thread.
*
* The binding is considered a reference to the context. Drivers should not
* destroy a context when it is bound.
* Increment reference count for the context.
*/
static INLINE EGLBoolean
_eglIsContextBound(_EGLContext *ctx)
static INLINE _EGLContext *
_eglGetContext(_EGLContext *ctx)
{
return (ctx->Binding != NULL);
if (ctx)
_eglGetResource(&ctx->Resource);
return ctx;
}
/**
* Link a context to a display and return the handle of the link.
* Decrement reference count for the context.
*/
static INLINE EGLBoolean
_eglPutContext(_EGLContext *ctx)
{
return (ctx) ? _eglPutResource(&ctx->Resource) : EGL_FALSE;
}
/**
* Link a context to its display and return the handle of the link.
* The handle can be passed to client directly.
*/
static INLINE EGLContext
_eglLinkContext(_EGLContext *ctx, _EGLDisplay *dpy)
_eglLinkContext(_EGLContext *ctx)
{
_eglLinkResource(&ctx->Resource, _EGL_RESOURCE_CONTEXT, dpy);
_eglLinkResource(&ctx->Resource, _EGL_RESOURCE_CONTEXT);
return (EGLContext) ctx;
}
@@ -120,18 +115,4 @@ _eglGetContextHandle(_EGLContext *ctx)
}
/**
* Return true if the context is linked to a display.
*
* The link is considered a reference to the context (the display is owning the
* context). Drivers should not destroy a context when it is linked.
*/
static INLINE EGLBoolean
_eglIsContextLinked(_EGLContext *ctx)
{
_EGLResource *res = (_EGLResource *) ctx;
return (res && _eglIsResourceLinked(res));
}
#endif /* EGLCONTEXT_INCLUDED */

View File

@@ -14,33 +14,7 @@
static _EGLThreadInfo dummy_thread = _EGL_THREAD_INFO_INITIALIZER;
#ifdef GLX_USE_TLS
static __thread const _EGLThreadInfo *_egl_TSD
__attribute__ ((tls_model("initial-exec")));
static INLINE void _eglSetTSD(const _EGLThreadInfo *t)
{
_egl_TSD = t;
}
static INLINE _EGLThreadInfo *_eglGetTSD(void)
{
return (_EGLThreadInfo *) _egl_TSD;
}
static INLINE void _eglFiniTSD(void)
{
}
static INLINE EGLBoolean _eglInitTSD(void (*dtor)(_EGLThreadInfo *))
{
/* TODO destroy TSD */
(void) dtor;
(void) _eglFiniTSD;
return EGL_TRUE;
}
#elif PTHREADS
#if PTHREADS
#include <pthread.h>
static _EGL_DECLARE_MUTEX(_egl_TSDMutex);
@@ -48,14 +22,26 @@ static EGLBoolean _egl_TSDInitialized;
static pthread_key_t _egl_TSD;
static void (*_egl_FreeTSD)(_EGLThreadInfo *);
#ifdef GLX_USE_TLS
static __thread const _EGLThreadInfo *_egl_TLS
__attribute__ ((tls_model("initial-exec")));
#endif
static INLINE void _eglSetTSD(const _EGLThreadInfo *t)
{
pthread_setspecific(_egl_TSD, (const void *) t);
#ifdef GLX_USE_TLS
_egl_TLS = t;
#endif
}
static INLINE _EGLThreadInfo *_eglGetTSD(void)
{
#ifdef GLX_USE_TLS
return (_EGLThreadInfo *) _egl_TLS;
#else
return (_EGLThreadInfo *) pthread_getspecific(_egl_TSD);
#endif
}
static INLINE void _eglFiniTSD(void)
@@ -300,6 +286,9 @@ _eglError(EGLint errCode, const char *msg)
case EGL_BAD_SURFACE:
s = "EGL_BAD_SURFACE";
break;
case EGL_NOT_INITIALIZED:
s = "EGL_NOT_INITIALIZED";
break;
#ifdef EGL_MESA_screen_surface
case EGL_BAD_SCREEN_MESA:
s = "EGL_BAD_SCREEN_MESA";
@@ -309,7 +298,7 @@ _eglError(EGLint errCode, const char *msg)
break;
#endif
default:
s = "other";
s = "other EGL error";
}
_eglLog(_EGL_DEBUG, "EGL user error 0x%x (%s) in %s\n", errCode, s, msg);
}

View File

@@ -27,8 +27,10 @@ _eglGetNativePlatformFromEnv(void)
} egl_platforms[_EGL_NUM_PLATFORMS] = {
{ _EGL_PLATFORM_WINDOWS, "gdi" },
{ _EGL_PLATFORM_X11, "x11" },
{ _EGL_PLATFORM_WAYLAND, "wayland" },
{ _EGL_PLATFORM_DRM, "drm" },
{ _EGL_PLATFORM_FBDEV, "fbdev" }
{ _EGL_PLATFORM_FBDEV, "fbdev" },
{ _EGL_PLATFORM_ANDROID, "android" }
};
_EGLPlatformType plat = _EGL_INVALID_PLATFORM;
const char *plat_name;
@@ -233,17 +235,53 @@ _eglCheckResource(void *res, _EGLResourceType type, _EGLDisplay *dpy)
/**
* Link a resource to a display.
* Initialize a display resource.
*/
void
_eglLinkResource(_EGLResource *res, _EGLResourceType type, _EGLDisplay *dpy)
_eglInitResource(_EGLResource *res, EGLint size, _EGLDisplay *dpy)
{
assert(!res->Display || res->Display == dpy);
memset(res, 0, size);
res->Display = dpy;
res->RefCount = 1;
}
/**
* Increment reference count for the resource.
*/
void
_eglGetResource(_EGLResource *res)
{
assert(res && res->RefCount > 0);
/* hopefully a resource is always manipulated with its display locked */
res->RefCount++;
}
/**
* Decrement reference count for the resource.
*/
EGLBoolean
_eglPutResource(_EGLResource *res)
{
assert(res && res->RefCount > 0);
res->RefCount--;
return (!res->RefCount);
}
/**
* Link a resource to its display.
*/
void
_eglLinkResource(_EGLResource *res, _EGLResourceType type)
{
assert(res->Display);
res->IsLinked = EGL_TRUE;
res->Next = dpy->ResourceLists[type];
dpy->ResourceLists[type] = res;
res->Next = res->Display->ResourceLists[type];
res->Display->ResourceLists[type] = res;
_eglGetResource(res);
}
@@ -270,6 +308,9 @@ _eglUnlinkResource(_EGLResource *res, _EGLResourceType type)
}
res->Next = NULL;
/* do not reset res->Display */
res->IsLinked = EGL_FALSE;
_eglPutResource(res);
/* We always unlink before destroy. The driver still owns a reference */
assert(res->RefCount);
}

View File

@@ -11,8 +11,10 @@
enum _egl_platform_type {
_EGL_PLATFORM_WINDOWS,
_EGL_PLATFORM_X11,
_EGL_PLATFORM_WAYLAND,
_EGL_PLATFORM_DRM,
_EGL_PLATFORM_FBDEV,
_EGL_PLATFORM_ANDROID,
_EGL_NUM_PLATFORMS,
_EGL_INVALID_PLATFORM = -1
@@ -40,6 +42,7 @@ struct _egl_resource
/* which display the resource belongs to */
_EGLDisplay *Display;
EGLBoolean IsLinked;
EGLint RefCount;
/* used to link resources of the same type */
_EGLResource *Next;
@@ -56,6 +59,8 @@ struct _egl_extensions
EGLBoolean MESA_drm_display;
EGLBoolean MESA_drm_image;
EGLBoolean WL_bind_wayland_display;
EGLBoolean KHR_image_base;
EGLBoolean KHR_image_pixmap;
EGLBoolean KHR_vg_parent_image;
@@ -74,7 +79,8 @@ struct _egl_extensions
EGLBoolean NOK_swap_region;
EGLBoolean NOK_texture_from_pixmap;
char String[_EGL_MAX_EXTENSIONS_LEN];
EGLBoolean ANDROID_image_native_buffer;
EGLBoolean ANDROID_swap_rectangle;
};
@@ -85,21 +91,29 @@ struct _egl_display
_EGLMutex Mutex;
_EGLPlatformType Platform;
void *PlatformDisplay;
_EGLPlatformType Platform; /**< The type of the platform display */
void *PlatformDisplay; /**< A pointer to the platform display */
EGLBoolean Initialized; /**< True if the display is initialized */
_EGLDriver *Driver;
void *DriverData; /* private to driver */
_EGLDriver *Driver; /**< Matched driver of the display */
EGLBoolean Initialized; /**< True if the display is initialized */
int APImajor, APIminor; /**< as returned by eglInitialize() */
char Version[1000]; /**< initialized from APImajor/minor, DriverName */
/* options that affect how the driver initializes the display */
struct {
EGLBoolean TestOnly; /**< Driver should not set fields when true */
EGLBoolean UseFallback; /**< Use fallback driver (sw or less features) */
} Options;
/** Bitmask of supported APIs (EGL_xx_BIT) set by the driver during init */
EGLint ClientAPIsMask;
char ClientAPIs[1000]; /**< updated by eglQueryString */
/* these fields are set by the driver during init */
void *DriverData; /**< Driver private data */
EGLint VersionMajor; /**< EGL major version */
EGLint VersionMinor; /**< EGL minor version */
EGLint ClientAPIs; /**< Bitmask of APIs supported (EGL_xxx_BIT) */
_EGLExtensions Extensions; /**< Extensions supported */
_EGLExtensions Extensions;
/* these fields are derived from above */
char VersionString[1000]; /**< EGL_VERSION */
char ClientAPIsString[1000]; /**< EGL_CLIENT_APIS */
char ExtensionsString[_EGL_MAX_EXTENSIONS_LEN]; /**< EGL_EXTENSIONS */
_EGLArray *Screens;
_EGLArray *Configs;
@@ -162,7 +176,19 @@ _eglGetDisplayHandle(_EGLDisplay *dpy)
extern void
_eglLinkResource(_EGLResource *res, _EGLResourceType type, _EGLDisplay *dpy);
_eglInitResource(_EGLResource *res, EGLint size, _EGLDisplay *dpy);
PUBLIC void
_eglGetResource(_EGLResource *res);
PUBLIC EGLBoolean
_eglPutResource(_EGLResource *res);
extern void
_eglLinkResource(_EGLResource *res, _EGLResourceType type);
extern void

View File

@@ -9,19 +9,10 @@
#include <stdlib.h>
#include "eglstring.h"
#include "eglconfig.h"
#include "eglcontext.h"
#include "egldefines.h"
#include "egldisplay.h"
#include "egldriver.h"
#include "egllog.h"
#include "eglmisc.h"
#include "eglmode.h"
#include "eglscreen.h"
#include "eglstring.h"
#include "eglsurface.h"
#include "eglimage.h"
#include "eglsync.h"
#include "eglmutex.h"
#if defined(_EGL_OS_UNIX)
@@ -34,6 +25,7 @@
typedef struct _egl_module {
char *Path;
_EGLMain_t BuiltIn;
void *Handle;
_EGLDriver *Driver;
} _EGLModule;
@@ -41,6 +33,24 @@ typedef struct _egl_module {
static _EGL_DECLARE_MUTEX(_eglModuleMutex);
static _EGLArray *_eglModules;
const struct {
const char *name;
_EGLMain_t main;
} _eglBuiltInDrivers[] = {
#ifdef _EGL_BUILT_IN_DRIVER_GALLIUM
{ "egl_gallium", _eglBuiltInDriverGALLIUM },
#endif
#ifdef _EGL_BUILT_IN_DRIVER_ANDROID
{ "egl_android", _eglBuiltInDriverANDROID },
#endif
#ifdef _EGL_BUILT_IN_DRIVER_DRI2
{ "egl_dri2", _eglBuiltInDriverDRI2 },
#endif
#ifdef _EGL_BUILT_IN_DRIVER_GLX
{ "egl_glx", _eglBuiltInDriverGLX },
#endif
{ NULL, NULL }
};
/**
* Wrappers for dlopen/dlclose()
@@ -137,9 +147,6 @@ _eglOpenLibrary(const char *driverPath, lib_handle *handle)
if (!lib) {
_eglLog(_EGL_WARNING, "Could not open driver %s (%s)",
driverPath, error);
if (!getenv("EGL_DRIVER"))
_eglLog(_EGL_WARNING,
"The driver can be overridden by setting EGL_DRIVER");
return NULL;
}
@@ -166,9 +173,18 @@ _eglLoadModule(_EGLModule *mod)
lib_handle lib;
_EGLDriver *drv;
mainFunc = _eglOpenLibrary(mod->Path, &lib);
if (!mainFunc)
return EGL_FALSE;
if (mod->Driver)
return EGL_TRUE;
if (mod->BuiltIn) {
lib = (lib_handle) NULL;
mainFunc = mod->BuiltIn;
}
else {
mainFunc = _eglOpenLibrary(mod->Path, &lib);
if (!mainFunc)
return EGL_FALSE;
}
drv = mainFunc(NULL);
if (!drv) {
@@ -195,11 +211,22 @@ _eglLoadModule(_EGLModule *mod)
static void
_eglUnloadModule(_EGLModule *mod)
{
#if defined(_EGL_OS_UNIX)
/* destroy the driver */
if (mod->Driver && mod->Driver->Unload)
mod->Driver->Unload(mod->Driver);
/*
* XXX At this point (atexit), the module might be the last reference to
* libEGL. Closing the module might unmap libEGL and give problems.
*/
#if 0
if (mod->Handle)
close_library(mod->Handle);
#endif
#elif defined(_EGL_OS_WINDOWS)
/* XXX Windows unloads DLLs before atexit */
#endif
mod->Driver = NULL;
mod->Handle = NULL;
@@ -310,68 +337,6 @@ _eglLoaderFile(const char *dir, size_t len, void *loader_data)
}
/**
* A loader function for use with _eglPreloadForEach. The loader data is the
* pattern (prefix) of the files to look for.
*/
static EGLBoolean
_eglLoaderPattern(const char *dir, size_t len, void *loader_data)
{
#if defined(_EGL_OS_UNIX)
const char *prefix, *suffix;
size_t prefix_len, suffix_len;
DIR *dirp;
struct dirent *dirent;
char path[1024];
if (len + 2 > sizeof(path))
return EGL_TRUE;
if (len) {
memcpy(path, dir, len);
path[len++] = '/';
}
path[len] = '\0';
dirp = opendir(path);
if (!dirp)
return EGL_TRUE;
prefix = (const char *) loader_data;
prefix_len = strlen(prefix);
suffix = library_suffix();
suffix_len = (suffix) ? strlen(suffix) : 0;
while ((dirent = readdir(dirp))) {
size_t dirent_len = strlen(dirent->d_name);
const char *p;
/* match the prefix */
if (strncmp(dirent->d_name, prefix, prefix_len) != 0)
continue;
/* match the suffix */
if (suffix) {
p = dirent->d_name + dirent_len - suffix_len;
if (p < dirent->d_name || strcmp(p, suffix) != 0)
continue;
}
/* make a full path and add it to the module array */
if (len + dirent_len + 1 <= sizeof(path)) {
strcpy(path + len, dirent->d_name);
_eglAddModule(path);
}
}
closedir(dirp);
return EGL_TRUE;
#else /* _EGL_OS_UNIX */
/* stop immediately */
return EGL_FALSE;
#endif
}
/**
* Run the callback function on each driver directory.
*
@@ -404,35 +369,62 @@ _eglPreloadForEach(const char *search_path,
static const char *
_eglGetSearchPath(void)
{
static const char *search_path;
static char search_path[1024];
#if defined(_EGL_OS_UNIX) || defined(_EGL_OS_WINDOWS)
if (!search_path) {
static char buffer[1024];
const char *p;
if (search_path[0] == '\0') {
char *buf = search_path;
size_t len = sizeof(search_path);
EGLBoolean use_env;
char dir_sep;
int ret;
p = getenv("EGL_DRIVERS_PATH");
#if defined(_EGL_OS_UNIX)
if (p && (geteuid() != getuid() || getegid() != getgid())) {
use_env = (geteuid() == getuid() && getegid() == getgid());
dir_sep = '/';
#else
use_env = EGL_TRUE;
dir_sep = '\\';
#endif
if (use_env) {
char *p;
/* extract the dirname from EGL_DRIVER */
p = getenv("EGL_DRIVER");
if (p && strchr(p, dir_sep)) {
ret = _eglsnprintf(buf, len, "%s", p);
if (ret > 0 && ret < len) {
p = strrchr(buf, dir_sep);
*p++ = ':';
len -= p - buf;
buf = p;
}
}
/* append EGL_DRIVERS_PATH */
p = getenv("EGL_DRIVERS_PATH");
if (p) {
ret = _eglsnprintf(buf, len, "%s:", p);
if (ret > 0 && ret < len) {
buf += ret;
len -= ret;
}
}
}
else {
_eglLog(_EGL_DEBUG,
"ignore EGL_DRIVERS_PATH for setuid/setgid binaries");
p = NULL;
}
#endif /* _EGL_OS_UNIX */
if (p) {
ret = _eglsnprintf(buffer, sizeof(buffer),
"%s:%s", p, _EGL_DRIVER_SEARCH_DIR);
if (ret > 0 && ret < sizeof(buffer))
search_path = buffer;
}
ret = _eglsnprintf(buf, len, "%s", _EGL_DRIVER_SEARCH_DIR);
if (ret < 0 || ret >= len)
search_path[0] = '\0';
_eglLog(_EGL_DEBUG, "EGL search path is %s", search_path);
}
if (!search_path)
search_path = _EGL_DRIVER_SEARCH_DIR;
#else
search_path = "";
#endif
#endif /* defined(_EGL_OS_UNIX) || defined(_EGL_OS_WINDOWS) */
return search_path;
}
@@ -443,11 +435,12 @@ _eglGetSearchPath(void)
*
* The user driver is specified by EGL_DRIVER.
*/
static void
static EGLBoolean
_eglAddUserDriver(void)
{
const char *search_path = _eglGetSearchPath();
char *env;
size_t name_len = 0;
env = getenv("EGL_DRIVER");
#if defined(_EGL_OS_UNIX)
@@ -459,35 +452,73 @@ _eglAddUserDriver(void)
env = NULL;
}
}
#endif /* _EGL_OS_UNIX */
else if (env) {
char *suffix = strchr(env, '.');
name_len = (suffix) ? suffix - env : strlen(env);
}
#else
if (env)
name_len = strlen(env);
#endif /* _EGL_OS_UNIX */
/*
* Try built-in drivers first if we know the driver name. This makes sure
* we do not load the outdated external driver that is still on the
* filesystem.
*/
if (name_len) {
_EGLModule *mod;
EGLint i;
for (i = 0; _eglBuiltInDrivers[i].name; i++) {
if (strlen(_eglBuiltInDrivers[i].name) == name_len &&
!strncmp(_eglBuiltInDrivers[i].name, env, name_len)) {
mod = _eglAddModule(env);
if (mod)
mod->BuiltIn = _eglBuiltInDrivers[i].main;
return EGL_TRUE;
}
}
}
/* otherwise, treat env as a path */
if (env) {
_eglPreloadForEach(search_path, _eglLoaderFile, (void *) env);
return EGL_TRUE;
}
return EGL_FALSE;
}
/**
* Add default drivers to the module array.
* Add egl_gallium to the module array.
*/
static void
_eglAddDefaultDrivers(void)
_eglAddGalliumDriver(void)
{
const char *search_path = _eglGetSearchPath();
EGLint i;
#if defined(_EGL_OS_WINDOWS)
const char *DefaultDriverNames[] = {
"egl_gallium"
};
#elif defined(_EGL_OS_UNIX)
const char *DefaultDriverNames[] = {
"egl_gallium",
"egl_dri2",
"egl_glx"
};
#ifndef _EGL_BUILT_IN_DRIVER_GALLIUM
void *external = (void *) "egl_gallium";
_eglPreloadForEach(_eglGetSearchPath(), _eglLoaderFile, external);
#endif
}
for (i = 0; i < ARRAY_SIZE(DefaultDriverNames); i++) {
void *name = (void *) DefaultDriverNames[i];
_eglPreloadForEach(search_path, _eglLoaderFile, name);
/**
* Add built-in drivers to the module array.
*/
static void
_eglAddBuiltInDrivers(void)
{
_EGLModule *mod;
EGLint i;
for (i = 0; _eglBuiltInDrivers[i].name; i++) {
mod = _eglAddModule(_eglBuiltInDrivers[i].name);
if (mod)
mod->BuiltIn = _eglBuiltInDrivers[i].main;
}
}
@@ -502,113 +533,96 @@ _eglAddDrivers(void)
if (_eglModules)
return EGL_TRUE;
/* the order here decides the priorities of the drivers */
_eglAddUserDriver();
_eglAddDefaultDrivers();
_eglPreloadForEach(_eglGetSearchPath(), _eglLoaderPattern, (void *) "egl_");
if (!_eglAddUserDriver()) {
/*
* Add other drivers only when EGL_DRIVER is not set. The order here
* decides the priorities.
*/
_eglAddGalliumDriver();
_eglAddBuiltInDrivers();
}
return (_eglModules != NULL);
}
/**
* Match a display to a driver. The display is initialized unless use_probe is
* true.
*
* The matching is done by finding the first driver that can initialize the
* display, or when use_probe is true, the driver with highest score.
* A helper function for _eglMatchDriver. It finds the first driver that can
* initialize the display and return.
*/
static _EGLDriver *
_eglMatchAndInitialize(_EGLDisplay *dpy)
{
_EGLDriver *drv = NULL;
EGLint i = 0;
if (!_eglAddDrivers()) {
_eglLog(_EGL_WARNING, "failed to find any driver");
return NULL;
}
if (dpy->Driver) {
drv = dpy->Driver;
/* no re-matching? */
if (!drv->API.Initialize(drv, dpy))
drv = NULL;
return drv;
}
while (i < _eglModules->Size) {
_EGLModule *mod = (_EGLModule *) _eglModules->Elements[i];
if (!_eglLoadModule(mod)) {
/* remove invalid modules */
_eglEraseArray(_eglModules, i, _eglFreeModule);
continue;
}
if (mod->Driver->API.Initialize(mod->Driver, dpy)) {
drv = mod->Driver;
break;
}
else {
i++;
}
}
return drv;
}
/**
* Match a display to a driver. The display is initialized unless test_only is
* true. The matching is done by finding the first driver that can initialize
* the display.
*/
_EGLDriver *
_eglMatchDriver(_EGLDisplay *dpy, EGLBoolean use_probe)
_eglMatchDriver(_EGLDisplay *dpy, EGLBoolean test_only)
{
_EGLModule *mod;
_EGLDriver *best_drv = NULL;
EGLint best_score = 0;
EGLint major, minor, i;
_EGLDriver *best_drv;
assert(!dpy->Initialized);
_eglLockMutex(&_eglModuleMutex);
if (!_eglAddDrivers()) {
_eglUnlockMutex(&_eglModuleMutex);
return EGL_FALSE;
}
/* set options */
dpy->Options.TestOnly = test_only;
dpy->Options.UseFallback = EGL_FALSE;
/* match the loaded modules */
for (i = 0; i < _eglModules->Size; i++) {
mod = (_EGLModule *) _eglModules->Elements[i];
if (!mod->Driver)
break;
if (use_probe) {
EGLint score = (mod->Driver->Probe) ?
mod->Driver->Probe(mod->Driver, dpy) : 1;
if (score > best_score) {
best_drv = mod->Driver;
best_score = score;
}
}
else {
if (mod->Driver->API.Initialize(mod->Driver, dpy, &major, &minor)) {
best_drv = mod->Driver;
best_score = 100;
}
}
/* perfect match */
if (best_score >= 100)
break;
}
/* load more modules */
best_drv = _eglMatchAndInitialize(dpy);
if (!best_drv) {
EGLint first_unloaded = i;
while (i < _eglModules->Size) {
mod = (_EGLModule *) _eglModules->Elements[i];
assert(!mod->Driver);
if (!_eglLoadModule(mod)) {
/* remove invalid modules */
_eglEraseArray(_eglModules, i, _eglFreeModule);
continue;
}
if (use_probe) {
best_score = (mod->Driver->Probe) ?
mod->Driver->Probe(mod->Driver, dpy) : 1;
}
else {
if (mod->Driver->API.Initialize(mod->Driver, dpy, &major, &minor))
best_score = 100;
}
if (best_score > 0) {
best_drv = mod->Driver;
/* loaded modules come before unloaded ones */
if (first_unloaded != i) {
void *tmp = _eglModules->Elements[i];
_eglModules->Elements[i] =
_eglModules->Elements[first_unloaded];
_eglModules->Elements[first_unloaded] = tmp;
}
break;
}
else {
_eglUnloadModule(mod);
i++;
}
}
dpy->Options.UseFallback = EGL_TRUE;
best_drv = _eglMatchAndInitialize(dpy);
}
_eglUnlockMutex(&_eglModuleMutex);
if (best_drv) {
_eglLog(_EGL_DEBUG, "the best driver is %s (score %d)",
best_drv->Name, best_score);
if (!use_probe) {
_eglLog(_EGL_DEBUG, "the best driver is %s%s",
best_drv->Name, (test_only) ? " (test only) " : "");
if (!test_only) {
dpy->Driver = best_drv;
dpy->Initialized = EGL_TRUE;
dpy->APImajor = major;
dpy->APIminor = minor;
}
}
@@ -652,88 +666,12 @@ _eglUnloadDrivers(void)
{
/* this is called at atexit time */
if (_eglModules) {
#if defined(_EGL_OS_UNIX)
_eglDestroyArray(_eglModules, _eglFreeModule);
#elif defined(_EGL_OS_WINDOWS)
/* XXX Windows unloads DLLs before atexit */
_eglDestroyArray(_eglModules, NULL);
#endif
_eglModules = NULL;
}
}
/**
* Plug all the available fallback routines into the given driver's
* dispatch table.
*/
void
_eglInitDriverFallbacks(_EGLDriver *drv)
{
/* If a pointer is set to NULL, then the device driver _really_ has
* to implement it.
*/
drv->API.Initialize = NULL;
drv->API.Terminate = NULL;
drv->API.GetConfigs = _eglGetConfigs;
drv->API.ChooseConfig = _eglChooseConfig;
drv->API.GetConfigAttrib = _eglGetConfigAttrib;
drv->API.CreateContext = _eglCreateContext;
drv->API.DestroyContext = _eglDestroyContext;
drv->API.MakeCurrent = _eglMakeCurrent;
drv->API.QueryContext = _eglQueryContext;
drv->API.CreateWindowSurface = _eglCreateWindowSurface;
drv->API.CreatePixmapSurface = _eglCreatePixmapSurface;
drv->API.CreatePbufferSurface = _eglCreatePbufferSurface;
drv->API.DestroySurface = _eglDestroySurface;
drv->API.QuerySurface = _eglQuerySurface;
drv->API.SurfaceAttrib = _eglSurfaceAttrib;
drv->API.BindTexImage = _eglBindTexImage;
drv->API.ReleaseTexImage = _eglReleaseTexImage;
drv->API.SwapInterval = _eglSwapInterval;
drv->API.SwapBuffers = _eglSwapBuffers;
drv->API.CopyBuffers = _eglCopyBuffers;
drv->API.QueryString = _eglQueryString;
drv->API.WaitClient = _eglWaitClient;
drv->API.WaitNative = _eglWaitNative;
#ifdef EGL_MESA_screen_surface
drv->API.ChooseModeMESA = _eglChooseModeMESA;
drv->API.GetModesMESA = _eglGetModesMESA;
drv->API.GetModeAttribMESA = _eglGetModeAttribMESA;
drv->API.GetScreensMESA = _eglGetScreensMESA;
drv->API.CreateScreenSurfaceMESA = _eglCreateScreenSurfaceMESA;
drv->API.ShowScreenSurfaceMESA = _eglShowScreenSurfaceMESA;
drv->API.ScreenPositionMESA = _eglScreenPositionMESA;
drv->API.QueryScreenMESA = _eglQueryScreenMESA;
drv->API.QueryScreenSurfaceMESA = _eglQueryScreenSurfaceMESA;
drv->API.QueryScreenModeMESA = _eglQueryScreenModeMESA;
drv->API.QueryModeStringMESA = _eglQueryModeStringMESA;
#endif /* EGL_MESA_screen_surface */
#ifdef EGL_VERSION_1_2
drv->API.CreatePbufferFromClientBuffer = _eglCreatePbufferFromClientBuffer;
#endif /* EGL_VERSION_1_2 */
#ifdef EGL_KHR_image_base
drv->API.CreateImageKHR = _eglCreateImageKHR;
drv->API.DestroyImageKHR = _eglDestroyImageKHR;
#endif /* EGL_KHR_image_base */
#ifdef EGL_KHR_reusable_sync
drv->API.CreateSyncKHR = _eglCreateSyncKHR;
drv->API.DestroySyncKHR = _eglDestroySyncKHR;
drv->API.ClientWaitSyncKHR = _eglClientWaitSyncKHR;
drv->API.SignalSyncKHR = _eglSignalSyncKHR;
drv->API.GetSyncAttribKHR = _eglGetSyncAttribKHR;
#endif /* EGL_KHR_reusable_sync */
}
/**
* Invoke a callback function on each EGL search path.
*

View File

@@ -4,7 +4,7 @@
#include "egltypedefs.h"
#include "eglapi.h"
#include <stddef.h>
/**
* Define an inline driver typecast function.
@@ -43,16 +43,6 @@ struct _egl_driver
{
const char *Name; /**< name of this driver */
/**
* Probe a display and return a score.
*
* Roughly,
* 50 means the driver supports the display;
* 90 means the driver can accelerate the display;
* 100 means a perfect match.
*/
EGLint (*Probe)(_EGLDriver *drv, _EGLDisplay *dpy);
/**
* Release the driver resource.
*
@@ -64,12 +54,28 @@ struct _egl_driver
};
extern _EGLDriver *
_eglBuiltInDriverGALLIUM(const char *args);
extern _EGLDriver *
_eglBuiltInDriverANDROID(const char *args);
extern _EGLDriver *
_eglBuiltInDriverDRI2(const char *args);
extern _EGLDriver *
_eglBuiltInDriverGLX(const char *args);
PUBLIC _EGLDriver *
_eglMain(const char *args);
extern _EGLDriver *
_eglMatchDriver(_EGLDisplay *dpy, EGLBoolean probe_only);
_eglMatchDriver(_EGLDisplay *dpy, EGLBoolean test_only);
extern __eglMustCastToProperFunctionPointerType
@@ -80,6 +86,7 @@ extern void
_eglUnloadDrivers(void);
/* defined in eglfallbacks.c */
PUBLIC void
_eglInitDriverFallbacks(_EGLDriver *drv);

View File

@@ -0,0 +1,99 @@
#include <string.h>
#include "egltypedefs.h"
#include "egldriver.h"
#include "eglconfig.h"
#include "eglcontext.h"
#include "eglsurface.h"
#include "eglmisc.h"
#include "eglscreen.h"
#include "eglmode.h"
#include "eglsync.h"
static EGLBoolean
_eglReturnFalse(void)
{
return EGL_FALSE;
}
/**
* Plug all the available fallback routines into the given driver's
* dispatch table.
*/
void
_eglInitDriverFallbacks(_EGLDriver *drv)
{
memset(&drv->API, 0, sizeof(drv->API));
/* the driver has to implement these */
drv->API.Initialize = NULL;
drv->API.Terminate = NULL;
drv->API.GetConfigs = _eglGetConfigs;
drv->API.ChooseConfig = _eglChooseConfig;
drv->API.GetConfigAttrib = _eglGetConfigAttrib;
drv->API.CreateContext = (CreateContext_t) _eglReturnFalse;
drv->API.DestroyContext = (DestroyContext_t) _eglReturnFalse;
drv->API.MakeCurrent = (MakeCurrent_t) _eglReturnFalse;
drv->API.QueryContext = _eglQueryContext;
drv->API.CreateWindowSurface = (CreateWindowSurface_t) _eglReturnFalse;
drv->API.CreatePixmapSurface = (CreatePixmapSurface_t) _eglReturnFalse;
drv->API.CreatePbufferSurface = (CreatePbufferSurface_t) _eglReturnFalse;
drv->API.CreatePbufferFromClientBuffer =
(CreatePbufferFromClientBuffer_t) _eglReturnFalse;
drv->API.DestroySurface = (DestroySurface_t) _eglReturnFalse;
drv->API.QuerySurface = _eglQuerySurface;
drv->API.SurfaceAttrib = _eglSurfaceAttrib;
drv->API.BindTexImage = (BindTexImage_t) _eglReturnFalse;
drv->API.ReleaseTexImage = (ReleaseTexImage_t) _eglReturnFalse;
drv->API.CopyBuffers = (CopyBuffers_t) _eglReturnFalse;
drv->API.SwapBuffers = (SwapBuffers_t) _eglReturnFalse;
drv->API.SwapInterval = _eglSwapInterval;
drv->API.WaitClient = (WaitClient_t) _eglReturnFalse;
drv->API.WaitNative = (WaitNative_t) _eglReturnFalse;
drv->API.GetProcAddress = (GetProcAddress_t) _eglReturnFalse;
drv->API.QueryString = _eglQueryString;
#ifdef EGL_MESA_screen_surface
drv->API.CopyContextMESA = (CopyContextMESA_t) _eglReturnFalse;
drv->API.CreateScreenSurfaceMESA =
(CreateScreenSurfaceMESA_t) _eglReturnFalse;
drv->API.ShowScreenSurfaceMESA = (ShowScreenSurfaceMESA_t) _eglReturnFalse;
drv->API.ChooseModeMESA = _eglChooseModeMESA;
drv->API.GetModesMESA = _eglGetModesMESA;
drv->API.GetModeAttribMESA = _eglGetModeAttribMESA;
drv->API.GetScreensMESA = _eglGetScreensMESA;
drv->API.ScreenPositionMESA = _eglScreenPositionMESA;
drv->API.QueryScreenMESA = _eglQueryScreenMESA;
drv->API.QueryScreenSurfaceMESA = _eglQueryScreenSurfaceMESA;
drv->API.QueryScreenModeMESA = _eglQueryScreenModeMESA;
drv->API.QueryModeStringMESA = _eglQueryModeStringMESA;
#endif /* EGL_MESA_screen_surface */
#ifdef EGL_KHR_image_base
drv->API.CreateImageKHR = NULL;
drv->API.DestroyImageKHR = NULL;
#endif /* EGL_KHR_image_base */
#ifdef EGL_KHR_reusable_sync
drv->API.CreateSyncKHR = NULL;
drv->API.DestroySyncKHR = NULL;
drv->API.ClientWaitSyncKHR = NULL;
drv->API.SignalSyncKHR = NULL;
drv->API.GetSyncAttribKHR = _eglGetSyncAttribKHR;
#endif /* EGL_KHR_reusable_sync */
#ifdef EGL_MESA_drm_image
drv->API.CreateDRMImageMESA = NULL;
drv->API.ExportDRMImageMESA = NULL;
#endif
#ifdef EGL_NOK_swap_region
drv->API.SwapBuffersRegionNOK = NULL;
#endif
}

View File

@@ -2,7 +2,6 @@
#include <string.h>
#include "eglimage.h"
#include "eglcurrent.h"
#include "egllog.h"
@@ -12,28 +11,57 @@
/**
* Parse the list of image attributes and return the proper error code.
*/
static EGLint
_eglParseImageAttribList(_EGLImage *img, const EGLint *attrib_list)
EGLint
_eglParseImageAttribList(_EGLImageAttribs *attrs, _EGLDisplay *dpy,
const EGLint *attrib_list)
{
EGLint i, err = EGL_SUCCESS;
(void) dpy;
memset(attrs, 0, sizeof(attrs));
attrs->ImagePreserved = EGL_FALSE;
attrs->GLTextureLevel = 0;
attrs->GLTextureZOffset = 0;
if (!attrib_list)
return EGL_SUCCESS;
return err;
for (i = 0; attrib_list[i] != EGL_NONE; i++) {
EGLint attr = attrib_list[i++];
EGLint val = attrib_list[i];
switch (attr) {
/* EGL_KHR_image_base */
case EGL_IMAGE_PRESERVED_KHR:
img->Preserved = val;
attrs->ImagePreserved = val;
break;
/* EGL_KHR_gl_image */
case EGL_GL_TEXTURE_LEVEL_KHR:
img->GLTextureLevel = val;
attrs->GLTextureLevel = val;
break;
case EGL_GL_TEXTURE_ZOFFSET_KHR:
img->GLTextureZOffset = val;
attrs->GLTextureZOffset = val;
break;
/* EGL_MESA_drm_image */
case EGL_WIDTH:
attrs->Width = val;
break;
case EGL_HEIGHT:
attrs->Height = val;
break;
case EGL_DRM_BUFFER_FORMAT_MESA:
attrs->DRMBufferFormatMESA = val;
break;
case EGL_DRM_BUFFER_USE_MESA:
attrs->DRMBufferUseMESA = val;
break;
case EGL_DRM_BUFFER_STRIDE_MESA:
attrs->DRMBufferStrideMESA = val;
break;
default:
/* unknown attrs are ignored */
break;
@@ -50,41 +78,12 @@ _eglParseImageAttribList(_EGLImage *img, const EGLint *attrib_list)
EGLBoolean
_eglInitImage(_EGLImage *img, _EGLDisplay *dpy, const EGLint *attrib_list)
_eglInitImage(_EGLImage *img, _EGLDisplay *dpy)
{
EGLint err;
memset(img, 0, sizeof(_EGLImage));
img->Resource.Display = dpy;
img->Preserved = EGL_FALSE;
img->GLTextureLevel = 0;
img->GLTextureZOffset = 0;
err = _eglParseImageAttribList(img, attrib_list);
if (err != EGL_SUCCESS)
return _eglError(err, "eglCreateImageKHR");
_eglInitResource(&img->Resource, sizeof(*img), dpy);
return EGL_TRUE;
}
_EGLImage *
_eglCreateImageKHR(_EGLDriver *drv, _EGLDisplay *dpy, _EGLContext *ctx,
EGLenum target, EGLClientBuffer buffer,
const EGLint *attr_list)
{
/* driver should override this function */
return NULL;
}
EGLBoolean
_eglDestroyImageKHR(_EGLDriver *drv, _EGLDisplay *dpy, _EGLImage *image)
{
/* driver should override this function */
return EGL_FALSE;
}
#endif /* EGL_KHR_image_base */

View File

@@ -6,6 +6,23 @@
#include "egldisplay.h"
struct _egl_image_attribs
{
/* EGL_KHR_image_base */
EGLBoolean ImagePreserved;
/* EGL_KHR_gl_image */
EGLint GLTextureLevel;
EGLint GLTextureZOffset;
/* EGL_MESA_drm_image */
EGLint Width;
EGLint Height;
EGLint DRMBufferFormatMESA;
EGLint DRMBufferUseMESA;
EGLint DRMBufferStrideMESA;
};
/**
* "Base" class for device driver images.
*/
@@ -13,34 +30,48 @@ struct _egl_image
{
/* An image is a display resource */
_EGLResource Resource;
EGLBoolean Preserved;
EGLint GLTextureLevel;
EGLint GLTextureZOffset;
};
PUBLIC EGLint
_eglParseImageAttribList(_EGLImageAttribs *attrs, _EGLDisplay *dpy,
const EGLint *attrib_list);
PUBLIC EGLBoolean
_eglInitImage(_EGLImage *img, _EGLDisplay *dpy, const EGLint *attrib_list);
extern _EGLImage *
_eglCreateImageKHR(_EGLDriver *drv, _EGLDisplay *dpy, _EGLContext *ctx,
EGLenum target, EGLClientBuffer buffer, const EGLint *attr_list);
extern EGLBoolean
_eglDestroyImageKHR(_EGLDriver *drv, _EGLDisplay *dpy, _EGLImage *image);
_eglInitImage(_EGLImage *img, _EGLDisplay *dpy);
/**
* Link an image to a display and return the handle of the link.
* Increment reference count for the image.
*/
static INLINE _EGLImage *
_eglGetImage(_EGLImage *img)
{
if (img)
_eglGetResource(&img->Resource);
return img;
}
/**
* Decrement reference count for the image.
*/
static INLINE EGLBoolean
_eglPutImage(_EGLImage *img)
{
return (img) ? _eglPutResource(&img->Resource) : EGL_FALSE;
}
/**
* Link an image to its display and return the handle of the link.
* The handle can be passed to client directly.
*/
static INLINE EGLImageKHR
_eglLinkImage(_EGLImage *img, _EGLDisplay *dpy)
_eglLinkImage(_EGLImage *img)
{
_eglLinkResource(&img->Resource, _EGL_RESOURCE_IMAGE, dpy);
_eglLinkResource(&img->Resource, _EGL_RESOURCE_IMAGE);
return (EGLImageKHR) img;
}
@@ -82,15 +113,4 @@ _eglGetImageHandle(_EGLImage *img)
}
/**
* Return true if the image is linked to a display.
*/
static INLINE EGLBoolean
_eglIsImageLinked(_EGLImage *img)
{
_EGLResource *res = (_EGLResource *) img;
return (res && _eglIsResourceLinked(res));
}
#endif /* EGLIMAGE_INCLUDED */

View File

@@ -151,6 +151,7 @@ _eglLog(EGLint level, const char *fmtStr, ...)
{
va_list args;
char msg[MAXSTRING];
int ret;
/* one-time initialization; a little race here is fine */
if (!logging.initialized)
@@ -162,7 +163,9 @@ _eglLog(EGLint level, const char *fmtStr, ...)
if (logging.logger) {
va_start(args, fmtStr);
vsnprintf(msg, MAXSTRING, fmtStr, args);
ret = vsnprintf(msg, MAXSTRING, fmtStr, args);
if (ret < 0 || ret >= MAXSTRING)
strcpy(msg, "<message truncated>");
va_end(args);
logging.logger(level, msg);

View File

@@ -36,6 +36,8 @@
#include "eglcurrent.h"
#include "eglmisc.h"
#include "egldisplay.h"
#include "egldriver.h"
#include "eglstring.h"
/**
@@ -73,11 +75,11 @@ _eglUpdateExtensionsString(_EGLDisplay *dpy)
do { \
if (dpy->Extensions.ext) { \
_eglAppendExtension(&exts, "EGL_" #ext); \
assert(exts <= dpy->Extensions.String + _EGL_MAX_EXTENSIONS_LEN); \
assert(exts <= dpy->ExtensionsString + _EGL_MAX_EXTENSIONS_LEN); \
} \
} while (0)
char *exts = dpy->Extensions.String;
char *exts = dpy->ExtensionsString;
if (exts[0])
return;
@@ -87,6 +89,8 @@ _eglUpdateExtensionsString(_EGLDisplay *dpy)
_EGL_CHECK_EXTENSION(MESA_drm_display);
_EGL_CHECK_EXTENSION(MESA_drm_image);
_EGL_CHECK_EXTENSION(WL_bind_wayland_display);
_EGL_CHECK_EXTENSION(KHR_image_base);
_EGL_CHECK_EXTENSION(KHR_image_pixmap);
if (dpy->Extensions.KHR_image_base && dpy->Extensions.KHR_image_pixmap)
@@ -107,6 +111,9 @@ _eglUpdateExtensionsString(_EGLDisplay *dpy)
_EGL_CHECK_EXTENSION(NOK_swap_region);
_EGL_CHECK_EXTENSION(NOK_texture_from_pixmap);
_EGL_CHECK_EXTENSION(ANDROID_image_native_buffer);
_EGL_CHECK_EXTENSION(ANDROID_swap_rectangle);
#undef _EGL_CHECK_EXTENSION
}
@@ -114,24 +121,24 @@ _eglUpdateExtensionsString(_EGLDisplay *dpy)
static void
_eglUpdateAPIsString(_EGLDisplay *dpy)
{
char *apis = dpy->ClientAPIs;
char *apis = dpy->ClientAPIsString;
if (apis[0] || !dpy->ClientAPIsMask)
if (apis[0] || !dpy->ClientAPIs)
return;
if (dpy->ClientAPIsMask & EGL_OPENGL_BIT)
if (dpy->ClientAPIs & EGL_OPENGL_BIT)
strcat(apis, "OpenGL ");
if (dpy->ClientAPIsMask & EGL_OPENGL_ES_BIT)
if (dpy->ClientAPIs & EGL_OPENGL_ES_BIT)
strcat(apis, "OpenGL_ES ");
if (dpy->ClientAPIsMask & EGL_OPENGL_ES2_BIT)
if (dpy->ClientAPIs & EGL_OPENGL_ES2_BIT)
strcat(apis, "OpenGL_ES2 ");
if (dpy->ClientAPIsMask & EGL_OPENVG_BIT)
if (dpy->ClientAPIs & EGL_OPENVG_BIT)
strcat(apis, "OpenVG ");
assert(strlen(apis) < sizeof(dpy->ClientAPIs));
assert(strlen(apis) < sizeof(dpy->ClientAPIsString));
}
@@ -139,51 +146,23 @@ const char *
_eglQueryString(_EGLDriver *drv, _EGLDisplay *dpy, EGLint name)
{
(void) drv;
(void) dpy;
switch (name) {
case EGL_VENDOR:
return _EGL_VENDOR_STRING;
case EGL_VERSION:
return dpy->Version;
_eglsnprintf(dpy->VersionString, sizeof(dpy->VersionString),
"%d.%d (%s)", dpy->VersionMajor, dpy->VersionMinor,
dpy->Driver->Name);
return dpy->VersionString;
case EGL_EXTENSIONS:
_eglUpdateExtensionsString(dpy);
return dpy->Extensions.String;
#ifdef EGL_VERSION_1_2
return dpy->ExtensionsString;
case EGL_CLIENT_APIS:
_eglUpdateAPIsString(dpy);
return dpy->ClientAPIs;
#endif
return dpy->ClientAPIsString;
default:
_eglError(EGL_BAD_PARAMETER, "eglQueryString");
return NULL;
}
}
EGLBoolean
_eglWaitClient(_EGLDriver *drv, _EGLDisplay *dpy, _EGLContext *ctx)
{
/* just a placeholder */
(void) drv;
(void) dpy;
(void) ctx;
return EGL_TRUE;
}
EGLBoolean
_eglWaitNative(_EGLDriver *drv, _EGLDisplay *dpy, EGLint engine)
{
/* just a placeholder */
(void) drv;
(void) dpy;
switch (engine) {
case EGL_CORE_NATIVE_ENGINE:
break;
default:
_eglError(EGL_BAD_PARAMETER, "eglWaitNative(engine)");
return EGL_FALSE;
}
return EGL_TRUE;
}

View File

@@ -37,12 +37,4 @@ extern const char *
_eglQueryString(_EGLDriver *drv, _EGLDisplay *dpy, EGLint name);
extern EGLBoolean
_eglWaitClient(_EGLDriver *drv, _EGLDisplay *dpy, _EGLContext *ctx);
extern EGLBoolean
_eglWaitNative(_EGLDriver *drv, _EGLDisplay *dpy, EGLint engine);
#endif /* EGLMISC_INCLUDED */

View File

@@ -3,11 +3,9 @@
#include <string.h>
#include "egldisplay.h"
#include "egldriver.h"
#include "eglmode.h"
#include "eglcurrent.h"
#include "eglscreen.h"
#include "eglstring.h"
#ifdef EGL_MESA_screen_surface
@@ -31,12 +29,19 @@ _eglLookupMode(EGLModeMESA mode, _EGLDisplay *disp)
/* loop over all screens on the display */
for (scrnum = 0; scrnum < disp->Screens->Size; scrnum++) {
const _EGLScreen *scrn = disp->Screens->Elements[scrnum];
EGLint i;
/* search list of modes for handle */
for (i = 0; i < scrn->NumModes; i++) {
if (scrn->Modes[i].Handle == mode) {
return scrn->Modes + i;
}
EGLint idx;
/*
* the mode ids of a screen ranges from scrn->Handle to scrn->Handle +
* scrn->NumModes
*/
if (mode >= scrn->Handle &&
mode < scrn->Handle + _EGL_SCREEN_MAX_MODES) {
idx = mode - scrn->Handle;
assert(idx < scrn->NumModes && scrn->Modes[idx].Handle == mode);
return &scrn->Modes[idx];
}
}
@@ -44,45 +49,6 @@ _eglLookupMode(EGLModeMESA mode, _EGLDisplay *disp)
}
/**
* Add a new mode with the given attributes (width, height, depth, refreshRate)
* to the given screen.
* Assign a new mode ID/handle to the mode as well.
* \return pointer to the new _EGLMode
*/
_EGLMode *
_eglAddNewMode(_EGLScreen *screen, EGLint width, EGLint height,
EGLint refreshRate, const char *name)
{
EGLint n;
_EGLMode *newModes;
assert(screen);
assert(width > 0);
assert(height > 0);
assert(refreshRate > 0);
n = screen->NumModes;
newModes = (_EGLMode *) realloc(screen->Modes, (n+1) * sizeof(_EGLMode));
if (newModes) {
screen->Modes = newModes;
screen->Modes[n].Handle = n + 1;
screen->Modes[n].Width = width;
screen->Modes[n].Height = height;
screen->Modes[n].RefreshRate = refreshRate;
screen->Modes[n].Optimal = EGL_FALSE;
screen->Modes[n].Interlaced = EGL_FALSE;
screen->Modes[n].Name = _eglstrdup(name);
screen->NumModes++;
return screen->Modes + n;
}
else {
return NULL;
}
}
/**
* Parse the attrib_list to fill in the fields of the given _eglMode
* Return EGL_FALSE if any errors, EGL_TRUE otherwise.

View File

@@ -32,11 +32,6 @@ extern _EGLMode *
_eglLookupMode(EGLModeMESA mode, _EGLDisplay *dpy);
PUBLIC _EGLMode *
_eglAddNewMode(_EGLScreen *screen, EGLint width, EGLint height,
EGLint refreshRate, const char *name);
extern EGLBoolean
_eglChooseModeMESA(_EGLDriver *drv, _EGLDisplay *dpy, _EGLScreen *scrn,
const EGLint *attrib_list, EGLModeMESA *modes,

View File

@@ -18,7 +18,6 @@
#include "egldisplay.h"
#include "eglcurrent.h"
#include "eglmode.h"
#include "eglconfig.h"
#include "eglsurface.h"
#include "eglscreen.h"
#include "eglmutex.h"
@@ -42,7 +41,8 @@ _eglAllocScreenHandle(void)
EGLScreenMESA s;
_eglLockMutex(&_eglNextScreenHandleMutex);
s = _eglNextScreenHandle++;
s = _eglNextScreenHandle;
_eglNextScreenHandle += _EGL_SCREEN_MAX_MODES;
_eglUnlockMutex(&_eglNextScreenHandleMutex);
return s;
@@ -53,16 +53,54 @@ _eglAllocScreenHandle(void)
* Initialize an _EGLScreen object to default values.
*/
void
_eglInitScreen(_EGLScreen *screen)
_eglInitScreen(_EGLScreen *screen, _EGLDisplay *dpy, EGLint num_modes)
{
memset(screen, 0, sizeof(_EGLScreen));
screen->Display = dpy;
screen->NumModes = num_modes;
screen->StepX = 1;
screen->StepY = 1;
if (num_modes > _EGL_SCREEN_MAX_MODES)
num_modes = _EGL_SCREEN_MAX_MODES;
screen->Modes = (_EGLMode *) calloc(num_modes, sizeof(*screen->Modes));
screen->NumModes = (screen->Modes) ? num_modes : 0;
}
/**
* Given a public screen handle, return the internal _EGLScreen object.
* Link a screen to its display and return the handle of the link.
* The handle can be passed to client directly.
*/
EGLScreenMESA
_eglLinkScreen(_EGLScreen *screen)
{
_EGLDisplay *display;
EGLint i;
assert(screen && screen->Display);
display = screen->Display;
if (!display->Screens) {
display->Screens = _eglCreateArray("Screen", 4);
if (!display->Screens)
return (EGLScreenMESA) 0;
}
screen->Handle = _eglAllocScreenHandle();
for (i = 0; i < screen->NumModes; i++)
screen->Modes[i].Handle = screen->Handle + i;
_eglAppendArray(display->Screens, (void *) screen);
return screen->Handle;
}
/**
* Lookup a handle to find the linked config.
* Return NULL if the handle has no corresponding linked config.
*/
_EGLScreen *
_eglLookupScreen(EGLScreenMESA screen, _EGLDisplay *display)
@@ -74,39 +112,21 @@ _eglLookupScreen(EGLScreenMESA screen, _EGLDisplay *display)
for (i = 0; i < display->Screens->Size; i++) {
_EGLScreen *scr = (_EGLScreen *) display->Screens->Elements[i];
if (scr->Handle == screen)
if (scr->Handle == screen) {
assert(scr->Display == display);
return scr;
}
}
return NULL;
}
/**
* Add the given _EGLScreen to the display's list of screens.
*/
void
_eglAddScreen(_EGLDisplay *display, _EGLScreen *screen)
{
assert(display);
assert(screen);
if (!display->Screens) {
display->Screens = _eglCreateArray("Screen", 4);
if (!display->Screens)
return;
}
screen->Handle = _eglAllocScreenHandle();
_eglAppendArray(display->Screens, (void *) screen);
}
static EGLBoolean
_eglFlattenScreen(void *elem, void *buffer)
{
_EGLScreen *scr = (_EGLScreen *) elem;
EGLScreenMESA *handle = (EGLScreenMESA *) buffer;
*handle = scr->Handle;
*handle = _eglGetScreenHandle(scr);
return EGL_TRUE;
}
@@ -122,66 +142,6 @@ _eglGetScreensMESA(_EGLDriver *drv, _EGLDisplay *display, EGLScreenMESA *screens
}
/**
* Drivers should do a proper implementation.
*/
_EGLSurface *
_eglCreateScreenSurfaceMESA(_EGLDriver *drv, _EGLDisplay *dpy, _EGLConfig *conf,
const EGLint *attrib_list)
{
return NULL;
}
/**
* Show the given surface on the named screen.
* If surface is EGL_NO_SURFACE, disable the screen's output.
*
* This is just a placeholder function; drivers will always override
* this with code that _really_ shows the surface.
*/
EGLBoolean
_eglShowScreenSurfaceMESA(_EGLDriver *drv, _EGLDisplay *dpy,
_EGLScreen *scrn, _EGLSurface *surf,
_EGLMode *mode)
{
if (!surf) {
scrn->CurrentSurface = NULL;
}
else {
if (surf->Type != EGL_SCREEN_BIT_MESA) {
_eglError(EGL_BAD_SURFACE, "eglShowSurfaceMESA");
return EGL_FALSE;
}
if (surf->Width < mode->Width || surf->Height < mode->Height) {
_eglError(EGL_BAD_SURFACE,
"eglShowSurfaceMESA(surface smaller than screen size)");
return EGL_FALSE;
}
scrn->CurrentSurface = surf;
scrn->CurrentMode = mode;
}
return EGL_TRUE;
}
/**
* Set a screen's current display mode.
* Note: mode = EGL_NO_MODE is valid (turns off the screen)
*
* This is just a placeholder function; drivers will always override
* this with code that _really_ sets the mode.
*/
EGLBoolean
_eglScreenModeMESA(_EGLDriver *drv, _EGLDisplay *dpy, _EGLScreen *scrn,
_EGLMode *m)
{
scrn->CurrentMode = m;
return EGL_TRUE;
}
/**
* Set a screen's surface origin.
*/
@@ -242,33 +202,4 @@ _eglQueryScreenMESA(_EGLDriver *drv, _EGLDisplay *dpy, _EGLScreen *scrn,
}
/**
* Delete the modes associated with given screen.
*/
void
_eglDestroyScreenModes(_EGLScreen *scrn)
{
EGLint i;
for (i = 0; i < scrn->NumModes; i++) {
if (scrn->Modes[i].Name)
free((char *) scrn->Modes[i].Name); /* cast away const */
}
if (scrn->Modes)
free(scrn->Modes);
scrn->Modes = NULL;
scrn->NumModes = 0;
}
/**
* Default fallback routine - drivers should usually override this.
*/
void
_eglDestroyScreen(_EGLScreen *scrn)
{
_eglDestroyScreenModes(scrn);
free(scrn);
}
#endif /* EGL_MESA_screen_surface */

View File

@@ -8,6 +8,9 @@
#ifdef EGL_MESA_screen_surface
#define _EGL_SCREEN_MAX_MODES 16
/**
* Per-screen information.
* Note that an EGL screen doesn't have a size. A screen may be set to
@@ -19,6 +22,8 @@
*/
struct _egl_screen
{
_EGLDisplay *Display;
EGLScreenMESA Handle; /* The public/opaque handle which names this object */
_EGLMode *CurrentMode;
@@ -33,41 +38,35 @@ struct _egl_screen
PUBLIC void
_eglInitScreen(_EGLScreen *screen);
_eglInitScreen(_EGLScreen *screen, _EGLDisplay *dpy, EGLint num_modes);
PUBLIC EGLScreenMESA
_eglLinkScreen(_EGLScreen *screen);
extern _EGLScreen *
_eglLookupScreen(EGLScreenMESA screen, _EGLDisplay *dpy);
PUBLIC void
_eglAddScreen(_EGLDisplay *display, _EGLScreen *screen);
/**
* Return the handle of a linked screen.
*/
static INLINE EGLScreenMESA
_eglGetScreenHandle(_EGLScreen *screen)
{
return (screen) ? screen->Handle : (EGLScreenMESA) 0;
}
extern EGLBoolean
_eglGetScreensMESA(_EGLDriver *drv, _EGLDisplay *dpy, EGLScreenMESA *screens, EGLint max_screens, EGLint *num_screens);
extern _EGLSurface *
_eglCreateScreenSurfaceMESA(_EGLDriver *drv, _EGLDisplay *dpy, _EGLConfig *conf, const EGLint *attrib_list);
extern EGLBoolean
_eglShowScreenSurfaceMESA(_EGLDriver *drv, _EGLDisplay *dpy, _EGLScreen *scrn, _EGLSurface *surf, _EGLMode *m);
extern EGLBoolean
_eglScreenModeMESA(_EGLDriver *drv, _EGLDisplay *dpy, _EGLScreen *scrn, _EGLMode *m);
extern EGLBoolean
_eglScreenPositionMESA(_EGLDriver *drv, _EGLDisplay *dpy, _EGLScreen *scrn, EGLint x, EGLint y);
extern EGLBoolean
_eglQueryDisplayMESA(_EGLDriver *drv, _EGLDisplay *dpy, EGLint attribute, EGLint *value);
extern EGLBoolean
_eglQueryScreenSurfaceMESA(_EGLDriver *drv, _EGLDisplay *dpy,
_EGLScreen *scrn, _EGLSurface **surface);
@@ -81,14 +80,6 @@ extern EGLBoolean
_eglQueryScreenMESA(_EGLDriver *drv, _EGLDisplay *dpy, _EGLScreen *scrn, EGLint attribute, EGLint *value);
extern void
_eglDestroyScreenModes(_EGLScreen *scrn);
PUBLIC void
_eglDestroyScreen(_EGLScreen *scrn);
#endif /* EGL_MESA_screen_surface */

View File

@@ -2,6 +2,7 @@
#define EGLSTRING_INCLUDED
#include <string.h>
#include <stdio.h>
#ifdef _EGL_OS_WINDOWS
#define _eglstrcasecmp _stricmp

View File

@@ -17,12 +17,12 @@
static void
_eglClampSwapInterval(_EGLSurface *surf, EGLint interval)
{
EGLint bound = GET_CONFIG_ATTRIB(surf->Config, EGL_MAX_SWAP_INTERVAL);
EGLint bound = surf->Config->MaxSwapInterval;
if (interval >= bound) {
interval = bound;
}
else {
bound = GET_CONFIG_ATTRIB(surf->Config, EGL_MIN_SWAP_INTERVAL);
bound = surf->Config->MinSwapInterval;
if (interval < bound)
interval = bound;
}
@@ -263,14 +263,13 @@ _eglInitSurface(_EGLSurface *surf, _EGLDisplay *dpy, EGLint type,
return EGL_FALSE;
}
if ((GET_CONFIG_ATTRIB(conf, EGL_SURFACE_TYPE) & type) == 0) {
if ((conf->SurfaceType & type) == 0) {
/* The config can't be used to create a surface of this type */
_eglError(EGL_BAD_CONFIG, func);
return EGL_FALSE;
}
memset(surf, 0, sizeof(_EGLSurface));
surf->Resource.Display = dpy;
_eglInitResource(&surf->Resource, sizeof(*surf), dpy);
surf->Type = type;
surf->Config = conf;
@@ -303,24 +302,6 @@ _eglInitSurface(_EGLSurface *surf, _EGLDisplay *dpy, EGLint type,
}
EGLBoolean
_eglSwapBuffers(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *surf)
{
/* Drivers have to do the actual buffer swap. */
return EGL_TRUE;
}
EGLBoolean
_eglCopyBuffers(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *surf,
EGLNativePixmapType target)
{
/* copy surface to native pixmap */
/* All implementation burdon for this is in the device driver */
return EGL_FALSE;
}
EGLBoolean
_eglQuerySurface(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *surface,
EGLint attribute, EGLint *value)
@@ -333,7 +314,7 @@ _eglQuerySurface(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *surface,
*value = surface->Height;
break;
case EGL_CONFIG_ID:
*value = GET_CONFIG_ATTRIB(surface->Config, EGL_CONFIG_ID);
*value = surface->Config->ConfigID;
break;
case EGL_LARGEST_PBUFFER:
*value = surface->LargestPbuffer;
@@ -388,51 +369,6 @@ _eglQuerySurface(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *surface,
}
/**
* Drivers should do a proper implementation.
*/
_EGLSurface *
_eglCreateWindowSurface(_EGLDriver *drv, _EGLDisplay *dpy, _EGLConfig *conf,
EGLNativeWindowType window, const EGLint *attrib_list)
{
return NULL;
}
/**
* Drivers should do a proper implementation.
*/
_EGLSurface *
_eglCreatePixmapSurface(_EGLDriver *drv, _EGLDisplay *dpy, _EGLConfig *conf,
EGLNativePixmapType pixmap, const EGLint *attrib_list)
{
return NULL;
}
/**
* Drivers should do a proper implementation.
*/
_EGLSurface *
_eglCreatePbufferSurface(_EGLDriver *drv, _EGLDisplay *dpy, _EGLConfig *conf,
const EGLint *attrib_list)
{
return NULL;
}
/**
* Default fallback routine - drivers should usually override this.
*/
EGLBoolean
_eglDestroySurface(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *surf)
{
if (!_eglIsSurfaceBound(surf))
free(surf);
return EGL_TRUE;
}
/**
* Default fallback routine - drivers might override this.
*/
@@ -445,7 +381,7 @@ _eglSurfaceAttrib(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *surface,
switch (attribute) {
case EGL_MIPMAP_LEVEL:
confval = GET_CONFIG_ATTRIB(surface->Config, EGL_RENDERABLE_TYPE);
confval = surface->Config->RenderableType;
if (!(confval & (EGL_OPENGL_ES_BIT | EGL_OPENGL_ES2_BIT))) {
err = EGL_BAD_PARAMETER;
break;
@@ -457,7 +393,7 @@ _eglSurfaceAttrib(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *surface,
case EGL_MULTISAMPLE_RESOLVE_DEFAULT:
break;
case EGL_MULTISAMPLE_RESOLVE_BOX:
confval = GET_CONFIG_ATTRIB(surface->Config, EGL_SURFACE_TYPE);
confval = surface->Config->SurfaceType;
if (!(confval & EGL_MULTISAMPLE_RESOLVE_BOX_BIT))
err = EGL_BAD_MATCH;
break;
@@ -474,7 +410,7 @@ _eglSurfaceAttrib(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *surface,
case EGL_BUFFER_DESTROYED:
break;
case EGL_BUFFER_PRESERVED:
confval = GET_CONFIG_ATTRIB(surface->Config, EGL_SURFACE_TYPE);
confval = surface->Config->SurfaceType;
if (!(confval & EGL_SWAP_BEHAVIOR_PRESERVED_BIT))
err = EGL_BAD_MATCH;
break;
@@ -536,40 +472,6 @@ _eglBindTexImage(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *surface,
}
EGLBoolean
_eglReleaseTexImage(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *surface,
EGLint buffer)
{
/* Just do basic error checking and return success/fail.
* Drivers must implement the real stuff.
*/
if (surface->Type != EGL_PBUFFER_BIT) {
_eglError(EGL_BAD_SURFACE, "eglBindTexImage");
return EGL_FALSE;
}
if (surface->TextureFormat == EGL_NO_TEXTURE) {
_eglError(EGL_BAD_MATCH, "eglBindTexImage");
return EGL_FALSE;
}
if (buffer != EGL_BACK_BUFFER) {
_eglError(EGL_BAD_PARAMETER, "eglReleaseTexImage");
return EGL_FALSE;
}
if (!surface->BoundToTexture) {
_eglError(EGL_BAD_SURFACE, "eglReleaseTexImage");
return EGL_FALSE;
}
surface->BoundToTexture = EGL_FALSE;
return EGL_TRUE;
}
EGLBoolean
_eglSwapInterval(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *surf,
EGLint interval)
@@ -577,24 +479,3 @@ _eglSwapInterval(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *surf,
_eglClampSwapInterval(surf, interval);
return EGL_TRUE;
}
#ifdef EGL_VERSION_1_2
/**
* Example function - drivers should do a proper implementation.
*/
_EGLSurface *
_eglCreatePbufferFromClientBuffer(_EGLDriver *drv, _EGLDisplay *dpy,
EGLenum buftype, EGLClientBuffer buffer,
_EGLConfig *conf, const EGLint *attrib_list)
{
if (buftype != EGL_OPENVG_IMAGE) {
_eglError(EGL_BAD_PARAMETER, "eglCreatePbufferFromClientBuffer");
return NULL;
}
return NULL;
}
#endif /* EGL_VERSION_1_2 */

Some files were not shown because too many files have changed in this diff Show More