Compare commits

...

4270 Commits

Author SHA1 Message Date
Brice Goglin
a7109f3ae5 Prepare Changelog for upload 2009-12-06 00:15:21 +01:00
Brice Goglin
e5e54a9a6e Refresh patches 2009-12-06 00:15:21 +01:00
Brice Goglin
c2ad82a90b New upstream release candidate 2009-12-06 00:15:07 +01:00
Brice Goglin
9347983556 Merge branch 'mesa_7_6_branch' of git://anongit.freedesktop.org/mesa/mesa into debian-unstable
Conflicts:
	progs/fp/Makefile
	progs/fp/fp-tri.c
	progs/fp/point-position.c
	progs/fp/tri-depth.c
	progs/fp/tri-depth2.c
	progs/fp/tri-depthwrite.c
	progs/fp/tri-depthwrite2.c
	progs/fp/tri-inv.c
	progs/fp/tri-param.c
	progs/fp/tri-tex.c
	progs/tests/Makefile
	progs/tests/SConscript
	progs/tests/arraytexture.c
	progs/tests/copypixrate.c
	progs/tests/crossbar.c
	progs/tests/drawbuffers.c
	progs/tests/invert.c
	progs/tests/minmag.c
	progs/tests/mipmap_comp.c
	progs/tests/prog_parameter.c
	progs/tests/random.c
	progs/tests/shader_api.c
	progs/tests/stencil_twoside.c
	progs/tests/texcmp.c
	progs/tests/texdown.c
	progs/tests/vao-01.c
	progs/tests/vao-02.c
	progs/trivial/clear-fbo-tex.c
	progs/trivial/clear-fbo.c
	progs/trivial/clear-random.c
	progs/trivial/clear-scissor.c
	progs/trivial/clear.c
	progs/trivial/createwin.c
	progs/trivial/dlist-begin-call-end.c
	progs/trivial/dlist-dangling.c
	progs/trivial/dlist-edgeflag-dangling.c
	progs/trivial/dlist-edgeflag.c
	progs/trivial/dlist-flat-tri.c
	progs/trivial/dlist-mat-tri.c
	progs/trivial/dlist-recursive-call.c
	progs/trivial/dlist-tri-flat-tri.c
	progs/trivial/dlist-tri-mat-tri.c
	progs/trivial/line-clip.c
	progs/trivial/line-cull.c
	progs/trivial/line-flat.c
	progs/trivial/line-stipple-wide.c
	progs/trivial/line-userclip-clip.c
	progs/trivial/line-userclip-nop-clip.c
	progs/trivial/line-userclip-nop.c
	progs/trivial/line-userclip.c
	progs/trivial/line-wide.c
	progs/trivial/line.c
	progs/trivial/lineloop-clip.c
	progs/trivial/lineloop.c
	progs/trivial/linestrip-clip.c
	progs/trivial/linestrip-flat-stipple.c
	progs/trivial/linestrip-stipple-wide.c
	progs/trivial/linestrip-stipple.c
	progs/trivial/linestrip.c
	progs/trivial/point-clip.c
	progs/trivial/point-param.c
	progs/trivial/point-sprite.c
	progs/trivial/point-wide-smooth.c
	progs/trivial/point-wide.c
	progs/trivial/point.c
	progs/trivial/poly-flat-clip.c
	progs/trivial/poly-flat-unfilled-clip.c
	progs/trivial/poly-flat.c
	progs/trivial/poly-unfilled.c
	progs/trivial/poly.c
	progs/trivial/quad-clip-all-vertices.c
	progs/trivial/quad-clip.c
	progs/trivial/quad-degenerate.c
	progs/trivial/quad-flat.c
	progs/trivial/quad-offset-factor.c
	progs/trivial/quad-offset-unfilled.c
	progs/trivial/quad-offset-units.c
	progs/trivial/quad-tex-alpha.c
	progs/trivial/quad-tex-pbo.c
	progs/trivial/quad-unfilled-clip.c
	progs/trivial/quad-unfilled-stipple.c
	progs/trivial/quad-unfilled.c
	progs/trivial/quad.c
	progs/trivial/quads.c
	progs/trivial/quadstrip-cont.c
	progs/trivial/quadstrip-flat.c
	progs/trivial/quadstrip.c
	progs/trivial/readpixels.c
	progs/trivial/tri-alpha-tex.c
	progs/trivial/tri-alpha.c
	progs/trivial/tri-blend-color.c
	progs/trivial/tri-clear.c
	progs/trivial/tri-clip.c
	progs/trivial/tri-cull-both.c
	progs/trivial/tri-dlist.c
	progs/trivial/tri-fbo.c
	progs/trivial/tri-flat-clip.c
	progs/trivial/tri-flat.c
	progs/trivial/tri-fog.c
	progs/trivial/tri-fp-const-imm.c
	progs/trivial/tri-fp.c
	progs/trivial/tri-lit-material.c
	progs/trivial/tri-lit.c
	progs/trivial/tri-multitex-vbo.c
	progs/trivial/tri-orig.c
	progs/trivial/tri-query.c
	progs/trivial/tri-scissor-tri.c
	progs/trivial/tri-square.c
	progs/trivial/tri-stipple.c
	progs/trivial/tri-tex-3d.c
	progs/trivial/tri-tex.c
	progs/trivial/tri-tri.c
	progs/trivial/tri-unfilled-clip.c
	progs/trivial/tri-unfilled-edgeflag.c
	progs/trivial/tri-unfilled-point.c
	progs/trivial/tri-unfilled-smooth.c
	progs/trivial/tri-unfilled-tri-lit.c
	progs/trivial/tri-unfilled-tri.c
	progs/trivial/tri-unfilled-userclip-stip.c
	progs/trivial/tri-unfilled-userclip.c
	progs/trivial/tri-unfilled.c
	progs/trivial/tri-userclip.c
	progs/trivial/tri-z-9.c
	progs/trivial/tri-z-eq.c
	progs/trivial/trifan-flat-clip.c
	progs/trivial/trifan-flat-unfilled-clip.c
	progs/trivial/trifan-flat.c
	progs/trivial/trifan-unfilled.c
	progs/trivial/trifan.c
	progs/trivial/tristrip-clip.c
	progs/trivial/tristrip-flat.c
	progs/trivial/tristrip.c
	progs/trivial/vp-tri-cb-pos.c
	progs/trivial/vp-tri-cb-tex.c
	progs/trivial/vp-tri-invariant.c
	progs/vp/vp-tris.c
	progs/vpglsl/psiz-mul.glsl
	progs/vpglsl/vp-tris.c
2009-12-05 23:36:06 +01:00
Vinson Lee
b2953ee1a6 mesa: Fix array out-of-bounds access by _mesa_TexGenf.
_mesa_TexGenf calls _mesa_TexGenfv, which uses the params argument
as an array.
(cherry picked from commit ca5a7aadb4)
2009-12-05 13:00:35 -08:00
Vinson Lee
d74cd04e61 mesa: Fix array out-of-bounds access by _mesa_TexGeni.
_mesa_TexGeni calls _mesa_TexGeniv, which uses the params argument
as an array.
(cherry picked from commit d55fb7c835)
2009-12-05 12:59:34 -08:00
Vinson Lee
ca8a2150c7 mesa: Fix array out-of-bounds access by _mesa_TexParameterf.
_mesa_TexParameterf calls set_tex_parameterf, which uses the params
argument as an array.
(cherry picked from commit 270d36da14)
2009-12-05 12:50:56 -08:00
Vinson Lee
4071d065c2 mesa: Fix array out-of-bounds access by _mesa_TexParameterf.
_mesa_TexParameterf calls set_tex_parameteri, which uses the params
argument as an array.
(cherry picked from commit a201dfb6bf)
2009-12-05 12:47:40 -08:00
Vinson Lee
1446f30875 progs/samples: Fix memory leak if malloc fails in rgbtoppm.c. 2009-12-05 01:43:29 -08:00
Vinson Lee
412aeeed1c progs/samples: Fix memory leak if fopen fails in rgbtoppm.c. 2009-12-05 01:38:14 -08:00
Vinson Lee
6212c8103a progs/samples: Add rgbtoppm to Makefile. 2009-12-05 01:28:47 -08:00
Vinson Lee
2cd2341ce8 progs/tests: Removed unused variable from texdown.c. 2009-12-05 01:23:05 -08:00
Vinson Lee
d642edd2d1 progs/vpglsl: Assign glGetUniformLocationARB return value to GLint.
The return type of glGetUniformLocationARB is GLint, not GLuint.
2009-12-05 01:11:26 -08:00
Vinson Lee
8d2f3434c5 progs/fp: Redraw upon keypress. 2009-12-04 23:31:39 -08:00
Vinson Lee
fe8e18bcd4 mesa: Fix array out-of-bounds access in _mesa_TexEnvf.
_mesa_TexEnvf calls _mesa_TexEnvfv, which uses the param argument
as an array.
(cherry picked from commit a11d60d14c)
2009-12-04 17:48:30 -08:00
Vinson Lee
4fb5ae7233 progs/util: Fix memory leak if fread returns 0 in CompileShaderFile.
(cherry picked from commit 11905da883)
2009-12-04 17:35:00 -08:00
Vinson Lee
5683d7d43f progs/util: Fix memory leak if fail to load/compile shader
Signed-off-by: Brian Paul <brianp@vmware.com>
(cherry picked from commit c475079ef2)
2009-12-04 17:32:48 -08:00
Vinson Lee
e5bc2a19bd progs/fp: Add tri-inv.c to Makefile. 2009-12-04 17:29:53 -08:00
Coleman Kane
225bc70b77 r300g: use $(MAKE) variable
Fixes bug 24501
2009-12-04 08:45:04 -07:00
Brian Paul
ca7cd3ade0 progs/xdemos: fix some visual/fbconfig logic in glxinfo.c
The fbAttribSingle/Double arrays had wrong GLX_DOUBLEBUFFER values.
We only need to use the glXChooseFBConfig() code when glXChooseVisual()
fails (but I don't know when that would happen).
Other recent commits errantly removed some code in this area too.
2009-12-04 08:09:57 -07:00
Brian Paul
fb83fa26c4 docs: a few more fixes for 7.6.1 2009-12-04 08:09:07 -07:00
Alex Deucher
8d8fd9776e radeon: fix polygon stipple
fixes fdo bug 25354

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2009-12-04 09:52:37 -05:00
Vinson Lee
c74afe0c46 glu/sgi: Fix memory leak in gluBuild2DMipmapLevelsCore.
(cherry picked from commit 808f037660)
2009-12-04 00:14:31 -08:00
Vinson Lee
8df551c46b glu/sgi: Fix memory leak in gluBuild1DMipmapLevelsCore.
(cherry picked from commit 94bcb9f1a4)
2009-12-04 00:14:05 -08:00
Vinson Lee
ea487c6d0b glu/sgi: Fix memory leak in gluBuild2DMipmapLevelsCore.
(cherry picked from commit 0d89f3dc7f)
2009-12-04 00:13:25 -08:00
Vinson Lee
7b5eba453e glu/sgi: Fix memory leak in gluBuild3DMipmapLevelsCore.
(cherry picked from commit f895abbd97)
2009-12-04 00:12:49 -08:00
Vinson Lee
7ed749c062 glu/sgi: Fix memory leak in gluBuild3DMipmapLevelsCore.
(cherry picked from commit 326b66d724)
2009-12-04 00:11:58 -08:00
Vinson Lee
80a3944a4d glu/sgi: Fix memory leak in bitmapBuild2DMipmaps.
(cherry picked from commit 5b925b7daa)
2009-12-04 00:11:02 -08:00
Vinson Lee
6c1fc2b2a5 glu/sgi: Fix memory leak in gluScaleImage3D.
(cherry picked from commit b611f639b4)
2009-12-04 00:10:22 -08:00
Vinson Lee
fe38c16021 glu/sgi: Fix memory leak in gluScaleImage.
(cherry picked from commit a9c540f5de)
2009-12-04 00:09:22 -08:00
Vinson Lee
d23bb22f62 glu: Fix memory leak in __gl_meshMakeEdge.
(cherry picked from commit d3b4c99c70)
2009-12-04 00:07:51 -08:00
Vinson Lee
12a440abfb progs/xdemos: Silence unused value warnings in sharedtex_mt.c.
(cherry picked from commit 8556fad751)
2009-12-04 00:04:38 -08:00
Vinson Lee
4bf96ebdae progs/xdemos: Fix memory leak in pbdemo.c.
(cherry picked from commit e0857962b9)
2009-12-04 00:03:14 -08:00
Vinson Lee
ba3fedf246 progs/xdemos: Add missing break statement in offset.c.
(cherry picked from commit 4ab8dbe593)
2009-12-04 00:01:20 -08:00
Vinson Lee
8350648401 progs/xdemos: Remove duplicate code in glxinfo.c.
(cherry picked from commit a4720a1a32)
2009-12-03 23:59:47 -08:00
Vinson Lee
7324c22024 progs/xdemos: Fix memory leak in glxinfo.c.
(cherry picked from commit f080567f4c)
2009-12-03 23:59:11 -08:00
Vinson Lee
68d206fafa progs/xdemos: Add assert in corender.c.
(cherry picked from commit 66a4ec14c3)
2009-12-03 23:22:47 -08:00
Vinson Lee
69ed1147a8 progs/vp: Fix memory leak in vp-tris.c.
(cherry picked from commit 760cf71572)
2009-12-03 23:20:18 -08:00
Vinson Lee
efb582fde7 progs/tests: Fix memory leak in texdown.c if malloc fails.
(cherry picked from commit e3cfd78969)
2009-12-03 23:17:26 -08:00
Vinson Lee
b210739aad progs/redbook: Fix memory leak in quadric.c.
(cherry picked from commit 47b5f584a6)
2009-12-03 23:12:59 -08:00
Vinson Lee
b1a87a3e0b progs/glsl: Fix memory leak in deriv.c.
(cherry picked from commit 0e783c7d03)
2009-12-03 22:54:35 -08:00
Vinson Lee
25fd168f03 progs/glsl: Change tangentAttrib from GLuint to GLint in bump.c.
tangentAtrrib is assigned the result of glGetAttribLocation.
The assertion 'assert(tangentAtrrib >= 0)' would be a no-op if
tangentAttrib is a GLuint.
(cherry picked from commit b8dcb79c53)
2009-12-03 22:51:43 -08:00
Vinson Lee
b803abbaad progs/demos: Fix memory leak in ray.c.
(cherry picked from commit 6b480dc21d)
2009-12-03 22:49:18 -08:00
Vinson Lee
5820dae4ec progs/demos: Fix memory leak in projtex.c.
(cherry picked from commit ee555e3d69)
2009-12-03 22:44:55 -08:00
Vinson Lee
fc5f07de1a progs/demos: Fix memory leak in ipers.c.
(cherry picked from commit a1afe303de)
2009-12-03 22:38:44 -08:00
Vinson Lee
d245a951f3 progs/demos: Fix memory leak in fslight.c.
(cherry picked from commit aef3218f0b)
2009-12-03 22:36:37 -08:00
Vinson Lee
905e12f3cc gallium/util: Initialize variables in u_pack_color.h.
(cherry picked from commit 36e2074b63)
2009-12-03 17:55:59 -08:00
Vinson Lee
56de7e222e progs/trivial: Redraw upon keypress.
(cherry picked from commit 9553a42f63)
2009-12-03 17:27:24 -08:00
Vinson Lee
34a0b22a74 progs/trivial: Redraw upon keypress.
(cherry picked from commit 3790c6a13b)
2009-12-03 17:25:00 -08:00
Vinson Lee
9e29242331 progs/glsl: Redraw upon keypress.
(cherry picked from commit 881f55236a)
2009-12-03 17:17:24 -08:00
Vinson Lee
a0ac8fc7d8 progs/util: Exit RawImageGetData early if malloc fails.
Prevents a null pointer deference later on.
(cherry picked from commit e26135a744)
2009-12-03 17:14:08 -08:00
Vinson Lee
0a6acecb35 progs/util: Fix memory leak if malloc fails in RawImageOpen.
(cherry picked from commit d36cb2396c)
2009-12-03 17:08:48 -08:00
Vinson Lee
305d4f147e progs/util: Fix memory leak if fopen fails in RawImageOpen.
(cherry picked from commit d9508e8df9)
2009-12-03 17:03:26 -08:00
Vinson Lee
772e004781 progs/util: Fix memory leak if malloc fails in tkRGBImageLoad.
(cherry picked from commit 786d539511)
2009-12-03 16:57:17 -08:00
Vinson Lee
f1172c4030 progs/util: Fix memory leak if LoadRGBImage fails.
(cherry picked from commit 041cd0e110)
2009-12-03 16:24:03 -08:00
Vinson Lee
84de1672d3 progs/util: Fix memory if LoadRGBMipmaps2 fails.
(cherry picked from commit 28b8e4bcd7)
2009-12-03 16:15:22 -08:00
Vinson Lee
4ca8e1680e progs/util: Fix memory leak if LoadYUVImage fails.
(cherry picked from commit 0e790ac353)
2009-12-03 16:03:22 -08:00
Vinson Lee
d6a993135f progs/fp: Redraw upon keypress.
(cherry picked from commit cde6643724)
2009-12-03 15:59:56 -08:00
Vinson Lee
005242f166 prog/tests: Fix MSVC build.
Signed-off-by: Brian Paul <brianp@vmware.com>
(cherry picked from commit 9c3197ef0a)
2009-12-03 15:53:13 -08:00
Vinson Lee
d3208678c2 progs/tests: fix MSVC build.
Signed-off-by: Brian Paul <brianp@vmware.com>
(cherry picked from commit a8ed066858)
2009-12-03 15:50:36 -08:00
Vinson Lee
97cbf4943a progs/tests: Fix MSVC build.
(cherry picked from commit 50e113e375)
2009-12-03 15:45:18 -08:00
Vinson Lee
a99bf51bc8 progs/tests: Fix MSVC build.
(cherry picked from commit 952bf63e2c)
2009-12-03 15:35:10 -08:00
José Fonseca
28474e1225 progs/tests: Use rand() instead of random().
Forgot these on previous commit.
(cherry picked from commit 166957abeb)
2009-12-03 15:34:38 -08:00
José Fonseca
bb6e3af939 progs/tests: Use rand() instead of random().
More portable. Same implementation on Linux.
(cherry picked from commit 699260b195)
2009-12-03 15:32:45 -08:00
Vinson Lee
a38776419b progs/tests: Fix MSVC build.
(cherry picked from commit f7455ad7af)
2009-12-03 15:29:01 -08:00
Vinson Lee
791b754687 prog/tests: Fix MSVC build.
(cherry picked from commit 60b6c74583)
2009-12-03 15:24:43 -08:00
Vinson Lee
89e747920f prog/tests: Fix MSVC build.
(cherry picked from commit 96fd13c1a0)
2009-12-03 15:15:12 -08:00
Vinson Lee
5a25adb646 progs/tests: fix MSVC build.
(cherry picked from commit 9c778a90ea)
2009-12-03 15:11:25 -08:00
Vinson Lee
3910e88ebf prog/tests: Fix MSVC build.
(cherry picked from commit ea862ec8ff)
2009-12-03 15:05:44 -08:00
Alex Deucher
2b5618fc5b r200: fix polygon stipple
fixes fdo bug 25354

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2009-12-03 11:20:40 -05:00
Vinson Lee
c3b7f93e02 scons: Add Mac OS to target platform list.
(cherry picked from commit 2c307c7750)
2009-12-02 20:33:32 -08:00
Vinson Lee
235c0c8134 progs/vpglsl: Fix psiz-mul.glsl compilation error on Mac OS.
(cherry picked from commit b98db7bf69)
2009-12-02 20:28:54 -08:00
Vinson Lee
0a107d36c2 progs/glsl: Fix trirast GLSL compilation errors on Mac OS.
(cherry picked from commit 4b3ec2acf2)
2009-12-02 20:20:12 -08:00
Vinson Lee
b094683e7c progs/glsl: Fix noise GLSL compilation error on Mac OS.
(cherry picked from commit 0d31990b47)
2009-12-02 20:16:51 -08:00
Vinson Lee
592c8522a2 demos/glsl: Add missing break statement to noise test.
(cherry picked from commit 7dfea5c072)
2009-12-02 20:16:41 -08:00
Vinson Lee
8f4d3613da progs/glsl: Fix multinoise GLSL compilation errors on Mac OS.
(cherry picked from commit d4dc2e30da)
2009-12-02 20:06:20 -08:00
Vinson Lee
9ed77d12b1 progs/glsl: Add missing break statement in multinoise.c.
(cherry picked from commit 43080e40aa)
2009-12-02 20:06:11 -08:00
Vinson Lee
832593772d progs/glsl: Fix mandelbrot GLSL compilation error on Mac OS.
(cherry picked from commit 04442841fb)
2009-12-02 19:55:48 -08:00
Vinson Lee
2a5cd95e24 progs/glsl: Include local headers before installed headers during compilation.
Fixes compilation errors on platforms with insufficient older installed
GL headers.
(cherry picked from commit d17af7d1e1)
2009-12-02 19:39:25 -08:00
Brian Paul
ccea09cd3a progs/glsl: minor Makefile clean-ups
(cherry picked from commit 4df2f7af5e)
2009-12-02 19:39:11 -08:00
Vinson Lee
67a0628ab2 progs: Ignore Mac OS dSYM directories.
(cherry picked from commit a420056750)
2009-12-02 15:22:34 -08:00
Brian Paul
908a3e56cc cell: added tex_usage param to xm_surface_buffer_create() 2009-12-02 09:31:26 -07:00
Brian Paul
ba97b98842 progs/demos: remove unused glFogCoordPointer_ext var 2009-12-01 12:23:07 -07:00
Tom Fogal
b9f4a0bd2b Simplify hackery added to fix AIX build.
Borrow an idiom from the GNU build system which can handle `for'
loops over empty lists.
2009-12-01 10:27:27 -08:00
Ian Romanick
d8da270a2b intel: Remove GL_NV_point_sprite from extension list
i830 does not (and cannot!) support the any of the non-default
GL_POINT_SPRITE_R_MODE_NV settings.  i915 and i965 could, but
currently do not.  In both cases it would require mucking about with
the fragment shader.
2009-12-01 10:25:44 -08:00
Ian Romanick
910aaed4da mesa: set version string to 7.6.1-rc2 2009-11-30 17:55:21 -08:00
Ian Romanick
587a52e95b i915: Actually put i915PointParameterfv in the driver function table. Duh. 2009-11-30 12:43:12 -08:00
Ian Romanick
533b766007 i915: Fallback bit define missed on previous commit 2009-11-29 17:49:55 -08:00
Ian Romanick
718f31b830 i915: Round point sizes instead of truncate. 2009-11-29 17:43:38 -08:00
Ian Romanick
d8d49716cf i915: Enable point sprite coordinate generation
Support still isn't completely correct, but it's better.  piglit
point-sprite now passes.  However, glean's pointSprite test fails.  In
that test the texture on the sprite is somehow inverted as though
GL_POINT_SPRITE_COORD_ORIGIN were set to GL_LOWER_LEFT.  i915 hardware
shouldn't be able to do that!

I believe there are also problems when not all texture units have
GL_COORD_REPLACE set.  The hardware enable seems to be all or nothing.

Fixes bug #25313.
2009-11-29 17:40:02 -08:00
Ian Romanick
0528f40e3b Improve implementation of GL_POINT_SPRITE_COORD_ORIGIN errors
This enum is only supported for OpenGL 2.0.  If a driver supports
OpenGL 1.4 and GL_ARB_point_sprite, using this enum should generate an
error.  This is important because, for example, i915 and i830 can
support GL_ARB_point_sprite, but they cannot support
GL_POINT_SPRITE_COORD_ORIGIN.

This commit just removes the check for NV_point_sprite, which is
completely wrong, and add some comments describing what the code
should do.  I don't see an easy way to check for version >= 2.0 from
inside Mesa.  Perhaps we should add an extension
GL_MESA_point_sprite_20 (like Intel's old GL_EXT_packed_pixels_12) to
indicate that this added bit of functionality is available.

Also note that glean's pointSprite test only checks for
GL_ARB_point_sprite before trying to use
GL_POINT_SPRITE_COORD_ORIGIN.  Naturally, that fails on
non-2.0 implementations (i.e., Mac OS X on GMA 950).
2009-11-25 16:31:28 -08:00
Dave Airlie
e4c5fe52c9 radeon: fix context destroy needing lock for flushing.
Thanks to Intel code which I've just stolen pretty much as usual.

This fixes fdo bug 22851 which is a dri1 regression since rewrite.

Tested by: fpiobaf (Fabio) on #radeon
Signed-off-by: Dave Airlie <airlied@redhat.com>
2009-11-25 20:29:56 +10:00
Ian Romanick
b12ca6b87b i915: Initialize Length and Offset fields when mapping a buffer object
This fixes an assertion failure in _mesa_MapBufferARB.

Fixes bugzilla #25253.
2009-11-23 23:14:49 -08:00
Ian Romanick
da0883114b shaderutil: Fix detection of shaders
Check for versions >= 2.0 (because some drivers return 3.0), and return
GL_FALSE if shaders are not detected.
2009-11-23 18:33:50 -08:00
Jakob Bornecrantz
a11750218f autoconf: Fix case for not having package
(cherry picked from commit 5c4bdbd825)
2009-11-23 20:09:36 +01:00
Michel Dänzer
601edbef17 Fix the DRI swrast driver for big endian platforms.
Too bad I didn't realize earlier how easy this could be...

Fixes http://bugs.freedesktop.org/show_bug.cgi?id=22767 .
2009-11-23 19:56:37 +01:00
Brian Paul
3128d65fd7 docs: document fixes for AIX 2009-11-19 09:35:01 -07:00
Tom Fogal
7593bcb6ec gl: added mangled glXGetProcAddressARB define
Signed-off-by: Brian Paul <brianp@vmware.com>
2009-11-19 09:33:32 -07:00
Tom Fogal
8f24e863c3 progs: Fix quoting issue with empty set of PROGRAM_DIRS.
Quotes are important to make sure the argument to test -n really
is the empty string, but that requires stringifying PROGRAM_DIRS.

Signed-off-by: Brian Paul <brianp@vmware.com>
2009-11-19 09:26:39 -07:00
Tom Fogal
4e6e2462ea mesa: define 32bit byteswap for AIX.
Fixes `xlib' driver build on AIX.

Signed-off-by: Brian Paul <brianp@vmware.com>
2009-11-19 09:18:51 -07:00
Brian Paul
5117725fd0 docs: removed VC6/7 project files 2009-11-19 09:07:34 -07:00
Brian Paul
e16b59df42 docs: update news file for 7.6.1 release 2009-11-19 09:07:17 -07:00
Brian Paul
2a1505b42e docs: remove VC6/7 project file info 2009-11-19 09:01:48 -07:00
Brian Paul
cba614bd88 mesa: omit VC6, VC7 project files from tarballs
Only VC8 project file is known to work.
2009-11-19 09:00:16 -07:00
Brian Paul
3bcf2d49f3 windows: remove old VC6 project files directory
Very out of date, according to Karl Schultz.
2009-11-19 08:57:39 -07:00
Alex Deucher
fe5c46546e r600: disable compressed texture support
It's not implemented yet.  fixes fdo bug 24047
2009-11-18 11:51:20 -05:00
Alex Deucher
c5add6a468 docs: Add note about r600 2009-11-18 11:32:55 -05:00
Alex Deucher
13b5a624b1 Revert "radeon: Fix legacy bo not to reuse dma buffers before refcount is 1."
This reverts commit 284a7af274.

This breaks kde desktop effects.  See fdo bug 24131
2009-11-18 11:27:36 -05:00
Brian Paul
027abddf4f mesa: set version string to 7.6.1-rc1 2009-11-18 08:08:25 -07:00
Brian Paul
d449c07b8b xorg/st: fixup builds against later dpms headers.
(cherry picked from master, commit e9d6ab72be)
2009-11-18 08:07:56 -07:00
Brian Paul
2b3ea2be90 docs: i965 clipping fix 2009-11-17 15:53:27 -07:00
Eric Anholt
514544f373 i965: Fix Ironlake shadow comparisons.
The cube map array index arg is always present.
2009-11-12 11:41:39 -08:00
Eric Anholt
5f305b1db9 i965: Fix VBO last-valid-offset setup on Ironlake.
Instead of doing math based on the (broken for VBO && offset != 0)
input->count number, just use the BO size.  Fixes assertion failure in ETQW.
2009-11-12 11:41:39 -08:00
Roland Scheidegger
ab12e764ba i965: fix EXT_provoking_vertex support
This didn't work for quad/quadstrips at all, and for all other primitive types
it only worked when they were unclipped.
Fix up the former in gs stage (could probably do without these changes and
instead set QuadsFollowProvokingVertexConvention to false), and the rest in
clip stage.
2009-11-11 17:57:56 -08:00
Eric Anholt
1220aba99b i965: Fix VS constant buffer value loading.
Previously, we'd load linearly from ParameterValues[0] for the constants,
though ParameterValues[1] may not equal ParameterValues[0] + 4.  Additionally,
the STATE_VAL type paramters didn't get updated.

Fixes piglit vp-constant-array-huge.vpfp and ET:QW object locations.

Bug #23226.
2009-11-10 14:44:40 -08:00
Eric Anholt
e5ffb9f5ea i965: Unalias src/dst registers for SGE and friends.
Fixes piglit vp-sge-alias test, and the googleearth ground shader.  \o/

Bug #22228
(cherry picked from commit 56ab92bad8)
2009-11-10 14:44:39 -08:00
Eric Anholt
23a4a6727e i965: Allow use of PROGRAM_LOCAL constants in ARB_vp.
Fixes piglit arl.vp.
(cherry picked from commit d52d78b4bc)
2009-11-10 14:44:39 -08:00
Alex Deucher
74ef3207d8 r600: don't emit htile regs
These are needed for HiZ which is not currently used and
the _BASE reg requires a reloc which is not currently supported
in the drm.
2009-11-09 12:27:27 -05:00
Ian Romanick
2cda507fa1 prog parse: Handle GL_VERTEX_PROGRAM_ARB in glLoadProgramNV 2009-11-07 15:54:33 -08:00
Ian Romanick
6d2ceda780 prog parse: Handle GL_VERTEX_PROGRAM_NV in glProgramStringARB
Handle both NV vertex programs and NV vertex state programs passed to
glProgramStringARB.
2009-11-07 15:54:33 -08:00
Ian Romanick
289db82b2d prog parse: Handle GL_FRAGMENT_PROGRAM_ARB in glLoadProgramNV 2009-11-07 15:54:32 -08:00
Ian Romanick
7452877cf6 prog parse: Handle GL_FRAGMENT_PROGRAM_NV in glProgramStringARB 2009-11-07 15:54:32 -08:00
Ian Romanick
26d2ce0a09 GLX: Change GLX client vendor string to "Mesa Project and SGI"
This change allows a certain closed-source browser plug-in to work
with open-source drivers.
2009-11-06 14:52:49 -08:00
Ian Romanick
9348ac03ce ARB prog parser: Regenerate parser from previous commits. 2009-11-06 10:46:23 -08:00
Ian Romanick
d8e256f923 ARB prog parser: Release old program string in _mesa_parse_arb_{fragment,vertex}_program
The program structure passed to _mesa_parse_arb_program is just a
place holder.  The stings that actually need to be released are only
known to the functions calling _mesa_parse_arb_program, so they should
be freed there.
2009-11-06 10:46:22 -08:00
Ian Romanick
301a9b7e28 ARB prog parser: Release strings returned from the lexer that don't need to be kept 2009-11-06 10:46:22 -08:00
Ian Romanick
1c7337d46e Revert "ARB prog parser: Fix epic memory leak in lexer / parser interface"
This reverts commit 93dae6761b.

This change was completely broken when the parser uses multiple
strings in a single production.  It would be nice if bug fixes could
initially land somewhere other than the stable branch.
2009-11-06 10:46:22 -08:00
Brian Paul
63191bd244 xmesa: pass pixmap to clip_for_xgetimage()
The code was assuming ctx->DrawBuffer == ctx->ReadBuffer.
Passing the pixmap is simpler and better.
Fixes a potential segfault.
2009-11-05 16:48:52 -07:00
Brian Paul
7c623905bc mesa: added cast to silence warning 2009-11-04 17:58:43 -07:00
Brian Paul
1c3f7ab74c vbo: fix out-of-bounds array access
The exec->vtx.inputs[] array was being written past its end.  This was
clobbering the following vbo_exec_context::eval state.  Probably not noticed
since evaluators and immediate mode rendering don't happen at the same time.

Fixed the loop in vbo_exec_vtx_init().
Changed the size of the vbo_exec_context::vtx.arrays[] array.
Added a bunch of debug-build assertions.

Issue found by Vinson Lee.
2009-11-04 17:51:28 -07:00
Brian Paul
bc4ad7c2ae mesa: fix broken pack_histogram() case for GLhalf 2009-11-04 17:42:30 -07:00
Brian Paul
76aa0c0fd3 mesa: silence warning from gcc 4.4.1 2009-11-04 17:42:01 -07:00
Vinson Lee
60c328db2d progs/tests: Fix MSVC build.
Signed-off-by: Brian Paul <brianp@vmware.com>
2009-11-04 15:56:14 -07:00
Alan Hourihane
f1b91ccc08 Fix YTILE spantmp functions 2009-11-04 15:26:38 +00:00
Vinson Lee
51f7763c00 glslcompiler: Fix Mac OS build.
Signed-off-by: Brian Paul <brianp@vmware.com>
2009-11-04 07:14:55 -07:00
Brian Paul
6eb71519f7 mesa: (GLint64) casts in get.c to silence Visual Studio warnings
Revised version of a patch from Karl Schultz.
2009-11-03 16:13:24 -07:00
Brian Paul
c5106339d3 docs: fix 7.6 build with Visual Studio 2009-11-03 16:12:02 -07:00
Karl Schultz
804d367a47 windows: updated VC8 project file
Signed-off-by: Brian Paul <brianp@vmware.com>
2009-11-03 16:09:29 -07:00
Karl Schultz
077eb0d81c windows: remove old entrypoints from mesa.def file
Signed-off-by: Brian Paul <brianp@vmware.com>
2009-11-03 16:08:46 -07:00
Karl Schultz
e713a95c96 mesa: added GLAPIENTRY keywords for sync object functions
Signed-off-by: Brian Paul <brianp@vmware.com>
2009-11-03 16:05:12 -07:00
Marek Olšák
a0cd2b7029 st/mesa: clip pixels in draw_stencil_pixels to avoid crash
Signed-off-by: Brian Paul <brianp@vmware.com>
2009-11-03 09:48:04 -07:00
Brian Paul
e60ebebb39 st/mesa: don't use util_blit_pixels_writemask() for depth or depth/stencil
util_blit_pixels_writemask() only works for color formats at this time.
Also, it might never work for depth/stencil surfaces since we can't get
handle stencil values in a fragment shader.

Fixes glCopyTexSubImage(GL_DEPTH_COMPONENT).
2009-11-03 09:48:04 -07:00
Brian Paul
0197348641 st/mesa: fix tests for depth and depth/stencil texture formats 2009-11-03 09:48:04 -07:00
Vinson Lee
e055665752 glx: Fix memory leak if XF86DRICreateDrawable() fails
Signed-off-by: Brian Paul <brianp@vmware.com>
2009-11-02 12:35:47 -07:00
Chow Loong Jin
35506dec67 Add --with-dri-searchpath argument
* Add an extra argument to configure which allows for specifying
  different DRI driver search paths to libGL (FDO #24766)

Signed-off-by: Dan Nicholson <dbn.lists@gmail.com>
2009-10-30 06:00:13 -07:00
Brian Paul
02b9fb9c80 progs/tests: fixes for drawbuffers.c
Disable GL_DEPTH_TEST before glDrawPixels.
Show color buffer 0 on left, color buffer 1 on right.
2009-10-29 14:46:35 -06:00
Brian Paul
635ea87374 progs/tests: added test for GL_EXT_texture_compression_s3tc support 2009-10-28 21:50:51 -06:00
Vinson Lee
96128fdf2f mesa: Fix memory leak if we run out of memory
Signed-off-by: Brian Paul <brianp@vmware.com>
2009-10-28 17:59:49 -06:00
Vinson Lee
c0a61c8442 intel: Fix memory leak in case of renderbuffer bad format
Signed-off-by: Brian Paul <brianp@vmware.com>
2009-10-28 13:09:44 -06:00
Brian Paul
0219cd0961 mesa: remove unneeded #includes 2009-10-28 11:13:21 -06:00
Brian Paul
5e3b2baae7 mesa: include imports.h to silence warning 2009-10-28 11:11:30 -06:00
Vinson Lee
a7d0665c00 intel: Fix memory leak in event of mip tree allocation failure
Signed-off-by: Brian Paul <brianp@vmware.com>
2009-10-28 11:10:14 -06:00
Ian Romanick
93dae6761b ARB prog parser: Fix epic memory leak in lexer / parser interface
Anything that matched IDENTIFIER was strdup'ed and returned to the
parser.  However, almost every case of IDENTIFIER in the parser just
dropped the returned string on the floor.  Every swizzle string, every
option string, every use of a variable, etc. leaked memory.

Create a temporary buffer in the parser state (string_dumpster and
dumpster_size).  Return strings from the lexer to the parser in the
buffer.  Grow the buffer as needed.  When the parser needs to keep a
string (i.e., delcaring a new variable), let it make a copy then.

The only leak that valgrind now detects is /occasionally/ the copy of
the program string in gl_program::String is leaked.  I'm not seeing
how. :(
2009-10-27 17:06:18 -07:00
Ian Romanick
8df9587d68 ARB prog parser: Don't leak program string
The program string is kept in the program object.  On the second call
into glProgramStringARB the previous kept string would be leaked.
2009-10-27 17:06:18 -07:00
Ian Romanick
0f255d1956 ARB prog parser: Don't leak symbol table header structures 2009-10-27 17:06:18 -07:00
Eric Anholt
2643a7ba29 intel: Fix flipped condition in ARB_sync GetSYnciv(GL_SYNC_STATUS).
Bug #24435
(cherry picked from commit d56125a298)
2009-10-27 16:59:03 -07:00
Brian Paul
b7eea8c616 intel: added region draw_x/y offsets in x/y_tile_swizzle() funcs
This fixes the second part of bug 23552.
2009-10-27 17:35:30 -06:00
Brian Paul
498fcfd315 progs/tests: added new blitfb.c test
Tests glBlitFramebuffer() between two texture/renderbuffer surfaces.
In particular, blit from level[1] of a cube map face to a 2D texture.

Used to find/fix bug in intel do_copy_texsubimage().
See commit aef1ab1073f3e30d699b99dae17518ed48b57c72
2009-10-27 16:46:20 -06:00
Brian Paul
22575abdec intel: fix src offset bug in do_copy_texsubimage()
Use src->draw_offset intead of zero.  Zero usually worked, except when
the src renderbuffer is actually a texture mipmap level higher than zero.
Fixes progs/test/blitfb.c test.
2009-10-27 16:46:20 -06:00
Brian Paul
517ae7a3b6 glsl: fix memory leak
A slightly modified version of a patch from Vinson Lee.
2009-10-27 16:29:15 -06:00
Eric Anholt
70b17db918 i915: Fix driver for the miptree x/y offset changes.
Bug #24734.
2009-10-27 10:27:15 -07:00
Brian Paul
43dc91f8bb i965: be clear that the Fallback field is a boolean, not a bitfield 2009-10-27 09:31:53 -06:00
Brian Paul
f9e334cb32 Revert "i965: fix hacked Fallback usage in brw_prepare_vertices()"
This reverts commit 8810b8f671.

It turns out the i965 driver uses the intel->Fallback field as a boolean,
not as a bitmask.  The intelFallback() function is a no-op in the i965
driver.  It would have been nice if there were some comments about this.
I'll fix that next...
2009-10-27 09:31:53 -06:00
Vinson Lee
42732611d3 draw: Fix memory leak.
This would only be hit if we got and invalid index_size.
2009-10-27 09:14:29 -06:00
Brian Paul
0a47631849 docs: document Intel glBitmap fixes 2009-10-26 10:58:47 -06:00
Brian Paul
48dad9c93f intel: fix GL state bugs in intel_texture_bitmap()
Need to push texture state and polygon state too.
Fixes rendering glitches seen in progs/demos/engine when changing
the rendering mode (wireframe, texture modes).
This makes bitmap rendering a little slower, unfortunately.
2009-10-26 10:44:22 -06:00
Brian Paul
dc8b139aa2 mesa: remove FBO texture depth/stencil test
The texture format should not be checked until validation time since
the format might be changed by a subsequent glTexImage() call.
2009-10-23 18:22:41 -06:00
Brian Paul
0acb057ad1 mesa: fix broken _mesa_str_checksum() 2009-10-23 16:36:15 -06:00
Eric Anholt
2d17dbfb53 intel: Keep track of x,y offsets in miptrees and use them for blitting.
By just using offsets, we confused the hardware's tiling calculations,
resulting in failures in miptree validation and blit clears.

Fixes piglit fbo-clearmipmap.

Bug #23552. (automatic mipmap generation)
2009-10-23 14:12:24 -07:00
Brian Paul
b01937a3c9 progs/tests: print requested/internal format info 2009-10-23 14:52:10 -06:00
Brian Paul
96d7d66dff docs: document updated GL extension header files 2009-10-23 14:49:47 -06:00
Brian Paul
5c0dc902e7 gl: updated wglext.h to version 17 2009-10-23 14:49:26 -06:00
Brian Paul
559da98c2b gl: updated glxext.h to version 25 2009-10-23 14:49:26 -06:00
Brian Paul
9df9696f6d gl: updated glext.h to version 56 2009-10-23 14:49:20 -06:00
Brian Paul
ff3f09a7fe docs: document cell, glGetTexLevelParameter() fixes 2009-10-23 14:45:44 -06:00
Brian Paul
cd62b4f00a mesa: fix GL_TEXTURE_INTERNAL_FORMAT query for compressed formats
Need to return the actual compressed format when the user originally
requested a generic compressed format.
2009-10-23 14:45:44 -06:00
Brian Paul
9528dc6ed8 mesa: added _mesa_compressed_format_to_glenum()
Maps a compressed MESA_FORMAT_x to correspding GLenum.  Needed for
querying a texture's actual format when a generic format was originally
requested.
2009-10-23 14:45:44 -06:00
Brian Paul
5e4f5e41a4 mesa: change s3tc vs. fxt1 priority when choosing compressed formats 2009-10-23 14:45:44 -06:00
Ian Romanick
dd24501665 ARB prog parser: Fix parameter array size comparison
Array indexes are invalid when >= the maximum, but array sizes are
only in valid when > the maximum.  This prevented programs from
declaring a single maximum size array.

See the piglit vp-max-array test.
2009-10-22 19:20:15 -07:00
Brian Paul
55058652b8 intel: flush old context before binding new context
Per the GLX spec, when changing rendering contexts, the old context
should first be flushed.
2009-10-22 18:33:26 -06:00
Brian Paul
5e6a6a2719 glx: don't destroy context immediately if it's currently bound
According to the GLXDestroyContext() man page, the context should not
immediately be destroyed if it's bound to some thread.  Wait until it's
unbound to really delete it.  The code for doing the later part is
already present in MakeContextCurrent() so no change was needed there.
2009-10-22 18:20:28 -06:00
Brian Paul
4837e01bcd mesa: code refactoring- new _mesa_finish(), _mesa_flush() 2009-10-22 18:16:10 -06:00
Brian Paul
61a96a2ac7 progs/xdemos: fix command line flag typo 2009-10-22 17:11:59 -06:00
Brian Paul
8810b8f671 i965: fix hacked Fallback usage in brw_prepare_vertices()
Setting intel->Fallback = 1 clobbered any fallback state that was already
set.  Not sure where this hack originated (the git history is a little
convoluted).  Define and use a new BRW_FALLBACK_DRAW bit instead.  This
shouldn't break anything and could potentially fix some bugs (but no
specific ones are known).
2009-10-22 16:52:59 -06:00
Brian Paul
c24466c34e intel: define INTEL_FALLBACK_DRIVER for drivers 2009-10-22 16:52:59 -06:00
Brian Paul
ea659f8917 intel: Fallback field is a bitmask, use GLbitfield 2009-10-22 16:52:59 -06:00
Brian Paul
f9bbbe5803 i965: remove unused brw_context::tmp_fallback field 2009-10-22 16:52:59 -06:00
Brian Paul
2f7abf5c04 i965: remove unused BRW_FALLBACK_TEXTURE bit
The value was probably wrong too.
It was the same as INTEL_FALLBACK_DRAW_BUFFER.
2009-10-22 16:52:59 -06:00
Andre Maasikas
869e20bcb7 r600: set barrier for tex inst if dst is used earlier, might overwrite it otherwise 2009-10-22 09:45:11 +03:00
Andre Maasikas
a88c9296cb r600: need to export something from PS
Also avoids empty shader for "END" - seems to be somewhat valid fp
 Maybe this can be done differently in the future (fake FRAG_RESULT_COLOR
 already in Map_Fragment_Program() or is there a way to program the chip
 to not hang in case of no exports.
2009-10-22 09:44:03 +03:00
Andre Maasikas
b86302283b r600: add beginnings of ARL instruction 2009-10-22 09:42:42 +03:00
Brian Paul
5283a3fb25 progs/trivial: check if GL_ARB_occlusion_query is supported 2009-10-20 16:22:03 -06:00
Marc Dietrich
4b2cf92ad9 cell: fix compilation on cell
s/LERP/LRP/
2009-10-20 11:17:12 -06:00
Vinson Lee
ca940a73a7 mesa: Fix Mac OS build.
strtod_l needs the xlocale.h header on Mac OS. It's possible other
non-Linux OSes would need this header too.
2009-10-20 10:43:49 -06:00
Mathias Fröhlich
16e21191e2 r300: fix texture size handling with size > 2048
The in kernel texture check fails because of both
bit11 flags being set on 16x16 textures. It tuns out
that these bits are still set and not cleared in the
pp_txpitch field of the texture. The attached patch
at least helps for this case on my machine. It clears
the bit 11 from the pitch field if the texture is smaller
and masks out that hight bits on the conventional width
and height field.

Fixes bug 24584
2009-10-19 11:47:21 -04:00
Robert Noland
8123180ea6 r600: Fix size calculation for 24 bit depth
size was being calculated based on 3 bytes per pixel with 24 bit depth
instead of 4 bytes.  This caused corruption in the bottom 25% of objects.
This finishes fixing the menu/text corruption in compiz/kde4.

Signed-off-by: Robert Noland <rnoland@2hip.net>
2009-10-19 11:09:10 -04:00
Maciej Cencora
3594b53c01 r300: fix vertex program parameters limits 2009-10-16 20:21:17 +02:00
Brian Paul
946bc9aa42 docs: document GLSL float parsing bug fix 2009-10-16 07:38:39 -06:00
Brian Paul
89b31c9619 mesa: use C locale for _mesa_strtod()
_mesa_strtod() is used for shader/program parsing where the decimal
point character is always '.'  Use strtod_l() with a "C" locale to
ensure correct string->double conversion when the actual locale uses
another character such as ',' for the decimal point.

Fixes bug 24531.
2009-10-16 07:36:50 -06:00
Owen Taylor
3f30b0709b Use the right pitch when rendering to a texture
We need to get the pitch from the texture level we are rendering to,
rather than just using the base texel width.
2009-10-15 11:33:08 -04:00
Robert Noland
16c6a3b71e r600: FRAG_ATTRIB_WPOS and FRAG_ATTRIB_FOGC appear to be supported.
Report unsupported attributes while I'm here.

Signed-off-by: Robert Noland <rnoland@2hip.net>
2009-10-15 11:29:52 -04:00
Robert Noland
a176b1c5d8 r600: cleanup in r600_cs_process_relocs().
Signed-off-by: Robert Noland <rnoland@2hip.net>
2009-10-15 11:29:45 -04:00
Robert Noland
e5d6450c2c radeon: return EINVAL for 0 length buffers.
Signed-off-by: Robert Noland <rnoland@2hip.net>
2009-10-15 11:29:35 -04:00
Andre Maasikas
22a0029a68 r600: fix tfp1 bo size
Setting the wrong bo size resulting in an incomplete
read cache flush when reading the texture.  This fixes the
compiz text corruption.

[agd5f: take hw pitch alignment into account]
2009-10-15 11:24:49 -04:00
Andre Maasikas
a3fec14101 r600: implement ProgramStringNotify
need this to properly test with piglit/glean vert/fragprog tests
copied mostly from r300, many thanks to osiris, nha, airlied, others...
2009-10-15 11:22:18 -04:00
Andre Maasikas
606becc7f3 r600: LIT dst.y gets value from src.x
seems I overlooked this when removing hardcoded swizzles for this
one previously
2009-10-15 11:21:15 -04:00
Andre Maasikas
74c31e5d05 r600: DPH adds w comp of second operand, so set first one to 1 instead 2009-10-15 11:20:04 -04:00
Andre Maasikas
95851d8cb2 r600: fixup KIL instruction a bit
- KILLGT takes 2 arguments
- arb KIL has no dst register
- add TODO about clause ending but currently piglit fp-kil passes and
  does not hang the card
2009-10-15 11:18:53 -04:00
Andre Maasikas
bf68e54a4d r600: use CB_TARGET_MASK instead of CB_SHADER_MASK for setting color mask
makes blend functions work better

Signed-off-by: Dave Airlie <airlied@linux.ie>
2009-10-15 11:17:09 -04:00
Andre Maasikas
5101215a64 r600: user correct alpha blend factor
Signed-off-by: Dave Airlie <airlied@linux.ie>
2009-10-15 11:16:53 -04:00
Andre Maasikas
f7285bdffc r600: clear position enable bit when when wpos is not used by FP
Makes doom3 alot nicer..
2009-10-15 11:16:41 -04:00
Brian Paul
6f8b4d9e36 mesa: regenerated lex.yy.c w/ _mesa_strtod() 2009-10-15 08:59:13 -06:00
Neil Roberts
269f16cd96 mesa: Use _mesa_strtod in the lexer for assembly shaders
See bug 24531.
2009-10-15 08:57:07 -06:00
Brian Paul
31f7e8efb2 progs/Makefile: remove extra quoting
This reverts part of commit 115edf24a9 and
fixes the error: "/bin/sh: line 0: test: too many arguments".
2009-10-14 09:37:53 -06:00
Tom Fogal
115edf24a9 Fix build when PROGRAM_DIRS is empty.
SUBDIRS just takes PROGRAM_DIRS value.  If PROGRAM_DIRS gets set
to the empty string (as can happen when building only OSMesa), a
'for' loop will lack anything to iterate over, causing a parse
error.

This fixes the issue by making sure SUBDIRS is the null string
when PROGRAM_DIRS is, and wrapping the for loops in if's, causing
them only to execute if there are directories to iterate over.
2009-10-13 16:22:09 -06:00
Tom Fogal
9282edfaa0 ac: Fix AIX shared library builds.
AIX uses ".a" for both static and shared library extensions.
2009-10-13 16:22:06 -06:00
Eric Anholt
f3be27c0cf i965: Fix the last valid address setting for the index buffer.
Again, last valid address, not first invalid address.  Fixes regression
in 255e5be265 that the kernel now catches
and caused piglit draw_elements_base_vertex to fail.
2009-10-11 11:21:03 -07:00
Eric Anholt
a82da7fa26 i965: Fix the bounds emitted in the vertex buffer packets.
It's the address of the last valid byte, not the address of the first
invalid byte.

This should also fix problems with rendering with the new sanity checks in
the kernel.
2009-10-11 11:21:03 -07:00
Brian Paul
768481ed40 softpipe: revert 564df9dc5f
This change silenced valgrind warnings but broke progs/tests/drawbuffers.
The problem is we don't know the surface's state when we start caching it
(it may or may not be initialized/cleared/etc).  So "clearing" it here was
presumptuous.  Leaving the code in place (but disabled) for reference and
when using valgrind.

Fixes bug 24401
2009-10-10 09:18:14 -06:00
Alex Deucher
194ede4bf9 radeon: fix scissor regression
fixes fdo bug 24248
2009-10-09 15:44:32 -04:00
Brian Paul
2738681e84 docs: fix aux buffer bug 24426 2009-10-09 13:23:07 -06:00
Brian Paul
6164f1fe79 st/mesa: create aux buffers according to visual
Fixes bug 24426 for gallium.
2009-10-09 13:22:15 -06:00
Brian Paul
ce64e063a8 mesa: fix incorrect assertion in _mesa_add_aux_renderbuffers()
Fixes bug 24426.
2009-10-09 13:22:00 -06:00
Brian Paul
f7fb30f03b mesa: regenerated gl_mangle.h file 2009-10-08 09:19:42 -06:00
Brian Paul
ee3fbe7067 gallium/xlib: call XQueryExtension() in glXQueryExtension()
See bug 24321.
2009-10-07 14:43:27 -06:00
Brian Paul
9f002e4aaa mesa/xlib: call XQueryExtension() in glXQueryExtension()
See bug 24321.
2009-10-07 14:42:16 -06:00
Brian Paul
7dd2c0afd6 mesa: don't need to free textures, VBOs, etc. in _mesa_meta_free()
They're freed by the normal context deallocation code.
Fixes Blender crash, bug 24185.
2009-10-07 14:07:49 -06:00
Nicolai Hähnle
9fde81bb20 shader_api: Fix bounds checking of glUniform and glUniformMatrix
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
Reviewed-by: Ian Romanick <ian.d.romanick@intel.com>
2009-10-07 20:36:23 +02:00
Nicolai Hähnle
ae351599f1 prog_parameter: Document the fact that Size may be > 4
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-10-07 20:33:55 +02:00
Brian Paul
cdcd9da480 docs: fix glXQueryDrawable() bugs 2009-10-07 09:41:38 -06:00
Brian Paul
c3eef6021a mesa/xlib: fix glXQueryDrawable() bugs, see bug 24320 2009-10-07 09:41:38 -06:00
Brian Paul
0526100a5c gallium/xlib: fix glXQueryDrawable() bugs, see bug 24320 2009-10-07 09:41:38 -06:00
Brian Paul
f36425b569 progs/xdemos: test glXQueryDrawable() 2009-10-07 09:41:38 -06:00
Brian Paul
846a6b0695 progs/xdemos: fix swapped parameters to CreatePbuffer() 2009-10-07 09:41:38 -06:00
Brian Paul
edbaa717b4 swrast: s/GLfloat/GLuint/ in bzero() 2009-10-07 08:07:53 -06:00
Brian Paul
14f21c7850 swrast: add missing returns 2009-10-07 08:05:28 -06:00
Vinson Lee
4b3cbecb3a progs/test: Fix MSVC build. 2009-10-07 07:54:31 -06:00
Brian Paul
e3fff3daf0 mesa/xlib: return 0 for errorBase, eventBase in glXQueryExtension()
A little better than leaving the values undefined, I think.
See bug 24321.
2009-10-07 07:45:59 -06:00
Brian Paul
f9904edf53 gallium/xlib: return 0 for errorBase, eventBase in glXQueryExtension()
A little better than leaving the values undefined, I think.
See bug 24321.
2009-10-07 07:45:59 -06:00
Brian Paul
79892e7976 intel: use driReadDrawable in do_copy_texsubimage() 2009-10-05 14:26:16 -06:00
Brian Paul
3b7ec94c0d intel: use driReadDrawable, not driDrawable in do_blit_readpixels() 2009-10-05 14:25:36 -06:00
Brian Paul
3b29dcbb5e intel: remove a buffer equality test in _mesa_make_current()
Before, if we called glXMakeCurrent() to change a context's window binding
while an FBO was bound, we weren't updating the intel->driDrawable and
intel->driReadDrawable fields.  This could cause us to dereference a null
pointer elsewhere.
2009-10-05 14:07:29 -06:00
Brian Paul
a8768bbc9d mesa: fix return value when clipping {Read,Draw}Pixels height <= 0
Signed-off-by: Ben Skeggs <bskeggs@redhat.com>

(cherry picked from master, commit 7aeaca33c3)
2009-10-05 11:10:31 -06:00
Jon TURNEY
a15d9ca9cc Fix building of GLSL demos which use M_PI
Some <math.h> files do not define M_PI, in which case, provide our own definition

Signed-off-by: Jon TURNEY <jon.turney@dronecode.org.uk>
2009-10-05 11:07:23 -06:00
Michel Dänzer
43750f1575 Use _mesa_select_tex_image() rather than hardcoding face 0.
Fixes crash loading a map in sauerbraten with

hwmipmap 1

in ~/.sauerbraten/config.cfg.
2009-10-05 12:31:51 +02:00
Frederic Crozat
3856c3cc46 r200: remove subpixel offset from viewport
Fixes bug fdo 20340 for r200.
2009-10-04 17:50:16 -04:00
Nicolai Hähnle
bbe384c86a r300: Workaround problem on R500 with very large fragment programs
The non-KMS interface is to blame here. In theory, a proper fix
could be produced that works for the KMS interface only, but it
require cleaning a lot of mess. Easier to just do it right in r300g.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-10-03 01:39:13 +02:00
Brian Paul
c01a77d304 docs: document default texture binding fix 2009-10-02 09:58:16 -06:00
Brian Paul
e1bddd159f mesa: fix incorrect default texture binding in unbind_texobj_from_texunits()
If we deleted a currently bound texture, we were always reverting the texture
binding to the default 1D texture rather than the proper default texture.
2009-10-02 09:57:00 -06:00
Brian Paul
85ee0ef9a7 gallium/xlib: use bitwise-and to test GLX_RGBA_BIT in choose_visual()
The parameter is a bitmask.
2009-10-02 07:52:29 -06:00
Brian Paul
584b0879ac xlib: use bitwise-and to test GLX_RGBA_BIT in choose_visual()
The parameter is a bitmask.
2009-10-02 07:51:19 -06:00
Brian Paul
abc12d0636 gallium/xlib: return GLX_RGBA_BIT or GLX_COLOR_INDEX_BIT in get_config()
This reverts part of commit a6b84aef4a
2009-10-02 07:47:49 -06:00
Brian Paul
389021220d gallium: replace // comments with /* */ 2009-10-02 07:31:42 -06:00
Brian Paul
337480e1f8 gallium: remove // comment and extra whitespace 2009-10-02 07:26:28 -06:00
Brian Paul
167ffa9e03 mesa: fix memory leak when generating mipmaps for compressed textures 2009-10-01 14:55:13 -06:00
Brian Paul
0574954238 mesa: fix mem leaks 2009-10-01 14:52:28 -06:00
Brian Paul
0f291f2efe gallium/util: silence uninitialized var warning 2009-10-01 14:52:10 -06:00
Brian Paul
63064cf7c3 mesa: add missing return when out of memory 2009-10-01 14:51:43 -06:00
Brian Paul
7b568614a2 mesa: fix potential uninitialized memory reads 2009-10-01 14:51:26 -06:00
Brian Paul
9b27a0d063 glsl: fix mem leak 2009-10-01 14:50:45 -06:00
Brian Paul
b3e41e0d5e st/mesa: check for null before asserts, fix possible mem leak 2009-10-01 14:49:39 -06:00
Brian Paul
b154497bef st/mesa: silence hidden parameter warning 2009-10-01 14:49:04 -06:00
Brian Paul
495628bc5c st/mesa: fix non-mipmap lastLevel calculation.
reviewed by Brian Paul.
(cherry picked from master, commit ae2daacbac)
2009-10-01 13:34:49 -06:00
Vinson Lee
18883cdf23 mesa: Return -FLT_MAX instead of 0 for LG2(0).
lim x->0 log(x) = -inf so -FLT_MAX is a better approximation than 0
for LG2(0).
2009-10-01 13:33:20 -06:00
Brian Paul
521e4b9b7e glx: fix glXQueryContext(GLX_RENDER_TYPE)
The renderType parameter to CreateContext() was never used.  Also, it
was often passed as zero.  Now when it's zero we check if the context
is RGBA or CI mode and set it accordingly.

Fixes bug 24211.
2009-09-30 15:15:10 -06:00
Eric Anholt
49fbdd18ed i965: Fix massive memory allocation for streaming texture usage.
Once we've freed a miptree, we won't see any more state cache requests
that would hit the things that pointed at it until we've let the miptree
get released back into the BO cache to be reused.  By leaving those
surface state and binding table pointers that pointed at it around, we
would end up with up to (500 * texture size) in memory uselessly consumed
by the state cache.

Bug #20057
Bug #23530
2009-09-30 11:27:27 -07:00
Brian Paul
b77469871a docs: document GLSL sqrt(0) fix 2009-09-29 19:05:04 -06:00
Brian Paul
322bc403bc glsl: regenerated file 2009-09-29 18:59:37 -06:00
Brian Paul
65765c9f2c glsl: rewrite sqrt(x) intrinsic to handle x=0
Since sqrt() is basically implemented in terms of RSQ/RCP we'll do a
divide by zero if x=0 and wind up with unpredictable results.
Now use CMP instruction to test for x<=0 and return zero in that case.
2009-09-29 18:57:13 -06:00
Brian Paul
3c794e45b0 glsl: add support for CMP instruction 2009-09-29 18:51:49 -06:00
Brian Paul
5f1faf4a21 docs: fixed glXQueryContext(GLX_RENDER_TYPE) 2009-09-29 12:18:41 -06:00
Brian Paul
a6b84aef4a gallium/xlib: fix GLX_RENDER_TYPE query
Return GLX_RGBA_TYPE or GLX_COLOR_INDEX_TYPE.
2009-09-29 12:17:20 -06:00
Brian Paul
86ee448047 mesa/xlib: fix GLX_RENDER_TYPE query
Return GLX_RGBA_TYPE or GLX_COLOR_INDEX_TYPE.
2009-09-29 12:16:20 -06:00
Brian Paul
ef9cd84521 glx: indentation fixes 2009-09-29 09:58:47 -06:00
Brian Paul
69a3043f41 mesa: bump version to 7.6.1 2009-09-29 09:36:06 -06:00
Brian Paul
2d400d43bf docs: initial 7.6.1 release notes 2009-09-29 09:34:47 -06:00
Brian Paul
9b5541617f mesa: work-around glXCopyContext() bug in _mesa_copy_texture_state()
See bug 24217.
2009-09-29 09:32:40 -06:00
Brian Paul
564df9dc5f softpipe: initialize the clear_flags bitvector in sp_create_tile_cache()
This silences tons of valgrind warnings in programs that don't call
glClear(), such as progs/demos/gamma.
2009-09-29 08:51:00 -06:00
Brian Paul
fbddc75aa2 softpipe: Grab a ref when the fb is set.
Nasty bug when the surface is freed and another is allocated right on
top of it. The next time we set the fb state SP thinks it's the same
surface and doesn't flush, and when the flush eventually happens the
surface belongs to a completely different texture.

(cherry picked from commit a77226071f)

Conflicts:
	src/gallium/drivers/softpipe/sp_context.c
2009-09-29 08:21:54 -06:00
Brice Goglin
ee9811de78 Prepare changelog for upload 2009-09-29 11:52:04 +02:00
Brice Goglin
adaeac03dd Add bug closers 2009-09-29 11:51:51 +02:00
Brice Goglin
e47955de4e Refresh patches 2009-09-29 11:45:58 +02:00
Brice Goglin
58c42a5b1d New upstream release 2009-09-29 11:43:15 +02:00
Brice Goglin
753604e607 Merge tag 'mesa_7_6' into debian-unstable
Conflicts:
	progs/egl/Makefile
	progs/egl/demo3.c
	progs/slang/vstest.c
	progs/tests/Makefile
	progs/tests/SConscript
	progs/tests/bufferobj.c
	progs/tests/floattex.c
	progs/tests/getprocaddress.c
	progs/tests/getprocaddress.py
	progs/tests/mapbufrange.c
	progs/tests/mapvbo.c
	progs/tests/texcmp.c
	progs/tests/texcompsub.c
	progs/tests/zreaddraw.c
	progs/trivial/.gitignore
	progs/vp/arl-static.txt
	progs/vp/arl-unused.txt
	progs/vp/vp-tris.c
	scons/gallium.py
2009-09-29 11:39:19 +02:00
Brian Paul
6829ef7460 docs: update news.html file with 7.5.2 and 7.6 release 2009-09-28 13:20:15 -06:00
Ian Romanick
d39fd9f641 Merge branch 'mesa_7_5_branch' into mesa_7_6_branch
Conflicts:
	src/mesa/main/version.h
2009-09-28 12:02:39 -07:00
Ian Romanick
18f3afbe88 docs: 7.5.2 md5 sums 2009-09-28 11:41:23 -07:00
Ian Romanick
b807d49f18 Prep for 7.5.2 release 2009-09-28 11:33:52 -07:00
Ian Romanick
86cd188f94 docs: 7.6 md5 sums 2009-09-28 11:29:25 -07:00
Ian Romanick
f0dc378705 Prep for 7.6 release 2009-09-28 11:22:54 -07:00
Brian Paul
eeb7e04da6 Merge branch 'mesa_7_5_branch' into mesa_7_6_branch 2009-09-28 09:59:59 -06:00
Robert Noland
d09941c8cc Fix build on non GLIBC platforms (FreeBSD at least)
Build was broken by commit 9666529b5a

I'm not certain that this is entirely the correct fix since the demo
from bug #23774 seemed to work before the commit that broke the build.

Signed-off-by: Robert Noland <rnoland@2hip.net>
Signed-off-by: Brian Paul <brianp@vmware.com>
2009-09-28 09:48:45 -06:00
Brian Paul
fc613848e6 docs: list additional 7.5.2 bug fixes 2009-09-28 09:43:42 -06:00
Brian Paul
c7d0f0b46c docs: document gallium mipmap generation fix 2009-09-28 09:38:50 -06:00
Brian Paul
c7fddaf612 st/mesa: fix st_generate_mipmap() issues
The main issue is we didn't always have a gallium texture object with
enough space to store the to-be-generated mipmap levels.  When that's
the case, allocate a new gallium texture and use st_texure_finalize()
to copy images from the old texture to the new one.

We also had the baseLevel parameter to st_render_mipmap() wrong.
2009-09-28 09:37:16 -06:00
Brian Paul
e3a6f57ad6 st/mesa: fix/simplify st_texture_object::lastLevel calculation
Don't compute the st_texture_object::lastLevel field based on the texture
filters.  Use the _MaxLevel value that core Mesa computes for us.
When called from the GenerateMipmap path, we'll use the lastLevel field
as-is.
2009-09-28 09:35:08 -06:00
Brian Paul
41d0606b7f gallium/util: add sanity check assertions 2009-09-28 09:35:04 -06:00
Michel Dänzer
151e0c0aea intel: Handle GL_RGB8 for glCopyTex(Sub)Image.
Avoids an unnecessary fallback.
2009-09-25 21:00:28 +02:00
Vinson Lee
46da1f2c9b mesa: move declaration before code 2009-09-25 08:51:57 -06:00
Eric Anholt
cc8084932c intel: Flush the batch when we're about to subdata into a VBO.
This fixes the clears in openarena with the new metaops clear code, and
the new piglit vbo-subdata-sync test.

Bug #23857.
2009-09-24 16:24:46 -07:00
Eric Anholt
54107a0979 i965: Clean up some mess with the batch cache.
Its flagging of extra state that's already flagged by the vtbl new_batch
when appropriate was confusing my tracking down of the OA clear bug.
2009-09-24 16:24:46 -07:00
Brian Paul
940ca2e837 Merge branch 'mesa_7_5_branch' into mesa_7_6_branch 2009-09-24 16:01:26 -06:00
Eric Anholt
726a04a2cd i965: Emit zero initialization for NV VP temporaries as required.
This is similar to what r300 does inside the driver, but I've added it as
a generic option since it seems most hardware will want it.

Fixes piglit nv-init-zero-reg.vpfp and nv-init-zero-addr.vpfp.
2009-09-24 13:34:06 -07:00
Eric Anholt
a9a47afe7e i965: Remove assert about NV_vp now that it somewhat works. 2009-09-24 13:34:06 -07:00
Eric Anholt
9018a7dd17 i965: Load NV program matrices when required. 2009-09-24 13:34:06 -07:00
Eric Anholt
601769a2c0 mesa: Initialize NV_vertex_program fields for the parameter lists and such.
This helps let drivers treat NV_vp like ARB_vp.
2009-09-24 13:34:06 -07:00
Brian Paul
b849c6f1b3 intel: use default array/element buffers in intel_generate_mipmap()
If there happened to be a bound VBO when intel_generate_mipmap() was
called we blew up because of a bad vertex array pointer.

Fixes regnumonline, bug 23859.
2009-09-24 12:41:14 -06:00
Brian Paul
f0339f502c mesa: replace assertion with no-op function assignment 2009-09-24 12:37:34 -06:00
Brian Paul
964792b025 mesa: added comment 2009-09-24 12:37:06 -06:00
Brian Paul
1a81611725 vbo: limit number of warnings to 10
Otherwise some apps will emit tons of warnings.
2009-09-24 12:36:05 -06:00
Pauli Nieminen
1d2dca194c radeon: Fix scissors for r600 KMS.
Radeon generic scissors code had problem that some of code was using exclusive
and some inclusive bottom right corner. Only r600 driver is using exclusive
coordinate so changed generic code to pass inclusive coordinate and r600 driver
changes BR coordinate to be exclusive.
2009-09-24 20:37:55 +03:00
Brian Paul
7549a8397b Merge branch 'mesa_7_5_branch' into mesa_7_6_branch 2009-09-24 10:52:15 -06:00
Brian Paul
a64d4516a0 tgsi/sse: Pass the lodbias, not zero. More comments.
This fixes the glean/glsl1 "texture2D(), with bias" test when using SSE.
2009-09-24 10:28:09 -06:00
Brian Paul
a491e25b1f mesa: added default case return to silence warning 2009-09-24 10:28:09 -06:00
Brian Paul
00ddd4f9e9 glsl: init var to silence warning 2009-09-24 10:28:09 -06:00
Brian Paul
e44c084be5 glsl: fix missing initializers warning 2009-09-24 10:28:09 -06:00
Andre Maasikas
2058dfaa47 r600: add support for CUBE textures, also TXP
seems to work here ...
2009-09-24 10:03:37 -04:00
Alex Deucher
639fb1472d r600: fix typo in the last commit
128 gprs, 256 reg-based consts
2009-09-24 10:03:22 -04:00
Alex Deucher
28308c9260 r600: various cleanups
- max texture size is 8k, but mesa doesn't support
that at the moment.
- attempt to set shader limits to what the hw actually
supports
- clean up some old r300 cruft
- no need to explicitly disable irqs.  This is fixed
in the drm now.

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2009-09-24 10:03:08 -04:00
Andre Maasikas
ed91d10347 r600: fix some issues with LIT instruction
- MUL_LIT is ALU.Trans instruction
- some Trans instructions can take 3 arguments
- don't clobber dst.x, use dst.z as temp, it'll get written correct
  value in last insn
- respect source swizzles
2009-09-24 10:02:37 -04:00
Alex Deucher
48559c7605 r600: fix point sizes
registers takes radius
2009-09-24 10:02:22 -04:00
Alex Deucher
095db818c6 r600: fix polygon offset 2009-09-24 10:02:08 -04:00
Alex Deucher
ec14d59afa radeon: don't build non-r600 span code on r600 2009-09-24 10:01:56 -04:00
Alex Deucher
dbec27be85 r600: minor span cleanups 2009-09-24 10:01:41 -04:00
Andre Maasikas
2cd2dc34ac r600: support position_invariant programs 2009-09-24 10:00:58 -04:00
Alex Deucher
9437ac9bcc r600: add span support for 1D tiles
1D tile span support for depth/stencil/color/textures

Z and stencil buffers are always tiled, so this fixes
sw access to Z and stencil buffers.  color and textures
are currently linear, but this adds span support when we
implement 1D tiling.

This fixes the text in progs/demos/engine and progs/tests/z*
2009-09-24 09:59:45 -04:00
Alex Deucher
93a7ea6ba0 r600: fix warning
Noticed by rnoland on IRC.
2009-09-24 09:59:32 -04:00
Andre Maasikas
7f5a958c80 r600: fix texcoords from constants
with some minor updates from Richard.
2009-09-24 09:59:15 -04:00
Andre Maasikas
9edd1a441c r600: enable caching of vertex programs 2009-09-24 09:59:00 -04:00
Alex Deucher
6552a103f9 r600: check if textures are actually enabled before submission
noticed by taiu on IRC.
2009-09-24 09:58:36 -04:00
Alex Deucher
65b01d449c r600: fix ftp for dri1
We use t->bo for dri1 since r600 uses CS for dri1.
2009-09-24 09:58:17 -04:00
Dave Airlie
b1e417413f r600: don't setup hardware state if TFP
if we have a BO here it means TFP and we should have set it
up already.

tested by b0le on #radeon
2009-09-24 09:57:45 -04:00
Alex Deucher
cbab3d7f2a r600: fix dri2 clipping 2009-09-24 09:56:18 -04:00
Maciej Cencora
84c7afd9e0 r300: fallback to software rendering if we are out of free texcoords
Fixes #22741
2009-09-23 23:22:33 +02:00
Brian Paul
e41707beca softpipe: added max texture/surface size sanity check 2009-09-23 10:50:38 -06:00
Brian Paul
84b956c29b softpipe: increase MAX_WIDTH/HEIGTH 4096 to match max texture size 2009-09-23 10:46:27 -06:00
Brian Paul
926b965ed5 mesa: don't re-use the meta glDrawPixels VBO; create a new one each time
This should help to work around bugs 24083 and 23670.
2009-09-22 15:58:49 -06:00
Brian Paul
f338de4018 mesa: fix more buffer object error messages 2009-09-22 13:47:49 -06:00
Brian Paul
ba002eb196 Merge branch 'mesa_7_5_branch' into mesa_7_6_branch
Conflicts:

	src/mesa/main/bufferobj.c
2009-09-22 13:44:43 -06:00
Nicolai Hähnle
8cc12ffb34 r300: Fix crash reported in bug #24066
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-09-22 21:00:01 +02:00
Brian Paul
6559eaef59 Merge branch 'mesa_7_5_branch' into mesa_7_6_branch 2009-09-21 14:49:46 -06:00
Brian Paul
2655d43756 mesa: refine the error checking vbo_exec_DrawRangeElements()
If the 'end' index is out of bounds issue a warning as before.  But instead
of just no-op'ing the draw call, examine the actual array indices to see
if they're OK.  If the max array index is out of bounds, issue another
warning and no-op the draw call.  Otherwise, draw normally.  This is a
debug build-only feature since it could impact performance.

This "fixes" the missing torus in the OGL Distilled / Picking demo.
2009-09-21 14:25:39 -06:00
Brian Paul
44d260329e mesa: make max_buffer_index() a non-static function 2009-09-21 14:25:39 -06:00
Maciej Cencora
ff5535c521 radeon: update buffer map/unmap code for changes introduced in 92033a9516 and 822c796481 2009-09-21 21:13:01 +02:00
Maciej Cencora
db928a5e91 mesa: add some debug info to teximage.c 2009-09-21 21:12:55 +02:00
Maciej Cencora
ab4ec85f6c r300: fix a typo 2009-09-21 21:12:31 +02:00
Nicolai Hähnle
526430ade1 r300: Zero-initialize register for NV_vertex_program
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-09-21 12:56:16 +02:00
Nicolai Hähnle
736e1ae42f r300: Fix handling of NV_vertex_program parameters
The handling is a bit inefficient, unfortunately, but I don't want to make
any intrusive changes for Mesa 7.6.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-09-21 12:56:16 +02:00
Michel Dänzer
1d4dbd8d9b Merge branch 'mesa_7_5_branch' into mesa_7_6_branch 2009-09-21 10:39:20 +02:00
Pauli Nieminen
284a7af274 radeon: Fix legacy bo not to reuse dma buffers before refcount is 1.
This should help detecting possible memory leaks with dma buffers and prevent
possible visual corruption if data would be overwriten too early.
2009-09-20 22:28:52 +03:00
Nicolai Hähnle
7e3b8b0d8f r300/compiler: Fix trig instructions in R300 fp
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-09-20 20:43:32 +02:00
Pauli Nieminen
3640e4acde radeon: Fix typo in variable name. 2009-09-20 21:08:42 +03:00
Pauli Nieminen
5fa9a7a9a9 radeon: Improve WARN_ONCE macro to appear as single statement.
Do-while makes macro safe to be used with if and for constructions.

Also remove __LINE__ macro from variable name because scope is local to macro anyway.
2009-09-20 20:15:52 +03:00
Nicolai Hähnle
94a3c5979f radeon: Fix "verts" debugging enable
Copy'n'paste apparently prevented the RADEON_VERTS flag from being enabled.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-09-20 18:45:32 +02:00
Nicolai Hähnle
82c2f7756a Merge branch 'mesa_7_5_branch' into mesa_7_6_branch 2009-09-20 16:59:03 +02:00
Nicolai Hähnle
e617dd14ab mesa/st: Create front renderbuffer on the fly when supplied with a surface
Normally, the mesa/st would create a fake front buffer out of a
client-allocated surface.

In the DRI setting, however, st/dri provides a front buffer surface which is
created and maintained by the X server. Prefer to use this surface instead,
so that front buffer rendering and reading works correctly.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-09-20 16:58:53 +02:00
Nicolai Hähnle
c8c5de9e9a docs: Document new features in radeon/r200/r300 drivers
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-09-20 16:47:40 +02:00
Nicolai Hähnle
6c323a2473 r300/compiler: Fix R300 fragment program regression introduced by 0723cd1...
We obviously need to move the code addr register backwards because their may
be overlap.

This bug affected in particular the Compiz water plugin.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-09-20 16:34:47 +02:00
Zou Nan hai
1e4c353511 [i965] add a missing header file 2009-09-18 16:04:41 +08:00
Zou Nan hai
a66bab0e37 [i965] use intel_batchbuffer_flush to flush the clear 2009-09-18 13:29:28 +08:00
Brian Paul
fac38e8c8f mesa: fix clip plane, fog issues 2009-09-16 21:22:02 -06:00
Ian Romanick
88e3a57605 Merge branch 'mesa_7_5_branch' into mesa_7_6_branch
Conflicts:
	src/mesa/main/dlist.c
2009-09-16 07:57:19 -07:00
Zou Nan hai
76e836a41a i965: do a flush in clear, fix openarena render issue,
fd.o bug# 23857
2009-09-16 13:25:46 +08:00
Ian Romanick
6c6fe0a704 Merge commit 'origin/mesa_7_5_branch' into mesa_7_6_branch 2009-09-15 13:13:35 -07:00
Brian Paul
5d526ed21a Merge branch 'mesa_7_5_branch' into mesa_7_6_branch 2009-09-15 09:45:18 -06:00
Brian Paul
2b992dc327 gl: restore some PFNGL typedefs
Commit d33c315d9e removed a few too many
typedefs.  We need the typedefs in glext.h which are protected by #ifdef
GL_VERSION_1_2 but we can exclude the ones protected by
GL_VERSION_1_2_DEPRECATED.
2009-09-15 09:36:31 -06:00
Vinson Lee
2729db8976 gallium: Add Mac OS to pipe/p_thread.h.
Mac OS also has POSIX threads.
2009-09-14 11:50:48 -06:00
Brian Paul
280933f793 docs: mention the new Gallium llvmpipe driver 2009-09-11 13:43:51 -06:00
Brian Paul
d81086a86b llvmpipe: asst fixes for 'make linux-llvmpipe' 2009-09-11 13:39:14 -06:00
Pauli Nieminen
796c96de80 radeon: Remove structure allocation from iterator variable.
dma_bo varaible is only used for iterating so allocating memory for it only
causes memory leaks.
2009-09-11 01:29:07 +03:00
Brian Paul
4b1cbfcbe6 Merge branch 'mesa_7_5_branch' into mesa_7_6_branch 2009-09-10 15:40:26 -06:00
Brian Paul
9e6ae75cc8 intel: disable intel_stencil_drawpixels() for now
It doesn't work reliably even when all the prerequisite checks are made.
2009-09-10 15:34:34 -06:00
Ian Romanick
8fd4e4dfc3 Fix merge fail
One of the conflicst from this merge was missed:

commit 0c309bb494
Merge: c6c44bf d27d659
Author: Brian Paul <brianp@vmware.com>
Date:   Wed Sep 9 08:33:39 2009 -0600
2009-09-10 11:47:24 -07:00
Brian Paul
d78a196121 tgsi: use new tgsi_call_record to handle execution mask stacks
This fixes some issues when "return"ing from nested loops/conditionals.
2009-09-10 12:45:27 -06:00
Brian Paul
c5f8594aeb mesa: need to set all stencil bits to 0 before setting the 1 bits
Plus, check for pixel transfer stencil index/offset.
2009-09-10 12:45:27 -06:00
Ian Romanick
8398535331 Merge branch 'mesa_7_5_branch' into mesa_7_6_branch
Conflicts:
	src/mesa/drivers/dri/intel/intel_context.c
2009-09-10 11:24:56 -07:00
Eric Anholt
acfea5c705 i965: Fix relocation delta for WM surfaces.
This was a regression in 0f328c90db.

Bug #23688
Bug #23254
(cherry picked from commit 5604b27b93)
2009-09-10 11:22:56 -07:00
Brian Paul
e9ba9ffc9a mesa: in texenvprogram code, only do saturation when really needed.
For some env modes (like modulate or replace) we don't have to clamp
because we know the results will be in [0,1].
2009-09-10 08:41:12 -06:00
Vinson Lee
23fefa031f gallium: Add PIPE_OS_APPLE back to auxiliary/util/u_time.h.
Fixes typo from commit c6c44bf481.
2009-09-10 08:40:16 -06:00
Pauli Nieminen
3d1324a66a radeon: Change debugging code to use macros instead of inline functions.
Variadic functions can't be inlined which makes debugging to have quite large
function overead. Only aleternative method is to use variadic macros which are
inlined so compiler can optimize debugging to minimize overhead.
2009-09-10 16:53:08 +03:00
Brian Paul
2b692cd6d6 mesa: include new u_format.csv file in tarballs 2009-09-09 12:01:39 -06:00
Pauli Nieminen
e0f99b8268 radeon: Add more verbose error message for failed command buffer. 2009-09-09 18:31:52 +03:00
Brian Paul
0c309bb494 Merge branch 'mesa_7_5_branch' into mesa_7_6_branch
Conflicts:

	Makefile
	configs/default
	progs/glsl/Makefile
	src/gallium/auxiliary/util/u_simple_shaders.c
	src/gallium/state_trackers/glx/xlib/xm_api.c
	src/mesa/drivers/dri/i965/brw_draw_upload.c
	src/mesa/drivers/dri/i965/brw_vs_emit.c
	src/mesa/drivers/dri/intel/intel_context.h
	src/mesa/drivers/dri/intel/intel_pixel.c
	src/mesa/drivers/dri/intel/intel_pixel_read.c
	src/mesa/main/texenvprogram.c
	src/mesa/main/version.h
2009-09-09 08:33:39 -06:00
aljen
c6c44bf481 gallium: Added HaikuOS platform 2009-09-09 08:24:18 -06:00
Brian Paul
89a765e92b mesa: disable GL_LUMINANCE case in _mesa_meta_draw_pixels()
Works around a bug found on i965.  See bug 23670.
2009-09-09 08:23:14 -06:00
José Fonseca
9216b4e7be scons: Used wrong exception class. 2009-09-04 19:38:35 +01:00
José Fonseca
b9f56078cd scons: Don't use scons internal functions. 2009-09-04 19:34:11 +01:00
Alex Deucher
b13a553dd4 r600: fix Elts handling
Patch from taiu on IRC.  fixes bug 23585
2009-09-04 14:07:53 -04:00
Julien Cristau
f8f07cb999 Remove unused INSTALL_TARGETS variable
The install targets were removed in the previous commit.
2009-09-04 17:29:21 +02:00
Julien Cristau
c14446ab00 Don't run install from the various configs in parallel
Hopefully this fixes a bug in the previous debian/rules that could lead
to FTBFS.  Thanks to Bernhard R. Link for the suggestions.
2009-09-04 17:22:31 +02:00
Brian Paul
592a6642fc ARB prog: replace 'unsigned' with 'gl_state_index'
Fixes compilation warnings with MSVC.
2009-09-04 09:17:59 -06:00
Brian Paul
3fedd08779 ARB prog: rename POINT, SIZE to POINT_TOK, SIZE_TOK
Fixes symbol collisions with typedefs in Microsoft headers.
Perhaps we should prefix/suffix all the lexer tokens to avoid this.
2009-09-04 09:17:59 -06:00
Brian Paul
40636fe6f2 gallium/xlib: minor clean-ups 2009-09-04 09:17:59 -06:00
Jakob Bornecrantz
65c79c9cbd i915g: Fix warnings in scons build by using byte pointers
scons build complained about void pointer math
2009-09-04 10:55:53 +01:00
Brice Goglin
70fd9421ac Prepare changelog for upload 2009-09-04 11:39:18 +02:00
Brice Goglin
1810757c29 Bump Standards-Version to 3.8.3 to 3.8.3 now that we have README.source 2009-09-04 11:35:10 +02:00
Brice Goglin
4c79e26a9d Add a Mesa-specific README.source inspired from the one in xsfbs 2009-09-04 11:33:17 +02:00
Brice Goglin
1783d52ace Prepare changelog for upload 2009-09-04 10:58:58 +02:00
Brice Goglin
c5bf7f94c0 New upstream release 2009-09-04 10:55:25 +02:00
Brice Goglin
8222bfc1d1 Merge tag 'mesa_7_5_1' into debian-unstable
Conflicts:
	progs/tests/fbotest1.c
	progs/tests/texwrap.c
	progs/trivial/.gitignore
	progs/trivial/Makefile
2009-09-04 10:53:45 +02:00
Michal Krol
ce39cd6696 tgsi: Document differencies between vs_1_1 and vs_2_0 for EXPP and LOGP. 2009-09-04 09:31:22 +02:00
Brian Paul
f6dff92c9b docs: 7.5.1 md5 sums 2009-09-03 16:07:46 -06:00
Brian Paul
5d56e31e1d docs: point to fd.o for downloads instead of SourceForge 2009-09-03 16:07:46 -06:00
Brian Paul
7ec865202e gallium/xlib: silence unitialized var warning 2009-09-03 16:07:46 -06:00
Brian Paul
9e711b6865 gallium/xlib: silence uninitialized var warning 2009-09-03 16:07:46 -06:00
Brian Paul
5a8e1ddf19 st/mesa: silence uninitialized var warnings 2009-09-03 16:07:46 -06:00
Brian Paul
f1ae72e9f2 docs: prep for 7.5.1 release 2009-09-03 16:07:46 -06:00
Brian Paul
a04e83ba15 docs: added news entry for 7.5.1 2009-09-03 16:07:46 -06:00
Brian Paul
4aee0dbf81 docs: update precompiled libs info 2009-09-03 16:07:46 -06:00
Brian Paul
7e2f01e0f1 docs: move SGI GLU link 2009-09-03 16:07:46 -06:00
Brian Paul
beb05393c8 st/mesa: fix glCopyPixels(GL_STENCIL_INDEX) inverted position
If the renderbuffer orientation is Y=0=TOP we need to invert the dstY
position.
2009-09-03 16:07:46 -06:00
Keith Whitwell
8fc945cd84 st/mesa: Do GL_RGBA->GL_RGB texsubimage on hardware
State tracker currently backs GL_RGB textures with RGBA almost always.
This means we need to maintain A==1 in these textures to give correct GL_RGB
sampling results.

This change offloads the RGBA->RGB copy to hardware using the new writemask
version of u_blit_pixels.

More src/dstLogical/dstActual triples could be shifted to hardware by
this technique in future patches.
2009-09-03 16:07:45 -06:00
Keith Whitwell
862724d3c2 util: add version of u_blit_pixels which takes a writemask
Values outside the writemask are set in the destination to {0,0,0,1}
2009-09-03 16:07:45 -06:00
Brian Paul
375a6b4c4a progs/tests: re-enable exit() call
See bug 21267.
2009-09-03 16:07:45 -06:00
Brian Paul
3b96db337d docs/: document cross-compile fix 2009-09-03 16:07:45 -06:00
Alex Deucher
6a97cca081 r600: rework cb/db setup
Setup the regs when we emit rather than during state setup.
In certain cases a proper CB target was never emitted.
This fixes bug 23658.
2009-09-03 18:04:47 -04:00
Zack Rusin
323440b3e2 st/xorg: add linear and radial gradient acceleration 2009-09-03 16:52:04 -04:00
Zack Rusin
007a843991 st/xorg: radial gradient shader 2009-09-03 16:52:04 -04:00
Zack Rusin
5571c4fe36 st/xorg: linear gradient shader 2009-09-03 16:52:04 -04:00
Alex Deucher
8c1d85cebe r600: make sure the active vertex shader bo is re-added to persistent list. 2009-09-03 15:23:18 -04:00
Brian Paul
dc60d0db52 glapi: fix incorrect/missing return types for glFenceSync(), glClientWaitSync() 2009-09-03 13:02:41 -06:00
Brian Paul
e059885ce3 mesa: rename gl_sync_object::Status to StatusFlag
There's a symbol collision with X11/Xlib.h #define Status int
in the Mesa xlib code.  This seems the simpliest way to work around this.
2009-09-03 12:47:25 -06:00
Ian Romanick
446a71d1f8 docs: Document new extension support for 7.6 release. 2009-09-03 11:22:47 -07:00
Eric Anholt
5e448a8d4d Add ARB_sync to the xorg sw dri driver. 2009-09-03 11:22:47 -07:00
Eric Anholt
d5ea2dce93 savage: Fix driver build post-ARB_sync.
Like s3v, clean up absurd use of Xlib in the driver, avoiding namespace
pollution.
2009-09-03 11:22:47 -07:00
Eric Anholt
19420f02d4 s3v: Fix driver build for ARB_sync.
This driver was including Xlibint.h to get the CARD32 typedef to use for
32-bit unsigned integers, which #defined Status to something.  CARD32 isn't
actually a 32-bit unsigned integer, so replacing with uint32_t usage should
fix bugs on 64-bit along with the build.
2009-09-03 11:22:47 -07:00
Eric Anholt
afd6141934 intel: Add support for ARB_sync.
We currently weasel out of supporting the timeout parameter, but otherwise
this extension looks ready, and should make the common case happy.
2009-09-03 11:22:47 -07:00
Ian Romanick
aee282faa7 ARB sync / swrast: Use GL_ARB_sync_functions instead of GL_ARB_sync. Oops. 2009-09-03 11:22:47 -07:00
Ian Romanick
0342dce226 Don't dereference function pointers in calls.
I'm apparently alone in prefering this calling convention, so I'll be
a team player. :p  Based on review comments by Brian Paul and Eric
Anholt.
2009-09-03 11:22:47 -07:00
Ian Romanick
18d3409571 Add syncobj.c to SConscript 2009-09-03 11:22:47 -07:00
Ian Romanick
6af24b6b03 Whitespace and include file clean-up.
Based on review comments by Brian Paul.
2009-09-03 11:22:47 -07:00
Ian Romanick
0f8fdd8198 Use MIN2 instead of open-coded version
Based on review comments by Brian Paul.
2009-09-03 11:22:47 -07:00
Ian Romanick
16b393d059 ARB sync: Fix delete behavior and context destruction behavior
I believe this resolves the outstanding issues WRT sync object
deletetion.  I have also added a large comment at the top of syncobj.c
describing the expected memory management behavior.  I'm still a
little uncertain about the locking on ctx->Shared.
2009-09-03 11:22:46 -07:00
Ian Romanick
f5a22721c5 Add dummy list node type 'struct simple_node' 2009-09-03 11:22:46 -07:00
Ian Romanick
f37070bab6 ARB sync: Add support for GL_ARB_sync to swrast
This isn't quite right yet.  The delete behavior and the context
clean-up needs some work.
2009-09-03 11:22:46 -07:00
Ian Romanick
96bdd993ec Eliminate trailing whitespace in extension_helper.c 2009-09-03 11:22:46 -07:00
Ian Romanick
064913430d ARB sync: Regenerate files from previous commit 2009-09-03 11:22:46 -07:00
Ian Romanick
10a09e49fc ARB sync: Add base infrastructure for GL_ARB_sync 2009-09-03 11:22:45 -07:00
Ian Romanick
10067e4641 ARB sync: Add infrastructure for glGetInteger64v 2009-09-03 11:22:45 -07:00
Brian Paul
d75a99edd6 mesa: fix typos in separable filter functions 2009-09-03 12:10:53 -06:00
Brian Paul
7a7d5879e2 mesa: compute tex env program key size based on nr_enabled_units
When no textures are enabled, the key size is 4 bytes.  If unit[0] is
enabled, the key size is 16 bytes.

Inspired by a patch from Chris Wilson.
2009-09-03 11:48:19 -06:00
Brian Paul
5cd7042088 swrast: wrap comment to 80 columns, remove dead code 2009-09-03 11:46:28 -06:00
Brian Paul
2db37ef659 mesa: use new combined PBO validate/map helpers in convolution/filter funcs 2009-09-03 11:45:18 -06:00
Brian Paul
95027a0087 mesa: use new combined PBO validate/map helpers 2009-09-03 11:45:17 -06:00
Brian Paul
dc947c8f92 mesa: combined PBO validate/map helpers 2009-09-03 11:45:17 -06:00
Brian Paul
203f395aaf mesa: use new _mesa_map_pbo_source/dest() functions in more places
This trims down the code a bit.  The next step would be to combine
the validate and map operations into one helper...
2009-09-03 11:45:17 -06:00
Brian Paul
1b448c7a5c mesa: consolidate PBO map/unmap helpers
Instead of _mesa_map_readpix_pbo() use _mesa_map_pbo_source().

Instead of _mesa_map_drawpix_pbo() and _mesa_map_bitmap_pbo() use
_mesa_map_pbo_dest().
2009-09-03 11:45:17 -06:00
Brian Paul
e0ec405a9f intel: helper to debug bufmgr (disabled) 2009-09-03 11:45:17 -06:00
Jakob Bornecrantz
3070b13f4c i915g: Up the number of relocs 2009-09-03 19:33:07 +01:00
Jakob Bornecrantz
8303c722cb i915g: Don't run in sync with HW 2009-09-03 19:33:07 +01:00
Jakob Bornecrantz
87a4fa56ae i915g: Don't send flush flags to HW 2009-09-03 19:33:07 +01:00
Zack Rusin
5643942517 st/xorg: cleanup and adjust to the changes in the ureg code 2009-09-03 12:44:15 -04:00
Zack Rusin
07f9ad5c32 st/xorg: adjust enums in preperation for gradients 2009-09-03 12:41:39 -04:00
Brian Paul
2f6d2a9e27 mesa: change ctx->Driver.BufferData() to return GLboolean for success/failure
Return GL_FALSE if we failed to allocate the buffer.  Then raise
GL_OUT_OF_MEMORY in core Mesa.
2009-09-03 09:42:38 -06:00
Keith Whitwell
848ab8be8c aux/tgsi: pull back ureg work from 0.1 branch
Manual merge of ureg changes on the branch.  Too much unrelated stuff
for a proper merge.
2009-09-03 15:16:25 +01:00
Christoph Bumiller
8b1ef3fa35 nv50: move centroid, flat bits when making interp long
Before this, just the perspective divide bit was moved in
convert_to_long of the load interpolant instruction.
2009-09-03 12:54:41 +02:00
Christoph Bumiller
ffee352726 nv50: fix vbo_static_attrib method size error
The VTX_ATTR_3/2/1F methods also had size 4 ...
a stupid copy/paste error.
2009-09-03 12:42:42 +02:00
Christoph Bumiller
c8258b95d6 nv50: fix draw_elements_inline_u08/16
We've been emitting the same two indices over and over
without incrementing map.
2009-09-03 12:42:42 +02:00
Cooper Yuan
e938d4a053 r300g: specify point/line/triangle have stuffed texture coord 2009-09-03 17:06:18 +08:00
Dave Airlie
c19b52f10f r600: visual depth has no meaning here.
fbos get angry when this happens.
2009-09-03 14:14:47 +10:00
Dave Airlie
a25d0dc9ec r600: make sure the active shader bo is re-added to persistent list. 2009-09-03 14:14:31 +10:00
Dave Airlie
5f7c532b1e radeon: pass internal format into the miptree.
We need to figure out if the compression format changes.

without this texcmp segfaults if you change format
enough times.
2009-09-03 12:02:54 +10:00
Dave Airlie
e5b93e1161 radeon/dri2: add gl20 bits for r300/r600 just like dri1 does 2009-09-03 12:01:27 +10:00
Dave Airlie
ea26f28c8f tests/texcmp: glewInit in wrong place 2009-09-03 11:33:53 +10:00
Zack Rusin
206eb50493 st/xorg: fix warnings 2009-09-02 18:39:21 -04:00
Zack Rusin
d6b58a97c2 st/xorg: handle xrender repeat modes 2009-09-02 18:38:23 -04:00
Zack Rusin
dc9de8064f st/xorg: flip the coordinate system 2009-09-02 17:21:28 -04:00
Zack Rusin
d918896a75 st/xorg: handle solid fills in the fragment shader 2009-09-02 17:16:03 -04:00
Eric Anholt
cbde276580 Revert "i965: Use VBOs in the VBO module on 965, now that we have ARB_map_buffer_range."
This reverts commit 00413d8742.  Even with
fixes, using ARB_map_buffer_range in the VBO module isn't showing up as a
significant win, and some cases apparently regressed.

Bug #23624.
2009-09-02 12:20:01 -07:00
Eric Anholt
ec32ef12b3 intel: Add support for FlushMappedBufferRange for ARB_map_buffer_range.
This should help for the usage by the VBO module, where we would upload
the whole remaining chunk of the buffer for a series of range maps that should
cover just a segment of it.
2009-09-02 12:20:00 -07:00
Eric Anholt
82313eed01 intel: Sync a synchronized READ_BIT map buffer range with GL drawing to it.
It's probably uncommon, but would obviously have gone wrong.
2009-09-02 12:20:00 -07:00
Eric Anholt
aecba6b1c8 intel: Move MapBufferRange mesa state setting up to cover the 915 case. 2009-09-02 12:20:00 -07:00
Jakob Bornecrantz
7d8f33590f st/xorg: Guard against realy old versions of Xorg 2009-09-02 19:48:49 +02:00
Brian Paul
5e809216a8 Revert "mesa: fix the non-GNU C bit-field case"
This reverts commit 4b08e74982.

Don't know what I was thinking there.
2009-09-02 10:38:46 -06:00
Brian Paul
4b08e74982 mesa: fix the non-GNU C bit-field case 2009-09-02 10:12:15 -06:00
Gary Wong
d98b9f4edb mesa: silence gcc bit-field warning 2009-09-02 10:11:15 -06:00
Brian Paul
a7a3d3c271 mesa: replace 8 with NUM_UNITS 2009-09-02 09:43:10 -06:00
Brian Paul
8cb651578d mesa: remove accidentally committed printf 2009-09-02 09:25:28 -06:00
Brian Paul
83e4470d9a mesa: added #ifdef __GNUC__ around GLubyte bitfield usage
It would be nice if there were a #pragma or something to disable the warnings:

main/texenvprogram.c:87: warning: type of bit-field ‘Source’ is a GCC extension
main/texenvprogram.c:88: warning: type of bit-field ‘Operand’ is a GCC extension

but there doesn't appear to be a way to do that.
2009-09-02 08:47:47 -06:00
Chris Wilson
a46e32787d mesa: Compact state key for TexEnv program cache
By rearranging the bitfields within the key we can reduce the size
of the key from 644 to 196 bytes, reducing the cost of both the
hashing and equality tests.
2009-09-02 08:47:47 -06:00
Michel Dänzer
c0cf0fd163 st/xorg: Remove code no longer support by xserver Git master.
Shouldn't be necessary with older versions either.
2009-09-02 16:01:21 +02:00
Michel Dänzer
ea55f8ed8f st/xorg: Add support for xserver Git master DRI2 interface.
Reorganize to handle both interfaces with common code.
2009-09-02 16:00:30 +02:00
Michel Dänzer
0b26d97f4d st/dri: Slight consolidation of DRI2 buffer handling.
Always use / assume a combined depth/stencil buffer.

Also update drawable formats from surfaces returned by the driver.
2009-09-02 15:41:41 +02:00
Michel Dänzer
385620e5eb st/xorg: Add EXA UploadToScreen and DownloadFromScreen hooks. 2009-09-02 15:41:40 +02:00
Xiang, Haihao
98a8744e02 i965: CS FENCE in URB_FENCE is 11-bits wide 2009-09-02 13:28:32 +08:00
Xiang, Haihao
f5539b6991 i965: validate sf state 2009-09-02 13:28:23 +08:00
Eric Anholt
60b08eb1fd mesa: Make MultiDrawElements submit multiple primitives at once.
Previously, MultiDrawElements just called DrawElements a bunch of times.
By sending several primitives down the pipeline at once, we avoid a bunch
of validation.  On my GL demo, this improves fps by 2.5% (+/- .41%) and
reduces CPU usage by 70.5% (+/- 2.9%) (n=3).

Reviewed by: Ian Romanick <ian.d.romanick@intel.com>
2009-09-01 20:35:19 -07:00
Ben Skeggs
a82cd55a5c nv50: SWZ is the same as MOV from our perspective 2009-09-02 12:05:34 +10:00
Brian Paul
282f578dbd mesa: skip bitmap drawing code if width==0 or height==0 2009-09-01 17:40:07 -06:00
Brian Paul
29e22059a9 intel: use _mesa_expand_bitmap() to skip an intermediate buffer 2009-09-01 17:39:32 -06:00
Brian Paul
d5b6dd0001 st/mesa: use new _mesa_expand_bitmap() function 2009-09-01 17:39:32 -06:00
Brian Paul
278e76832f mesa: new _mesa_expand_bitmap() function 2009-09-01 17:39:32 -06:00
Brian Paul
921bbfc942 mesa: remove redundant assignments 2009-09-01 17:39:32 -06:00
Brian Paul
457e427e32 mesa: more clean-ups 2009-09-01 17:39:32 -06:00
Brian Paul
84d6bed4d6 mesa: change conditional to match the previous one 2009-09-01 17:39:32 -06:00
Brian Paul
25e5a6f279 mesa: updated #includes 2009-09-01 17:39:32 -06:00
Brian Paul
95136694ab mesa: remove unused texenv_fragment_program::ctx field 2009-09-01 17:39:32 -06:00
Brian Paul
1480bcacfe mesa: remove unused ureg::abs field 2009-09-01 17:39:32 -06:00
Brian Paul
c7ba2b8622 mesa: remove unused ureg:negateabs field 2009-09-01 17:39:32 -06:00
Brian Paul
9ed0315271 mesa: more comments, clean-ups 2009-09-01 17:39:31 -06:00
Brian Paul
b5ec0a6858 mesa: simplify translate_tex_src_bit() 2009-09-01 17:39:31 -06:00
Brian Paul
f337e2c495 mesa: minor code clean-ups, comments 2009-09-01 17:39:31 -06:00
Brian Paul
d55a28e3dc mesa: replace 8 with MAX_TEXTURE_UNITS 2009-09-01 17:39:31 -06:00
Brian Paul
51334d8401 dri: remove unused meta_clear_tris() 2009-09-01 17:39:31 -06:00
Brian Paul
c2542cdaff intel: use BUFFER_BITS_COLOR 2009-09-01 17:39:31 -06:00
Brian Paul
5353961344 intel: fix incorrect parameter type for intel_bufferobj_map_range() 2009-09-01 17:39:31 -06:00
Brian Paul
85d3562385 radeon: trim down #includes 2009-09-01 17:39:31 -06:00
Brian Paul
18916986b4 radeon: use _mesa_meta_clear() 2009-09-01 17:39:30 -06:00
Brian Paul
92d63931e2 mesa: obey stencil write mask in _mesa_meta_draw_pixels() 2009-09-01 17:39:30 -06:00
Brian Paul
a1e869b417 intel: set Length/Offset fields in intel_bufferobj_map() 2009-09-01 17:39:30 -06:00
Brian Paul
15e6d08670 intel: use _mesa_meta_copy_pixels() when do_blit_copypixels() fails
Also, trim down #includes.
2009-09-01 17:39:30 -06:00
Brian Paul
be229d24c4 intel: trim down #includes 2009-09-01 17:39:30 -06:00
Brian Paul
886a0a7150 intel: use _mesa_meta_draw_pixels()
The textured quad path is slightly faster and will work with POT textures
on i945.
2009-09-01 17:39:30 -06:00
Brian Paul
90cba4a839 intel: trim down #includes 2009-09-01 17:39:30 -06:00
Brian Paul
50d8b295f6 intel: use _mesa_meta_clear(), it's a bit faster 2009-09-01 17:39:30 -06:00
Pauli Nieminen
06bf6628aa radeon: Fix OQ to set ful lstate as dirty too. 2009-09-02 02:04:10 +03:00
Pauli Nieminen
9f650e19dd radeon: Fix debug output to filter out less critical messages instead of more critical. 2009-09-02 02:04:10 +03:00
Zack Rusin
7e4487ad5c st/xorg: getting indexes right tends to be helpful 2009-09-01 19:01:05 -04:00
Zack Rusin
5c746d9214 st/xorg: redo the vertex shader 2009-09-01 18:59:01 -04:00
Zack Rusin
a8cbb15632 st/xorg: setup solid fills 2009-09-01 17:49:32 -04:00
Zack Rusin
811aa02c7a st/xorg: fold back the helper function into core 2009-09-01 14:44:55 -04:00
Zack Rusin
91c366359c st/xorg: start rendering and compositing pictures 2009-09-01 14:44:55 -04:00
Ian Romanick
847bc5c852 ARB prog parser: Fix handling of stateOptModMatNum
The optional array index should clearly be enclosed in square
brackets.  This helps the oglconform test vp_binding.c get a bit
farther, but it still fails.
2009-09-01 11:11:31 -07:00
Keith Whitwell
b3f4b56a3b tgsi: remove redundant CND0 opcode
Can be implemented with CMP src2, src1, src0
2009-09-01 17:30:01 +01:00
José Fonseca
836a9f0ae6 scons: Tool for LLVM. Gracefully disable llvmpipe if LLVM not found. 2009-09-01 12:26:00 +01:00
Jakob Bornecrantz
8c3f622a34 trace: Don't set surface_[fill|copy] if not set on pipe 2009-09-01 11:56:14 +02:00
Cooper Yuan
165e87c491 r300g: Fix clear issue on r300 2009-09-01 17:59:03 +08:00
Dave Airlie
7d36153766 radeon: fix r100/r200 polygon stipple under kms
There really need to use state emits under kms, otherwise
we end up with some dwords in the command buffer before we've
ever emitted any useful state.

Signed-off-by: Dave Airlie <airlied@redhat.com>
2009-09-01 16:06:02 +10:00
Dave Airlie
a2bd13fec9 r100: fixup cubemap domains 2009-09-01 15:18:17 +10:00
Brian Paul
ae5d78198f xlib: plug in more meta functions, if TEST_META_FUNCS is set 2009-08-31 21:15:39 -06:00
Brian Paul
056612241a mesa: implement GL_DEPTH_BUFFER_BIT for _mesa_meta_blit_framebuffer() 2009-08-31 21:15:39 -06:00
Brian Paul
7a78e6e8af mesa: disable another debug test 2009-08-31 21:15:38 -06:00
Brian Paul
5b0f7c6c3b mesa: make verts[] arrays local vars 2009-08-31 21:15:38 -06:00
Dave Airlie
97aa3d553f r200: emit cube for kms correctly + fix tex emit reset
CS checker found some issues.
2009-09-01 12:54:48 +10:00
Brian Paul
8126dfa9c2 xlib: option to enable/test meta functions (disabled) 2009-08-31 19:34:47 -06:00
Brian Paul
1fc713a1e7 mesa: implement depth/stencil formats for meta glDrawPixels 2009-08-31 19:34:47 -06:00
Brian Paul
9c41931c0f mesa: remove accidentally commited debug/disabled code 2009-08-31 19:34:47 -06:00
Brian Paul
10d81f4667 mesa: added _mesa_is_stencil_format() 2009-08-31 19:34:47 -06:00
Brian Paul
d762b5459b progs/samples: added test/debug code for culling 2009-08-31 19:34:47 -06:00
Brian Paul
a1d3855fb0 swrast: fix selection/feedback regression
This fixes a conform selection/feedback regression introduced by commit
8f4d66c5f8
2009-08-31 19:34:47 -06:00
Brian Paul
c0633ddabb mesa: debug printf for KIL 2009-08-31 19:34:47 -06:00
Brian Paul
b3232e9280 progs/tests: disable depth test for second glDrawPixels
We don't want to z-test that glDrawPixels.  Also, set the raster color to
red when drawing GL_DEPTH_COMPONENT image to aid in debugging.
2009-08-31 19:34:47 -06:00
Brian Paul
18656201ef swrast: can't use deferred texture/shading if using KIL instruction
If the fragment program uses KIL, we have to execute it before z/stencil
testing.  Otherwise, deferred texture/shading lets us skip shading for
pixels that fail z/stencil testing.
2009-08-31 19:34:47 -06:00
Dave Airlie
31a5a9e9cc r300/compiler: fix warning due to no newline 2009-09-01 10:50:40 +10:00
Dave Airlie
e3a17904dd r200: emit max vtx info for index buffer.
We need this for the CS bounds checking.
2009-09-01 10:50:31 +10:00
Jakob Bornecrantz
935e4c56e5 i915g: Implement new winsys 2009-09-01 00:47:02 +01:00
Jakob Bornecrantz
d2110064c2 i915g: Switch from pipe_winsys to intel_winsys
Also includes moving lots of functions from i915_batch.h
	into intel_batchbuffer.h
2009-09-01 00:47:02 +01:00
Jakob Bornecrantz
dd040753d7 i915g: Add header file for new winsys interface 2009-09-01 00:47:01 +01:00
Jakob Bornecrantz
105e4b093e i915g: Add new buffer code not yet hocked up 2009-09-01 00:46:56 +01:00
Jakob Bornecrantz
7b32da0b11 st/xorg: Fix crash in MPH 2009-09-01 00:44:36 +01:00
Pauli Nieminen
c4a3e036ed radeon: Fix null pointer reference in debug system if no context is bind. 2009-09-01 00:39:20 +03:00
Pauli Nieminen
d028cf9313 r600: Add more trace debug output to rendering pipeline. 2009-08-31 20:44:11 +03:00
Pauli Nieminen
fde929c4fd radeon: Add support for indenting debug output.
Indetion can be used to make it easier to read debug code when sections of debug output are indented.
2009-08-31 20:39:43 +03:00
Pauli Nieminen
7870edc778 radeon: Add comment warning about not choosing critical debug level. 2009-08-31 20:27:49 +03:00
Pauli Nieminen
6c963fbdd1 radeon: Change default debug level to verbose.
Verbose is a lot better for developement but we should considre changing it to normal in stable branch.
2009-08-31 20:27:49 +03:00
Pauli Nieminen
012e990160 r300: Convert to shared debug code. 2009-08-31 20:27:49 +03:00
Pauli Nieminen
239105c6c8 r200: Convert r200 to use new style debug code.
Only very few places where realy converted so there isa lot of to do.
2009-08-31 20:27:49 +03:00
Pauli Nieminen
aabb36fdd5 r600: Convert to shared debug code and add a few new debug messages.
There is only a few functions that have debugging enabled now.
2009-08-31 20:27:49 +03:00
Pauli Nieminen
fe62e4c3ff radeon: Make OQ to use new style debugging. 2009-08-31 20:27:48 +03:00
Pauli Nieminen
b6ebcf8156 radeon: Add gcc attribute to enable pritnf format warnings. 2009-08-31 20:27:48 +03:00
Pauli Nieminen
4e0d99a635 r100: Use shared debug code.
Converted r100 to use shared debug code with sed and fast compile check. New
code has compability layer so old debugging code doesn't have to be changed
all immidiatly.
2009-08-31 20:27:48 +03:00
Pauli Nieminen
f9a4a0a971 radeon: Add common debugging functions.
These function are aiming to make it very simple to add and keep large amount
of debugging code without having runtime impact in relase builds. Basic idea
is to expose simple printf style debugging functions that are inlined.

Level parameter will be evalueted in compile time so compiler can optimise
some of debugging functions out if compile time request for debug level is too
tight.
2009-08-31 20:27:48 +03:00
Brian Paul
a5e7003565 mesa: added const qualifiers, move local var 2009-08-31 11:22:36 -06:00
Brian Paul
956e6c3978 mesa: fix saturation logic in emit_texenv()
We need to clamp/saturate after each texenv stage, not just the last one.
Fixes glean texEnv failure for softpipe (and probably other fragment program-
based drivers).
2009-08-31 11:22:36 -06:00
Brian Paul
aca8dbcaa6 docs: fixed glXCreateGLXPixmap() for direct rendering 2009-08-31 11:22:36 -06:00
Brian Paul
1d64a4ceb3 docs/: document cross-compile fix 2009-08-31 11:22:36 -06:00
Marc Dietrich
c705e72382 mesa: fix 32bit cross compilation on a 64bit machine
When cross compiling on a 64bit machine, gen_matypes.c is build
for the host machine (64bit) but must generates code for the target
machine (32bit). This causes wrong offsets all over the place and
crashes googleearth on my machine. Solution is to add -m32 when
cross compiling.

Attached patch is compatible with linux-x86-32 and autoconf based
builds.
2009-08-31 11:22:36 -06:00
Zack Rusin
f315c0128b st/xorg: add code to render textured quads for composite acceleration 2009-08-31 13:26:01 -04:00
Zack Rusin
9ccbadb22d st/xorg: setup constant buffers for vertex and fragment shaders 2009-08-31 13:26:01 -04:00
Michel Dänzer
3c3ad915d8 st/xorg: Re-organize the EXA ModifyPixmapHeader hook a bit.
This should also handle the case where the pixmap is backed by a (different)
texture before and afterwards.
2009-08-31 18:41:54 +02:00
Michel Dänzer
40e3148a81 st/xorg: Simplify EXA ModifyPixmapHeader hook for pPixmap != NULL.
Just let the upper layers handle it.
2009-08-31 18:41:54 +02:00
Michel Dänzer
366efd8c4b st/xorg: Don't always fall back for solid fills. 2009-08-31 18:41:53 +02:00
Alex Deucher
1b1673fa63 r600: add missing r7xx pci id 2009-08-31 12:18:44 -04:00
Jakob Bornecrantz
5f7b46ae5f i915g: Reorg texture layout code 2009-08-31 16:29:59 +01:00
Jakob Bornecrantz
761c8c7076 i915g: Move transfer functions into i915_texture.c 2009-08-31 16:29:58 +01:00
Jakob Bornecrantz
5374aff56f i915g: Reorg texture code a bit 2009-08-31 16:29:58 +01:00
Jakob Bornecrantz
f260652153 i915g: Don't use winsys directly in the driver 2009-08-31 16:29:58 +01:00
Jakob Bornecrantz
bd0c51874f i915g: Cleanup i915_prim_vbuf.c 2009-08-31 16:29:58 +01:00
Jakob Bornecrantz
1bb3a2c648 i915g: Cleanup i915_screen.[c|h] 2009-08-31 16:29:58 +01:00
Jakob Bornecrantz
1b5f46a3b8 i915g: Cleanup i915_context.c 2009-08-31 16:29:58 +01:00
Jakob Bornecrantz
7864b0e717 i915g: Cleanup i915_blit.[c|h] 2009-08-31 16:29:58 +01:00
Jakob Bornecrantz
5d929366aa i915g: Cleanup i915_state_emit.c 2009-08-31 16:29:57 +01:00
Jakob Bornecrantz
00b0728094 i915g: Cleanup i915_texture.c 2009-08-31 16:29:57 +01:00
Jakob Bornecrantz
4224bda684 i915g: Cleanup texture init functions a bit 2009-08-31 16:29:57 +01:00
Jakob Bornecrantz
e1741dbe45 i915g: Rename pipe field on context to base 2009-08-31 16:29:57 +01:00
Jakob Bornecrantz
ad25d450ec i915g: Rename screen field on screen to base 2009-08-31 16:29:57 +01:00
Brian Paul
2b6ab615a4 mesa: set additional fields in _mesa_buffer_map_range() 2009-08-31 09:12:04 -06:00
Brian Paul
d1da8acd82 mesa: set Length/Offset fields in _mesa_buffer_map() 2009-08-31 09:05:28 -06:00
Brian Paul
822c796481 mesa: additional assertions for ctx->Driver.UnmapBuffer()
The Pointer, Offset and Lenght fields should be cleared by the driver function
since ctx->Driver.Unmap() may be called from VBO code, etc.
2009-08-31 09:01:58 -06:00
Brian Paul
28c159d614 intel: clear buffer fields in intel_bufferobj_unmap() 2009-08-31 09:01:44 -06:00
Brian Paul
92033a9516 mesa: new assertions, comments about buffer mapping
Since ctx->Driver.MapBuffer() and ctx->Driver.MapBufferRange() may be called
from other places in Mesa (such as VBO) it's important that the driver
callbacks set all the buffer object fields properly (Pointer, Offset, Length,
etc).  Add assertions to make sure that the driver does that.
2009-08-31 08:50:15 -06:00
Brian Paul
c69a4dce75 st/mesa: fix obj->Pointer offset in st_bufferobj_map_range()
This fixes a bunch of gallium regressions since
commit 8096aa5213
2009-08-31 08:49:24 -06:00
José Fonseca
241c3a1d80 llvmpipe: Fallback to element-wise comparisons when no comparison intrinsic is available.
Although selection of vector elements is valid LLVM IR, no machine target
supports it yet.

This is a last-resort option, but it allows llvmpipe to be used on any
target supported by LLVM without modifications. Obviously better
performance is attainable by emitting SIMD intrinsics where otherwise
LLVM doesn't.
2009-08-31 10:22:36 +01:00
José Fonseca
45fb66ab7b llvmpipe: In the abcense of a min/max intrinsic, use the comparison intrinsics. 2009-08-31 10:00:38 +01:00
José Fonseca
b995af25d0 llvmpipe: Actually commit lp_buffer.[ch].
Thanks Michel.
2009-08-31 09:34:04 +01:00
Michel Dänzer
9f0495aa76 Gallium xlib: Add support for BGRA visuals. 2009-08-31 10:22:19 +02:00
Ben Skeggs
1ea114958b nouveau: fix for dri state tracker changes 2009-08-31 13:39:45 +10:00
Ben Skeggs
02f3245448 nouveau: introduce nouveau_miptree common to all nouveau pipe drivers
The winsys once again has to know about textures it seems, so we need a
common representation between all our pipe drivers to store some
information the winsys will need.

Only the nv50 driver has been fixed so far.
2009-08-31 13:39:38 +10:00
Ben Skeggs
500b260494 nouveau: hack winsys to compile again, it's broken still however 2009-08-31 12:55:56 +10:00
Marc Dietrich
a192da37ed cell: fix compilation 2009-08-30 09:24:27 -06:00
Brian Paul
d6b8664e3c swrast: minor code consolidation 2009-08-30 09:21:20 -06:00
Brian Paul
04f8193aad mesa: consolidate texture-related code in meta.c
Also, allow using texture rectangles, NPOT textures or regular POT textures
(preferred in that order).
2009-08-30 09:15:24 -06:00
Brian Paul
7dd6fa12e1 progs/util: minor updates to glutskel.c 2009-08-30 09:10:36 -06:00
Brian Paul
a068e098e2 intel: use more efficient loop over buffers 2009-08-30 09:10:36 -06:00
Brian Paul
0243f79eac mesa: avoid redundant viewport changes in meta code 2009-08-30 09:10:36 -06:00
José Fonseca
c28f253ac2 llvmpipe: Texture cache in 4 ubytes instead of 4 floats.
This is more a short term experiment than a long term commitment, as we'll
need to support higher precision textures too, as this will all be
be replaced by runtime generated code.

With this change most Mesa demos fps increased around 10%. Not a huge
improvement, but not a negligible one either.
2009-08-30 12:37:03 +01:00
José Fonseca
62b586fce4 llvmpipe: Use util_format_read_4f to read texture tiles. 2009-08-30 12:37:03 +01:00
José Fonseca
ffe1b7bad8 llvmpipe: Texture cache is read-only. No need to flush. 2009-08-30 12:37:03 +01:00
José Fonseca
3d30524393 util: Auto generate pixel format accessor functions from
This has several advantages over the u_
 - not hand written
 - no intermediate memcpy of raw pixels
 - supports 4 ubytes in addition to floats
 - no need to pass a pipe_transfer

It also has (hopefully temporary) limitations:
 - no support for YUV
 - no support for SRGB
2009-08-30 12:37:03 +01:00
José Fonseca
379304a72c llvmpipe: Eliminate internal pipe_buffer_map/unmap usage. 2009-08-30 12:37:03 +01:00
José Fonseca
d336ef410a xlib: Implement lp_winsys::destroy. 2009-08-30 12:37:03 +01:00
Michel Dänzer
9053bb0d40 Merge branch 'mesa_7_5_branch'
Conflicts:
	src/glx/x11/glxcmds.c
2009-08-30 13:06:18 +02:00
Eric Anholt
3c1172f066 i965: Fix segfault with ARB_oq CheckQuery when results are already fetched. 2009-08-29 13:29:38 -07:00
Eric Anholt
09549704c6 i965: Support PROGRAM_ENV_PARAMs in brw_vs_emit.c 2009-08-29 13:29:38 -07:00
José Fonseca
c9adb4c9cb llvmpipe: List lp_buffer.c in the Makefile. 2009-08-29 20:07:53 +01:00
José Fonseca
85a0a4b296 xlib: Implement llvmpipe lp_winsys interface. 2009-08-29 20:03:44 +01:00
José Fonseca
e173a9bbd6 llvmpipe: Define an winsys for LLVM. Drop pipe_winsys
lp_winsys will eventually be unified with softpipe's eventually, but we
are free to move quicker since we don't have the myriad of users yet.

Will provide a pipe_winsys adaptor from Keith's softpipe-private-winsys
soon.
2009-08-29 20:03:44 +01:00
Pauli Nieminen
e48dc9c5ed r300: Disable threshold register for KMS.
Kernel side doesn't have required register in safe list so can't send it kernel.
2009-08-29 21:05:22 +03:00
Pauli Nieminen
9c0ab1fa85 r300: Swtcl prediction was still missing scissors.
All that state stuff should really be in state atoms :/
2009-08-29 21:05:19 +03:00
Pauli Nieminen
32df8922a9 r300: Add missing pre_emit_count to swtcl state size prediction. 2009-08-29 18:40:44 +03:00
Christoph Bumiller
8313801911 nv50: set provoking vertex state 2009-08-29 17:22:12 +02:00
José Fonseca
da1248bee5 xlib: Update llvmpipe integration for changes in master. 2009-08-29 09:21:42 +01:00
José Fonseca
f04ce6276b llvmpipe: Update for changes in master. 2009-08-29 09:21:42 +01:00
José Fonseca
6818eb9b90 mesa: Update sconscript for new ARB/FP assembler. 2009-08-29 09:21:42 +01:00
José Fonseca
fdb3e75f7e util: Add util_unsigned_logbase2.
Cherry picked from Keith's commit f911c3b989.
2009-08-29 09:21:42 +01:00
José Fonseca
c40eddd294 llvmpipe: Isolate sampling from TGSI translation. 2009-08-29 09:21:42 +01:00
José Fonseca
d4806c64a2 llvmpipe: Better structure dereference naming. 2009-08-29 09:21:42 +01:00
José Fonseca
8aa62cead7 llvmpipe: Fix shader variant key construction.
Fixes the blank screen on non-64bit mode.
2009-08-29 09:21:42 +01:00
José Fonseca
1e6cc1cf37 llvmpipe: Fix build. 2009-08-29 09:21:42 +01:00
José Fonseca
f311bacebd llvmpipe: Merge all pixel format related files. 2009-08-29 09:21:42 +01:00
José Fonseca
f85c5f8621 llvmpipe: Factor out and optimize the input interpolation.
Special attention is given to the interpolation of side by side quads.
Multiplications are made only for the first quad. Interpolation of
inputs for posterior quads are done exclusively with additions, and
perspective divide if necessary.
2009-08-29 09:21:41 +01:00
José Fonseca
03180dca7a llvmpipe: Pre-declare fetch_texel. 2009-08-29 09:21:41 +01:00
José Fonseca
635c37e118 llvmpipe: Pass the alpha ref value and blend color in the jit context. 2009-08-29 09:21:41 +01:00
José Fonseca
c022e15d1e llvmpipe: Pass fragment context to generated function in a single structure. 2009-08-29 09:21:41 +01:00
José Fonseca
8c7c108d71 llvmpipe: Structure manipulation helpers. 2009-08-29 09:21:41 +01:00
José Fonseca
08dd41fd68 llvmpipe: Centralize the C <-> JIT interfaces in one place. 2009-08-29 09:21:41 +01:00
José Fonseca
97b4681d7e llvmpipe: Drop blend derived state.
Already included in the fragment shader.
2009-08-29 09:21:41 +01:00
Keith Whitwell
04de13b9cd llvmpipe: keep texture stride 16byte aligned
Fixes crash when resizing gears window.
2009-08-29 09:21:41 +01:00
José Fonseca
4d2b0eb19e llvmpipe: Squash the quad pipeline.
It had been reduced to one fixed stage.
2009-08-29 09:21:41 +01:00
José Fonseca
77b35dc179 llvmpipe: s/uni/scalar/.
More obvious name.
2009-08-29 09:21:40 +01:00
José Fonseca
5811ed87d7 llvmpipe: Add a bunch of comments.
Description/rationale/to-do items, while I still remember them...
2009-08-29 09:21:40 +01:00
José Fonseca
3f36f4b051 llvmpipe: Split off vs stuff from lp_state_fs.c.
lp_state_fs.c is already too big without it.
2009-08-29 09:21:40 +01:00
José Fonseca
c3b7406667 llvmpipe: Avoid duplicate clamping when converting between types. 2009-08-29 09:21:40 +01:00
José Fonseca
9897180279 llvmpipe: Generate the fragment pipeline into a single function.
Still hackish. Will document and optimize later.
2009-08-29 09:21:40 +01:00
José Fonseca
64cc71167f llvmpipe: Get conversions working correctly for all integer types. 2009-08-29 09:21:39 +01:00
José Fonseca
53f9a1180e llvmpipe: Delete the quad polygon stipple stage.
Not used now -- stipple done by the draw module. May code generate later.
2009-08-29 09:21:39 +01:00
José Fonseca
3d7a88674f llvmpipe: Early depth testing. 2009-08-29 09:21:39 +01:00
José Fonseca
90b5df8d1b llvmpipe: Disassemble beyond referred code beyond the RET instruction. 2009-08-29 09:21:39 +01:00
José Fonseca
c5531f575b llvmpipe: Split control flow function declarations and notes. 2009-08-29 09:21:39 +01:00
José Fonseca
1e4376a68f llvmpipe: Back port recent softpipe-opt improvements from Keith. 2009-08-29 09:21:39 +01:00
José Fonseca
f10ee9a0a1 llvmpipe: Don't limit the number of tiles in the cache. 2009-08-29 09:21:39 +01:00
José Fonseca
87c383a2e5 llvmpipe: Clean dead tile cache code. 2009-08-29 09:21:39 +01:00
José Fonseca
e3baeb3f14 llvmpipe: Simplify tile clears. Use pipe_fill_rect instead of scratch tile. 2009-08-29 09:21:38 +01:00
José Fonseca
d94fbb4a48 llvmpipe: Start hiding llvmpipe_cached_tile. 2009-08-29 09:21:38 +01:00
José Fonseca
1cb9ce0d27 llvmpipe: Drop depth/stencil support from tile cache. 2009-08-29 09:21:38 +01:00
José Fonseca
e3b38e5ec1 llvmpipe: Code generate the depth test, and include in the shader.
Only 32bit depth/stencil surfaces supported for now. Stencil ops not
implemented yet.
2009-08-29 09:21:38 +01:00
José Fonseca
db35ac36d9 llvmpipe: Update texture block from format. 2009-08-29 09:21:38 +01:00
José Fonseca
343ccc8dd0 llvmpipe: Depth test to LLVM IR translation. 2009-08-29 09:21:38 +01:00
José Fonseca
c0472f9c34 llvmpipe: Centralize mask update logic. 2009-08-29 09:21:37 +01:00
José Fonseca
3dbf00f9ab llvmpipe: Clamped float to unsigned norm via mantissa manipulation. 2009-08-29 09:21:37 +01:00
José Fonseca
33ce51bc0d llvmpipe: Several fixes of the conversion test. 2009-08-29 09:21:37 +01:00
José Fonseca
d07b038366 llvmpipe: Generate instrinsics for integer comparisons.
It is a little messy, given the available instrucions form SIMD
integer comparisons is rather limited.
2009-08-29 09:21:37 +01:00
José Fonseca
89146cd48d llvmpipe: Mention the ability to get microbenchmarks from the unit tests.
Even better would be to have a -h/--help option to the tests...
2009-08-29 09:21:37 +01:00
José Fonseca
9ae47069b4 llvmpipe: Code generate alpha testing and append to generated fragment shader. 2009-08-29 09:21:37 +01:00
José Fonseca
b5e397c369 util: Dump PIPE_FUNC_x value names. 2009-08-29 09:21:37 +01:00
Brian Paul
d6d4f8b66e llvmpipe: use the udis86 lib to print the x86 assembly code 2009-08-29 09:21:36 +01:00
Brian Paul
03b388e1c9 llvmpipe: frag shader comments 2009-08-29 09:21:36 +01:00
Brian Paul
0f6c621aee llvmpipe: blend comments 2009-08-29 09:21:36 +01:00
Brian Paul
8329e59958 llvmpipe: comments about blend generator 2009-08-29 09:21:36 +01:00
Brian Paul
f586d9546b llvmpipe: basic comments 2009-08-29 09:21:36 +01:00
José Fonseca
b9f2f01315 llvmpipe: Hack to force the line/point rasterization also fit the blend function expectations. 2009-08-29 09:21:35 +01:00
José Fonseca
7643da88a3 llvmpipe: Refer my udis86 branch which decodes more opcodes. 2009-08-29 09:21:35 +01:00
José Fonseca
7c2dc3faa8 llvmpipe: Code generate the position interpolation. 2009-08-29 09:21:35 +01:00
José Fonseca
6f5cd15f80 llvmpipe: Simpler variant of lp_build_broadcast_scalar. 2009-08-29 09:21:35 +01:00
José Fonseca
17baa01bfb llvmpipe: Put the position coefficients together with the inputs.
The automatic search'n'replace leaves lp_setup.c a bit ugly, but this code
will be eventually code generated as well.
2009-08-29 09:21:35 +01:00
José Fonseca
7926b42d41 llvmpipe: Implement saturation. 2009-08-29 09:21:35 +01:00
José Fonseca
39352b3443 llvmpipe: Put color/depth directly into the quad structure. 2009-08-29 09:21:35 +01:00
Brian Paul
4c6fd574b1 llvmpipe: re-enable other gallium drivers
No more symbol collisions between drivers, AFAICT.
2009-08-29 09:21:35 +01:00
Brian Paul
908d8d7a1b llvmpipe: prefix point/line/tri_setup() functions with llvmpipe_
Avoid symbol collisions with softpipe.
2009-08-29 09:21:35 +01:00
Brian Paul
1ea1cd8468 llvmpipe: repurpose linux-llvm config to build the llvmpipe driver
The gallivm module is no longer built.  If/when gallivm is resuscitated we
can revisit this.
2009-08-29 09:21:35 +01:00
Brian Paul
137afe6a55 llvmpipe: updated Makefile C_SOURCES 2009-08-29 09:21:34 +01:00
Brian Paul
aa2514d12d llvmpipe: add missing break in xlib _init() 2009-08-29 09:21:34 +01:00
José Fonseca
556eecea67 llvmpipe: Allow to build without udis86. 2009-08-29 09:21:34 +01:00
José Fonseca
2fef9b3369 llvmpipe: Drop the FETCH/STORE macros. 2009-08-29 09:21:34 +01:00
José Fonseca
5999ebfb69 llvmpipe: Debug helper function to name llvm intermediate values. 2009-08-29 09:21:34 +01:00
Keith Whitwell
a22f87c994 llvmpipe: use align_malloc for all structs containing ALIGN16 members
Unless the struct is allocated aligned, aligning the members isn't very
helpful.
2009-08-29 09:21:34 +01:00
José Fonseca
49d83fdc45 llvmpipe: Document that llvm 2.5 is expected. 2009-08-29 09:21:34 +01:00
José Fonseca
8df64bb2fe llvmpipe: Briefly describe current status. 2009-08-29 09:21:34 +01:00
José Fonseca
bb867b0ae4 llvmpipe: Blend in place. 2009-08-29 09:21:34 +01:00
José Fonseca
4a414d8f87 llvmpipe: Code generate logic ops. 2009-08-29 09:21:34 +01:00
José Fonseca
3014919211 llvmpipe: Rasterize the quads according to what the blend function expects. 2009-08-29 09:21:34 +01:00
José Fonseca
efab431684 llvmpipe: Tile in SoA format identical to the blender function output. 2009-08-29 09:21:34 +01:00
José Fonseca
ee066eaf6d llvmpipe: Allow to dump the disassembly byte code.
Useful as dis86 doesn't disassemble some SSE4 opcodes yet.
2009-08-29 09:21:33 +01:00
José Fonseca
c5abcac7ef llvmpipe: Implement LIT. 2009-08-29 09:21:33 +01:00
José Fonseca
09a7b011ac llvmpipe: Move lp_build_select to lp_bld_logic.[ch]. 2009-08-29 09:21:33 +01:00
José Fonseca
1aae039ee2 llvmpipe: Implement comparison opcodes. 2009-08-29 09:21:33 +01:00
José Fonseca
aede39efd8 llvmpipe: Fix translation of KIL with repeated swizzles. 2009-08-29 09:21:33 +01:00
José Fonseca
81e7ec485d llvmpipe: Handle floating point selection. 2009-08-29 09:21:33 +01:00
José Fonseca
4d7a8194c5 llvmpipe: Silence compiler warnings. 2009-08-29 09:21:33 +01:00
José Fonseca
7821664b15 llvmpipe: Implement KIL. 2009-08-29 09:21:33 +01:00
José Fonseca
2c90652ed9 llvmpipe: More verbose error message when failed to translate opcodes. 2009-08-29 09:21:33 +01:00
José Fonseca
58f20b2b65 llvmpipe: Detect typos in LLVM intrinsics early. 2009-08-29 09:21:33 +01:00
José Fonseca
1aede69d3a llvmpipe: Comparisons translation. 2009-08-29 09:21:33 +01:00
José Fonseca
818d444e12 llvmpipe: Disassemble generated x86 code. 2009-08-29 09:21:32 +01:00
José Fonseca
a7f9b915ae llvmpipe: Shader function arguments don't alias. 2009-08-29 09:21:32 +01:00
José Fonseca
539c55da16 llvmpipe: Test only present functionality to allow regression testing. 2009-08-29 09:21:32 +01:00
José Fonseca
c67570ba85 llvmpipe: Clamp into range when writing integers. 2009-08-29 09:21:32 +01:00
José Fonseca
17aec9304c llvmpipe: Compute interpolation coeffs directly into SoA layout. 2009-08-29 09:21:32 +01:00
José Fonseca
b6f43b445b llvmpipe: Pass the interpolation factors as scalars. 2009-08-29 09:21:32 +01:00
José Fonseca
1a004142bb llvmpipe: Eliminate dependency on tgsi_exec_machine. 2009-08-29 09:21:32 +01:00
José Fonseca
73af91e938 llvmpipe: Eliminate non-LLVM fs execution paths. 2009-08-29 09:21:32 +01:00
José Fonseca
95f38dd67c llvmpipe: Code generate interpolators. 2009-08-29 09:21:32 +01:00
José Fonseca
af608e56ca llvmpipe: Factor out lp_build_select from lp_build_select_aos. 2009-08-29 09:21:31 +01:00
José Fonseca
57907e7fd9 llvmpipe: Translate approximate log2/exp2. 2009-08-29 09:21:31 +01:00
José Fonseca
ef1fddb36a llvmpipe: Handle a few more TGSI opcodes. 2009-08-29 09:21:31 +01:00
José Fonseca
844f802a70 llvmpipe: Efficient implementations of pow/exp/log/exp2/log2 2009-08-29 09:21:31 +01:00
José Fonseca
90e9a4d4f9 llvmpipe: Migrate more SSE2 codegen to LLVM IR. 2009-08-29 09:21:31 +01:00
José Fonseca
1b3c83d699 llvmpipe: Don't assume/enforce fs values are in [0,1] range. 2009-08-29 09:21:30 +01:00
José Fonseca
1709ace359 llvmpipe: Implement more arithmetic functions. 2009-08-29 09:21:30 +01:00
José Fonseca
1929057eac llvmpipe: Reuse coord/texel store. 2009-08-29 09:21:30 +01:00
José Fonseca
0b6a9b2dbe llvmpipe: Replace lp_fs_llvm.c.
Based on lp_fs_exec.c/lp_fs_sse.c and tgsi_exec.c.
2009-08-29 09:21:30 +01:00
José Fonseca
63b07618b3 llvmpipe: TGSI -> LLVM SoA IR converstion.
Based on tgsi_sse2.c.
2009-08-29 09:21:30 +01:00
José Fonseca
9033c44a62 llvmpipe: Dump only the generated function. 2009-08-29 09:21:29 +01:00
José Fonseca
4393ca7956 llvmpipe: Scalar -> vector broadcasting. 2009-08-29 09:21:29 +01:00
José Fonseca
8422f293ab llvmpipe: More arithmetic ops.
Mostly untested.
2009-08-29 09:21:29 +01:00
José Fonseca
36249348ed llvmpipe: More intrinsic helpers. 2009-08-29 09:21:29 +01:00
José Fonseca
50d77141e8 llvmpipe: Fix typo. 2009-08-29 09:21:29 +01:00
José Fonseca
81644f6315 util: Fix SCons build. 2009-08-29 09:21:28 +01:00
José Fonseca
19b31d0ac8 llvmpipe: Document the typo in llvm-c/Core.h. 2009-08-29 09:21:28 +01:00
José Fonseca
fb56786f60 util: Auto-generate u_format_table.c from SConscript. 2009-08-29 09:21:28 +01:00
José Fonseca
9285f159e0 llvmpipe: Simple description/instructions. 2009-08-29 09:21:28 +01:00
José Fonseca
8edcc8abe3 llvmpipe: Add missing include. 2009-08-29 09:21:27 +01:00
José Fonseca
2101c2941c llvmpipe: Tiles in rgba8 format. 2009-08-29 09:21:27 +01:00
José Fonseca
3ce1abf950 llvmpipe: Store tile color in SoA. 2009-08-29 09:21:27 +01:00
José Fonseca
29d94a9cbb llvmpipe: Code generate color masking. 2009-08-29 09:21:27 +01:00
José Fonseca
2d6b39f05e llvmpipe: Use the generated SoA blending code. 2009-08-29 09:21:27 +01:00
José Fonseca
e7fc21434d llvmpipe: Handle disabled blending too. 2009-08-29 09:21:27 +01:00
José Fonseca
62c91998ef xlib: Ensure one screen instance. 2009-08-29 09:21:27 +01:00
José Fonseca
0318f3e53e llvmpipe: Split the texture cache from the color/depth/stencil cache. 2009-08-29 09:21:27 +01:00
José Fonseca
b836b2593c xlib: Complete llvmpipe integration. 2009-08-29 09:21:27 +01:00
José Fonseca
2529ed5616 llvmpipe: SoA blending.
Throughput seems to be 4x higher.
2009-08-29 09:21:27 +01:00
José Fonseca
20f50b845b util: Fix blend factor dumping. 2009-08-29 09:21:26 +01:00
José Fonseca
3130b9921c llvmpipe: Update blending test. 2009-08-29 09:21:26 +01:00
José Fonseca
60584affcf llvmpipe: Handle more conversions.
Not all successfully yet though..
2009-08-29 09:21:26 +01:00
José Fonseca
145de19548 llvmpipe: Use full set of sse4 min/max intrinsics. 2009-08-29 09:21:26 +01:00
José Fonseca
a9771d2b75 llvmpipe: Fix one const generation for some signed integers. 2009-08-29 09:21:26 +01:00
José Fonseca
8244d6e5ad llvmpipe: Allow floating types without sign.
With the meaning that all values are assumed to be positive.
2009-08-29 09:21:26 +01:00
José Fonseca
9493260fdc llvmpipe: Centralize lp_build_context initialization. 2009-08-29 09:21:25 +01:00
José Fonseca
b07d19a885 llvmpipe: Normalize the cycles with the number of channel.
So that we have a comparable number for different formats.
2009-08-29 09:21:25 +01:00
José Fonseca
b874a7b807 llvmpipe: Handle ubyte -> float conversion too. 2009-08-29 09:21:25 +01:00
José Fonseca
b441a0b658 llvmpipe: Make lp_const_offset visible. 2009-08-29 09:21:24 +01:00
José Fonseca
684a47f0f6 llvmpipe: Only get the preprocessor flags from llvm-config.
Otherwise we get -O2 optimization flag, preventing proper debugging.
2009-08-29 09:21:24 +01:00
José Fonseca
8988424ee8 llvmpipe: Bootstrap type conversions. 2009-08-29 09:21:24 +01:00
José Fonseca
b19cb0080c llvmpipe: Use same type for reference vectors. 2009-08-29 09:21:24 +01:00
José Fonseca
d52dce0ffb llvmpipe: Fix floating point const scale factor. 2009-08-29 09:21:24 +01:00
José Fonseca
e6ebebc485 llvmpipe: Factor out shared test code into a separate module. 2009-08-29 09:21:24 +01:00
José Fonseca
138428bade llvmpipe: Cleanup constant helpers. 2009-08-29 09:21:23 +01:00
José Fonseca
627d6a6b04 llvmpipe: Move intrinsic helpers to a separate module. 2009-08-29 09:21:23 +01:00
José Fonseca
1165c30dc2 llvmpipe: Collect richer blend data. 2009-08-29 09:21:23 +01:00
José Fonseca
28e46458bc llvmpipe: Some notes about PSHUF. 2009-08-29 09:21:23 +01:00
José Fonseca
1dd7bb17c7 llvmpipe: Optimize blend swizzles by using bitmasks instead of shuffles for ubytes. 2009-08-29 09:21:23 +01:00
José Fonseca
a77084ea4b llvmpipe: Write data to a tsv file for posterior analysis. 2009-08-29 09:21:23 +01:00
José Fonseca
f081bacc25 llvmpipe: Move p_build_context to lp_bld_type.h
As it will be shared with more modules.
2009-08-29 09:21:23 +01:00
José Fonseca
696f7f2be5 util: New file dedicated to dump state in human/machine readable format. 2009-08-29 09:21:23 +01:00
José Fonseca
5940ba26f7 llvmpipe: Don't use llvm.readcyclecounter.
LLVM during optimization reorders the rdtsc instructions next to each
other, which makes it pretty useless.
2009-08-29 09:21:22 +01:00
José Fonseca
64611e086d llvmpipe: Separate constant building. 2009-08-29 09:21:22 +01:00
José Fonseca
c87fab0008 llvmpipe: Move type support functions into a separate file. 2009-08-29 09:21:22 +01:00
José Fonseca
b94e22e4be llvmpipe: Measure the number of cycles taken for blending. 2009-08-29 09:21:22 +01:00
José Fonseca
5778970f15 llvmpipe: Minor comments / debug mnemonics. 2009-08-29 09:21:22 +01:00
José Fonseca
02eaa32d83 llvmpipe: Optimize away min/max with equal operands. 2009-08-29 09:21:22 +01:00
José Fonseca
9e92244440 llvmpipe: Improve generated 8bit blending code. 2009-08-29 09:21:22 +01:00
José Fonseca
ede73258a7 llvmpipe: Get blending of normalized 8bit unsigned integers working. 2009-08-29 09:21:22 +01:00
José Fonseca
a6622e6c54 llvmpipe: Specialize arithmetic operations. 2009-08-29 09:21:22 +01:00
José Fonseca
272dadbe4e llvmpipe: Introduce a custom typing system.
Straightforward representation of floating-point/fixed-point/integer,
normalized/scaled, signed/unsigned SIMD vector types.
2009-08-29 09:21:22 +01:00
José Fonseca
f478b6fe76 llvmpipe: Avoid C99-isms. 2009-08-29 09:21:21 +01:00
José Fonseca
fe90e46dc9 llvmpipe: Factor out intrisic calling code into a reusable function. 2009-08-29 09:21:21 +01:00
José Fonseca
7ace0b1f4a llvmpipe: Cleanup test programs. 2009-08-29 09:21:21 +01:00
José Fonseca
7d043162c5 llvmpipe: Blending.
The code
2009-08-29 09:21:21 +01:00
José Fonseca
d2cf3e8dfd llvmpipe: Arithmetic helpers. 2009-08-29 09:21:21 +01:00
Keith Whitwell
fa3514a57e llvmpipe: fastpath for interpolated z16 less depthtesting
Because this is interpolated (ie. early) depth, we can build in an
assumption about the quads emitted by triangle setup, ie that they
are actually linear spans.  Interpolate z over those spans in z16
format to save on math & conversion.
2009-08-29 09:21:21 +01:00
Keith Whitwell
38a1479fe1 llvmpipe: cope with nr_cbufs == 0
Disable blend code when no color buffer
2009-08-29 09:21:21 +01:00
José Fonseca
4639f8aad5 llvmpipe: Translate logicops. 2009-08-29 09:21:21 +01:00
José Fonseca
833323b8d0 llvmpipe: Separate pixel packing/unpacking from loading/storing. 2009-08-29 09:21:21 +01:00
José Fonseca
c4903ee27f xlib: Integrate with llvmpipe.
Actually, the makefile/sconscript changes were already commit by mistake.
2009-08-29 09:21:21 +01:00
José Fonseca
b060771612 llvmpipe: Adjust for pixel layout changes. 2009-08-29 09:21:20 +01:00
José Fonseca
42b15b26fd util: Make pixel format layout more meaningful.
Namelly, explicitly distinguish formats coded by arithmetic manipulation,
from formats layed out in array.
2009-08-29 09:21:20 +01:00
José Fonseca
a910c7d820 util: Don't commit u_format_table.c
At least not until stabilizes, to reduce noise.
2009-08-29 09:21:20 +01:00
José Fonseca
9a519ec4d1 llvmpipe: Fix typo in copyright. 2009-08-29 09:21:20 +01:00
José Fonseca
3ef44746fe llvmpipe: Add test cases for pixels.
Actually some of this test cases need more testing...
2009-08-29 09:21:20 +01:00
José Fonseca
899bee2788 util: Fix r5g6b5 description. 2009-08-29 09:21:19 +01:00
José Fonseca
3ace63c00f llvmpipe: Update SConscript. 2009-08-29 09:21:19 +01:00
José Fonseca
b023c1dc68 llvmpipe: Simple shell script to aid port softpipe changes to llvmpipe. 2009-08-29 09:21:19 +01:00
Keith Whitwell
05bfd93c3f llvmpipe: move all depth/stencil/alpha pixel processing into one stage 2009-08-29 09:21:19 +01:00
Keith Whitwell
b8c437f20f llvmpipe: fix error in scissor state dependencies 2009-08-29 09:21:18 +01:00
Keith Whitwell
c5375da1dc llvmpipe: cleanup framebuffer state routine slightly 2009-08-29 09:21:18 +01:00
Keith Whitwell
90caf1a3f3 llvmpipe: move all color-combine code into lp_quad_blend.c
Consolidate the read-modify-write color combining code from
the blend, colormask and output stages.
2009-08-29 09:21:18 +01:00
Keith Whitwell
54c6ef144f llvmpipe: fix typo 2009-08-29 09:21:18 +01:00
Keith Whitwell
3c71a19016 llvmpipe: example fastpaths in blending 2009-08-29 09:21:18 +01:00
Keith Whitwell
80eb276630 llvmpipe: actually pass >1 quad from triangle routine
First attempt
2009-08-29 09:21:18 +01:00
Keith Whitwell
bdbb4beb21 llvmpipe: expand quad pipeline to process >1 quad at a time
This is part one -- we still only pass a single quad down, but
the code can now cope with more.  The quads must all be from the same
tile.
2009-08-29 09:21:18 +01:00
Keith Whitwell
4486012245 llvmpipe: rip out old mulithread support 2009-08-29 09:21:18 +01:00
Keith Whitwell
2a7c39a211 llvmpipe: avoid flushing depth buffer cache on swapbuffers
There's no need to push out depth buffer contents on swapbuffers.

Note that this change doesn't throw away depth buffer changes, it simply
holds them in the cache over calls to swapbuffers.  The hope is
that swapbuffers will be followed by a clear() which means in that case
we won't have to write the changes out.
2009-08-29 09:21:17 +01:00
Keith Whitwell
3adca96114 llvmpipe: also shortcircuit non-texture tile lookups 2009-08-29 09:21:17 +01:00
Keith Whitwell
2301314e7c llvmpipe: shortcircuit repeated lookups of the same tile
The lp_tile_cache is often called repeatedly to look up the same
tile.  Add a cache (to the cache) of the single tile most recently
retreived and make a quick inline check to see if this matches the
subsequent request.

Add a tile_address bitfield struct to make this check easier.
2009-08-29 09:21:17 +01:00
Keith Whitwell
df1823ec5b llvmpipe: remove unused vars in lp_setup.c 2009-08-29 09:21:17 +01:00
Keith Whitwell
08811032c2 llvmpipe: use bitwise logic to setup quad masks in lp_setup 2009-08-29 09:21:17 +01:00
Keith Whitwell
0aa24fa36f llvmpipe: simplify flush_spans
No loss of performance, but simpler code.
2009-08-29 09:21:17 +01:00
Keith Whitwell
0f55a95b2f llvmpipe: make some small steps to flush texture cache less frequently
No performance gain yet, but the code is a bit cleaner.
2009-08-29 09:21:16 +01:00
Keith Whitwell
3121484a8b llvmpipe: remove backwards dependency from tilecache to llvmpipe
The tile cache is a utility, it shouldn't know anything about the
entity which is making use of it (ie llvmpipe).

Remove llvmpipe parameter to all the tilecache function calls, and
also remove the need to keep a llvmpipe pointer in the sampler structs.
2009-08-29 09:21:16 +01:00
José Fonseca
c9a5930fe4 llvmpipe: Rename preprocessor symbols too. 2009-08-29 09:21:16 +01:00
José Fonseca
8783732c4d llvmpipe: Pixel packing/unpacking and loop code generators.
Just a small proof of concept plus a standalone test app. Not integrated
with the rest of the driver yet.
2009-08-29 09:21:16 +01:00
José Fonseca
15422b2d99 util: Pixel format database.
There are some inconsistencies in pipe_format, but above all, there
simply aren't enough bits in an enum to conveniently store all
information about a pixel format we need to be able to dynamically
generate pixel packing/unpacking code.
2009-08-29 09:21:15 +01:00
José Fonseca
946f432a08 llvmpipe: Fork softpipe for experimentation with llvm. 2009-08-29 09:21:15 +01:00
Ian Romanick
1814d6b49c Put 'extern' first on the line to silence GCC warnings. 2009-08-28 20:12:36 -07:00
Eric Anholt
00413d8742 i965: Use VBOs in the VBO module on 965, now that we have ARB_map_buffer_range.
This looks like it's a small win on blender.
2009-08-28 15:29:35 -07:00
Eric Anholt
8096aa5213 vbo: Fix array pointer calculation for MapBufferRange-mapped vertex data.
We would end up with the offset from the start of the mapping rather than
the offset from the start of the buffer.
2009-08-28 15:29:35 -07:00
Eric Anholt
2d5c74fac3 intel: Add support for GL_ARB_map_buffer_range.
Passes glean's bufferObject test, and should provide good performance in the
cases applications are expected to use.
2009-08-28 15:29:35 -07:00
Eric Anholt
446a226f9f i965: Implement ARB_oq CheckQuery in the intended way.
Previously we blocked because I hadn't added the libdrm function.  Now it's
there, so update your libdrm.
2009-08-28 15:29:34 -07:00
Pauli Nieminen
0926a5f4a1 radeon: Fix swtcl emit pediction.
Problem was to find the correct place to run prediction. Only place that is
called for every primitive is ALLOC_VERTS so we have to do prediction there
before allocation.
2009-08-29 00:46:57 +03:00
Jakob Bornecrantz
55e7abf81f i915g: Add cursor case for scanout layout 2009-08-28 22:41:53 +01:00
Jakob Bornecrantz
644060c025 i915g: Don't forget to init buffer ptrs 2009-08-28 22:41:52 +01:00
Zack Rusin
aaedd035ca st/xorg: disable composite accelration for now 2009-08-28 16:19:53 -04:00
Zack Rusin
0a26811286 st/xorg: bind samplers before composition 2009-08-28 15:43:46 -04:00
Zack Rusin
f1c0a4b2f4 st/xorg: normalize coords for the src operands in the vertex shader 2009-08-28 15:36:33 -04:00
Pauli Nieminen
4f644e58d4 radeon: Fix scissors for dri1.
DRI1 has to set scissors in framebuffer coordinates.
2009-08-28 22:05:15 +03:00
Joakim Sindholt
dbe58d7f9f r300g: pretty up the new drm code a bit
As it turns out, I made some boners. This corrects them (I hope)
2009-08-28 20:05:52 +02:00
Jakob Bornecrantz
1e9eb69f83 st/xorg: If migrating from a sw pixmap to a hw pixmap upload old contents 2009-08-28 17:10:58 +02:00
Jakob Bornecrantz
d80242c254 st/xorg: Null devPrivate.ptr when unmapping 2009-08-28 17:10:57 +02:00
Michel Dänzer
fdc8ec60eb st/xorg: Fix scons build. 2009-08-28 17:42:07 +02:00
Joakim Sindholt
6bfec14d6d r300g: support new drm_api 2009-08-28 17:23:11 +02:00
Jakob Bornecrantz
1e5014f7df drm_api: Operate on textures instead of buffers
Most use cases just got the buffer from the texture
	and then called into one of the get_handle functions.

	Also with this patch it would be easier to move to a
	generic function for getting handles from textures
	and textures from handles, that is exposed via the screen.
2009-08-28 13:38:23 +01:00
Jakob Bornecrantz
7d9af52bc5 st/xorg: Fix some warnings 2009-08-28 12:46:24 +02:00
Jakob Bornecrantz
b26aee0ffe st/dri: Fix some warnings 2009-08-28 12:46:17 +02:00
Jakob Bornecrantz
6f0a1a8426 st/xorg: Pass dri driver name as driverName on screen 2009-08-28 12:36:42 +02:00
Jakob Bornecrantz
205d344e2a Revert "st/xorg/dri: Pass texture formats via the DRI2 protocol flags."
This reverts commit a33e9ea3b9.

As this change breaks both radeon and nouveau
2009-08-28 12:35:42 +02:00
Pauli Nieminen
4322181e6a r100/r200: Bring back old PolygonStripple for DRI1.
DRI1 didn't have support for command buffer emit for stripple.
2009-08-28 05:42:41 +03:00
Pauli Nieminen
bfbad4fbb7 r100/r200: Share PolygonStripple code. 2009-08-28 04:58:50 +03:00
Pauli Nieminen
e541845959 r200: Fix piglit paths test.
Polygon stipple has to go to command buffer because special ioctl is disabled.
Piglit doesn't like HyperZ warning so disable it for kms.
2009-08-28 04:13:01 +03:00
Dave Airlie
a7f8b329aa r600: fix scissor also.
I forgot about r600 being here.
2009-08-28 11:05:29 +10:00
Dave Airlie
d0cb1036aa radeon: fix scissors harder.
this makes gnome-shell work on r300 for me
2009-08-28 11:02:32 +10:00
Eric Anholt
60b072d49f intel: Add support for ARB_copy_buffer.
Passes glean's bufferObject test for this extension.
2009-08-27 17:51:29 -07:00
Pauli Nieminen
812ccacabc r300: Fix emit prediction to account scissor emitting correctly. 2009-08-28 02:05:08 +03:00
Brian Paul
e363ec1d08 Merge branch 'mesa_7_5_branch' 2009-08-27 16:54:32 -06:00
Eric Anholt
c2ef10803d i915: Fix undefined symbol as of eabe12df44 2009-08-27 15:33:33 -07:00
Zack Rusin
8bdce0c3a7 st/xorg: set vertex and fragment shader for the current op 2009-08-27 18:17:54 -04:00
Zack Rusin
c7e103d238 st/xorg: bind rasterizer state 2009-08-27 18:08:58 -04:00
Zack Rusin
2048182e86 st/xorg: set blend state for exa 2009-08-27 18:06:15 -04:00
Zack Rusin
f9a3fce090 st/xorg: bind framebuffer and viewport for exa 2009-08-27 17:39:45 -04:00
Zack Rusin
3f15ea866f st/xorg: create and destroy shader cache 2009-08-27 17:39:45 -04:00
Michel Dänzer
416ee3c53e st/xorg: Set shared usage of pixmaps for use via DRI2.
Also allow pixmaps to have both the shared and displayed usage flags, as is
the case for the screen pixmap now.
2009-08-27 20:29:32 +02:00
Michel Dänzer
bfbfcdd703 st/dri: Make sure the front left renderbuffer is there for texture-from-pixmap. 2009-08-27 20:27:28 +02:00
Michel Dänzer
d73d4cfcf1 st/xorg: Don't hardcode ExaPrepareCopy to fall back to software. 2009-08-27 20:27:28 +02:00
Michel Dänzer
05aa56a827 st/xorg: Flush context if necessary in ExaPrepareAccess. 2009-08-27 20:27:28 +02:00
Michel Dänzer
f3a540f6d7 st/dri: Only ask for fake front buffer for single buffer visuals by default. 2009-08-27 20:17:53 +02:00
Michel Dänzer
a33e9ea3b9 st/xorg/dri: Pass texture formats via the DRI2 protocol flags.
No need to guess.
2009-08-27 20:17:53 +02:00
Nicolai Hähnle
1160bf7c65 r300: Cleanup reported native program limits
The fragment program native limits are actually higher on R4xx
as reported by Alex Deucher, but using those requires some
bit-twiddling changes to program handling.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-08-27 18:13:48 +02:00
Nicolai Hähnle
eb6e281966 r300: Debug messages are written to stderr, so fflush that
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-08-27 18:13:48 +02:00
Pauli Nieminen
570d4e375a radeon/r200/r300: Fix swtcl prediction to work after primitie change.
Swtcl calls flush everytime primitive changes so prediction has to made again
after flushing.
2009-08-27 18:57:13 +03:00
Brian Paul
44e86dde6d Merge branch 'mesa_7_5_branch' 2009-08-27 09:14:09 -06:00
Chia-I Wu
8d0bdfa433 progs: EGL/X progs should link to libX11.
Since 5a459d58fc, libEGL no longer links
to libX11.  Add the dependency to affected progs and cleanup
prog/egl/Makefile.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-27 08:08:30 -06:00
Vinson Lee
0dd08a9e15 mesa: move decls before code 2009-08-27 07:40:48 -06:00
Cooper Yuan
ba87cbf2be r300g: Correct scissor setting, subtract 1 from window's width and height 2009-08-27 17:46:59 +08:00
Dave Airlie
82ff3190de radeon: fix scissor calcs.
For non-FBOs we need to invert, for FBOs the scissors are non-inverted.

no matter what we need to clamp them to the buffer sizes.
2009-08-27 15:38:00 +10:00
Ian Romanick
09c73c7437 i965: Increase assmebly shader program parameter limits
Increase the number of native program parameters to the same values
exposed by GLSL.
2009-08-26 22:05:53 -07:00
Ian Romanick
eabe12df44 ARB prog: Change handling of program parameter limits
Several changes are made to program parameter limits.  Several of the
non-NATIVE limits are set higher.  All of the NATIVE limits are set to
zero in the core Mesa code.  Each driver must set the actual value in
its context creation routine.  If the NATIVE value remains zero, this
indicates that hardware shaders may not be supported.

Each of the preceeding changes matches the bahavior of Apple's shader
assembler, so it seems safe.

Finally, we limit the value of MaxEnvParams to be no greater than
MaxNativeAttribs.  At least one case has been found where an
application does the wrong thing if MaxNativeAttribs < MaxEnvParams.

See also bugzilla #23490.
2009-08-26 22:05:53 -07:00
Dave Airlie
20d9204fbd radeon: fix max indx/vertex emission due to state checker 2009-08-27 14:50:42 +10:00
Younes Manton
cefe9c4f39 mesa: gitignore 2009-08-26 20:15:00 -04:00
Younes Manton
7d3b8231e1 nv04: Handle more Z formats.
Based on the patch from Luo Jinghua.
2009-08-26 20:07:51 -04:00
Nicolai Hähnle
c024f1047f r300/compiler: Fix vertex program MAD emit
Only use the macro variant of MAD when absolutely necessary.
Apparently it cannot deal with relative addressing.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-08-27 01:46:50 +02:00
Nicolai Hähnle
2114acb044 r300/compiler: Fix bug in rc_find_free_temporary
Find used temporaries even if they are only written to in dead code.
This fixes a bug in the NQSSADCE stage.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-08-27 01:46:45 +02:00
Chia-I Wu
e1d978775f egl: Remove Xdpy from EGLDisplay.
It is not used anymore.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-26 16:40:22 -06:00
Chia-I Wu
f5a06fad62 egl_glx: Make fbconfigs and visuals per display.
This is to allow a driver to drive multiple displays.  Remove the use of
_EGL_PLATFORM_X and obsolete code along the way.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-26 16:40:22 -06:00
Chia-I Wu
c06699dd12 egl_softpipe: Make winsys and pipe screen per display.
This is to allow a driver to drive multiple displays.  Remove the use of
_EGL_PLATFORM_X along the way.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-26 16:40:22 -06:00
Chia-I Wu
49f245ea6b EGL_i915: Make struct drm_device per display.
This is to allow a driver to drive multiple displays.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-26 16:40:22 -06:00
Pauli Nieminen
74b55970dc Merge branch 'fix_r300_swtcl' into push_master 2009-08-27 00:08:30 +03:00
Pauli Nieminen
47d4b9ff70 radeon: Fix loop en condition so debug output doesn't flood meaningless values. 2009-08-27 00:07:05 +03:00
Pauli Nieminen
e0e76edf97 radeon: Make RADEON_CMDBUF more fine grained. 2009-08-27 00:05:57 +03:00
Pauli Nieminen
97029c1860 radeon/r200/r300: Fix swtcl flushing not to invalidate dma region.
We were check command buffer sizes too alte so allocated dma regions
were freed before relocations so space checking failed.
2009-08-27 00:01:56 +03:00
Brian Paul
38f5641106 Merge branch 'mesa_7_5_branch' 2009-08-26 14:49:15 -06:00
Brian Paul
b2b220e622 i965: init the tex_units_used field 2009-08-26 14:47:50 -06:00
Brian Paul
a9a6399cd3 i965: fix incorrect tex unit in emit_tex() and emit_txb()
The instructions we're translating already went through the brw_wm_pass_fp()
function which does the sampler->texture unit mapping.  We were applying
the sample->unit mapping a second time in the GLSL texture emitters.
Often, this made no difference but other times it could lead to accessing
an invalid texture and could cause a GPU lockup.
2009-08-26 14:46:58 -06:00
Brian Paul
81a101b5be i965: clean-up tex target switches 2009-08-26 14:43:45 -06:00
Brian Paul
6df38e6f5a glsl: asst. clean-ups in set_program_uniform()
Remove redunant type check for samplers (assert instead).
Move some local vars.  Update comments.
2009-08-26 14:35:45 -06:00
Brian Paul
7205221051 progs/glsl: asst. changes in shtest.c 2009-08-26 12:16:18 -06:00
Brian Paul
af7315e58b i965: added texture unit sanity check
Check that all the textures needed by the current fragment program
actually exist and are valid.
2009-08-26 12:08:23 -06:00
Brian Paul
34da6024e3 i965: keep track of which texture units the fragment shader accesses
We'll use this for debug/sanity checking.
2009-08-26 12:07:03 -06:00
Brian Paul
f8b344114f i965: clean up texture target switches 2009-08-26 12:02:24 -06:00
Brian Paul
f05344fcea mesa: var renaming, new assertion 2009-08-26 12:02:24 -06:00
Brian Paul
dd528f0ec1 mesa: additional instruction field size assertions 2009-08-26 12:02:24 -06:00
Brian Paul
476290946e Merge branch 'mesa_7_5_branch' 2009-08-26 12:01:23 -06:00
Brian Paul
2bcf787de1 progs/glsl: handle window resizes in texaaline.c 2009-08-26 11:56:56 -06:00
Alex Deucher
7ffbe48706 r600: fix two sided stencil 2009-08-26 13:33:06 -04:00
Alex Deucher
f988c750a9 r600: add missing radeon_cs_space_set_flush call
fixes crash in etracer reported by kdekorte on IRC
2009-08-26 13:10:15 -04:00
Zack Rusin
a0966c41a9 st/xorg: create basic vertex shader 2009-08-26 12:50:47 -04:00
Zack Rusin
b324aacf13 st/xorg: create basic fragment shader 2009-08-26 12:50:47 -04:00
Alex Deucher
490f640cd5 r600: make reloc_chunk size dynamic 2009-08-26 12:17:44 -04:00
Alex Deucher
f33853e56d r600: fix memory leak 2009-08-26 11:09:59 -04:00
Alex Deucher
18e0fea55b r300: r4xx and rs4xx also have lte discard regs 2009-08-26 10:53:30 -04:00
Jakob Bornecrantz
53b3cdaee2 st/dri: Add some debug code 2009-08-26 14:30:54 +02:00
Jakob Bornecrantz
57230d96ed st/xorg: Temporary fix for none stencil visuals
Should be replaced with something looking at the proper
	glx visual for the buffers.
2009-08-26 14:27:50 +02:00
Jakob Bornecrantz
23fe960be0 st/xorg: Find out correct type for depth stencil buffers 2009-08-26 13:45:31 +02:00
Jakob Bornecrantz
aab0bedb8c st/dri: Redo config generation 2009-08-26 12:29:28 +02:00
Michel Dänzer
b2e1b25881 st/xorg: Add support for dirty framebuffer region reporting.
Add a BlockHandler which flushes the context and reports the dirty region
gathered using the X server damage layer.

In the interim, with dirty region reporting only allocate textures for the
framebuffer and shared pixmaps (e.g. DRI2 buffers) and fall back to software
for other pixmaps. This will be improved in the future.
2009-08-26 13:18:37 +02:00
Cooper Yuan
dadf138ddb r600: Update vertex fetch shader if necessary 2009-08-26 16:21:10 +08:00
Ben Skeggs
1664bc1a37 st/dri: make the GL_ARB_map_buffer_range entrypoints available 2009-08-26 16:18:39 +10:00
Dave Airlie
674835f184 radeon/r100/r200: actually init the OQ support properly 2009-08-26 14:16:54 +10:00
Dave Airlie
b6df23d8b3 radeon/r200: OQ support for r200 in theory.
this is an untested port of the r100 OQ code
2009-08-26 14:03:48 +10:00
Dave Airlie
5484428d72 radeon: add r100 OQ support with kms.
This adds OQ support for the r100 chipsets, it requires
KMS unless someone wants to make a kernel patch to add support
for OQ regs.
2009-08-26 13:56:45 +10:00
Brian Paul
42675ff0e3 progs/glsl: call ValidateShaderProgram() 2009-08-25 17:46:11 -06:00
Brian Paul
a088e5631d mesa: validate shader before drawing (for debugging, disabled) 2009-08-25 17:46:10 -06:00
Brian Paul
d8b4f8c848 glsl: update a texture/sampler comment 2009-08-25 17:46:10 -06:00
Brian Paul
c90fca3da4 glsl: implement shader sampler validation
Shader validation should fail if there are two samplers of different types
which reference the same texture unit.  For example, if a cubemap sampler
and a 2D sampler both reference texture unit 0, that's invalid.
2009-08-25 17:46:10 -06:00
Brian Paul
2050baba96 mesa: use gl_texture_index type for gl_program::SamplerTargets 2009-08-25 17:46:10 -06:00
Brian Paul
fa6299cb31 progs/util: added ValidateShaderProgram() to shaderutil.c 2009-08-25 17:46:10 -06:00
Brian Paul
b7d2023cf9 i965: add some texture unit/target assertions 2009-08-25 17:46:10 -06:00
Brian Paul
f9ce0a91dc mesa: print some program fields in binary too 2009-08-25 17:46:10 -06:00
Pauli Nieminen
dbf59de6d2 r200: Add scissor to state atom list.
Scissors are jsut one of states that we have to emit so it should be in state list
2009-08-26 01:53:17 +03:00
Pauli Nieminen
5d10890795 radeon/r600: Fix remaining warnings when building 64 bit binary. 2009-08-25 22:16:19 +03:00
Pauli Nieminen
87f83e193a r200: Addd missing parameter to debug output. 2009-08-25 21:39:58 +03:00
Pauli Nieminen
75df73838a r200: Fix commit size prediction.
Scissor are emited for every primitive so fix that in prediction.
2009-08-25 21:36:57 +03:00
Zack Rusin
7bc4744026 xorg: insert shaders into the cache 2009-08-25 14:22:26 -04:00
Zack Rusin
23b59d3b40 exa: add basic code to cache vertex and fragment shaders 2009-08-25 14:01:58 -04:00
Zack Rusin
c7653a8333 exa: check whether the op is accelerated 2009-08-25 13:23:08 -04:00
Pauli Nieminen
c3374bf97e radeon: Fix all compiler warnings. 2009-08-25 19:35:41 +03:00
Brian Paul
42ecb1287e mesa: remove -I$(TOP)/src/gallium/drivers from sources.mak
Core Mesa and the state tracker do not depend on any gallium drivers.
2009-08-25 09:42:28 -06:00
Brian Paul
a94d66e857 Revert "glapi: Fix a possible race in getting current context/dispatch."
This reverts commit 17090cf3ef.

We're reverting this because it causes ABI breakage with the X server.
Maybe re-attempt with another patch.
2009-08-25 09:37:43 -06:00
Zack Rusin
65f9d10342 xorg: revert bad merge 2009-08-25 09:58:51 -04:00
Michel Dänzer
d22bd1421c Add support for building the Xorg state tracker with scons.
scons ... statetrackers=xorg
2009-08-25 15:39:05 +02:00
Pauli Nieminen
418cdc66ec Revert "glx: Make drawables persistent untill they are changed by glXMakeCurrent"
This commit was not mean to end in to master yet. It is still queston if this
right design to fix the problem.

This reverts commit 45e3be3c07.
2009-08-25 05:07:08 +03:00
Pauli Nieminen
ce7ed63f0c Merge branch 'master' of ssh://git.freedesktop.org/git/mesa/mesa into r600_state_predict 2009-08-25 02:36:13 +03:00
Maciej Cencora
1d5a06a1f7 r300: fix condition logic
The s3tc extensions are properly enabled now, when force_s3tc_enable option is set in driconf.
2009-08-25 01:30:24 +02:00
Maciej Cencora
ff235c8ccb r300: set proper CS section size 2009-08-25 01:30:24 +02:00
Pauli Nieminen
4297f32c24 radeon/r200/r300/r600: Warn if we emit more than prediction was.
Prediction code making too small prediction may cause space check aserttion
failure later in rendering. So warning about any failure to predict correctly
should be fixed.
2009-08-25 02:23:52 +03:00
Zack Rusin
ffe8cc6cef xorg: fix compilation 2009-08-24 18:42:16 -04:00
Zack Rusin
17076d700c xorg: start on code accelerating render 2009-08-24 18:39:01 -04:00
Alex Deucher
3023328ea7 r300: add support for getting Z pipe info from drm
Needed for occulsion queries on rv530 chips

Signed-off-by: Alex Deucher <alexdeucher@gmail.com>
2009-08-24 18:08:37 -04:00
Alex Deucher
8dd151b947 r600: code cleanup 2009-08-24 17:51:00 -04:00
Dave Airlie
dea1038186 radeon: fix fbo size calculation to after pitch 2009-08-25 07:21:03 +10:00
Zack Rusin
cd5c7bfd93 Merge branch 'master' of ssh://zack@git.freedesktop.org/git/mesa/mesa 2009-08-24 16:39:25 -04:00
Zack Rusin
534c133022 openvg: fix vgTransformPath with relative coords 2009-08-24 16:38:43 -04:00
Ian Romanick
4bccd693a7 ARB prog: Set error instead of falling through with incorrect value
If a fragment program only parameter was queried of a vertex program
(e.g., GL_MAX_PROGRAM_TEX_INDIRECTIONS_ARB) no error would be set and
a random value would be returned.  This caused 'glxinfo -l' to show
the same values for GL_MAX_PROGRAM_ALU_INSTRUCTIONS_ARB,
GL_MAX_PROGRAM_TEX_INSTRUCTIONS_ARB, GL_MAX_PROGRAM_TEX_INDIRECTIONS_ARB,
GL_MAX_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB,
GL_MAX_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB,
GL_MAX_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB as for
GL_MAX_PROGRAM_ENV_PARAMETERS_ARB.  This is confusing and incorrect.
2009-08-24 12:51:29 -07:00
Brian Paul
1e2a71c5c2 mesa: add new program parser sources to tarball
The end user doesn't need the .y or .l or Makefile but include them anyway
in case someone wants to patch or debug things.
2009-08-24 13:12:07 -06:00
Brian Paul
b879316d4d docs: recent 7.5.1 bug fixes 2009-08-24 13:05:20 -06:00
Brian Paul
69170a4aae xlib: fix single buffer window resize bug
When a single-buffered window was resized the new window size was never
detected.  This fix that, but there's still a bug which causes window
contents corruption for certain window sizes...
2009-08-24 13:05:20 -06:00
Brian Paul
93aa0fd81c vbo: fix divide by zero exception
Fixes bug 23489.
2009-08-24 13:05:20 -06:00
Vinson Lee
0a24e50111 glsl: Silence gcc uninitialized variable warning. 2009-08-24 13:04:50 -06:00
Brian Paul
4eb7256854 st/mesa: flush bitmap cache if Z value changes
When adding a new bitmap to the cache we have to check if the Z value is
changing and flush first if it is.

This is a modified version of a patch from Justin Dou <justin.dou@intel.com>
2009-08-24 13:04:50 -06:00
Ian Romanick
d8a3ada7fb ARB prog parser: Regenerate parser from previous commit 2009-08-24 12:00:35 -07:00
Brian Paul
4cf27608bc ARB prog parser: use correct context limits 2009-08-24 12:00:35 -07:00
Alex Deucher
29473d25a3 r600: fix state emit sizes 2009-08-24 14:40:40 -04:00
Chia-I Wu
58ac57c2b7 egl_xdri: Revive the driver.
egl_xdri does not compile for some time.  This commit revives the
driver.  It no longer depends on libGL.so for GLX related functions.
Instead, it uses code from src/glx/ directly.  Both DRI and DRI2 are
supported.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-24 11:49:45 -06:00
Chia-I Wu
17090cf3ef glapi: Fix a possible race in getting current context/dispatch.
There is a possbile race that _glapi_Context is reset by another thread
after it is tested in GET_CURRENT_CONTEXT but before it is returned.  We
definitely do not want a lock here to solve the race.  To have correct
results even under a race, no other threads should reset _glapi_Context
(or _glapi_Dispatch).

This patch adds a new global variable _glapi_SingleThreaded.  Since
_glapi_Context or _glapi_Dispatch are no longer reset,
_glapi_SingleThreaded is tested instead, before accessing them.

DRI drivers compiled with this patch applied will not work with existing
libGL.so because of the missing new symbol.  If this turns out to be a
real problem, this patch should be reverted.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-24 11:46:15 -06:00
Chia-I Wu
3076d1617d glapi: Static mutex does not work on WIN32_THREADS.
This re-introduces the race in _glapi_check_multithread, but avoids a
crash on windows.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-24 11:46:15 -06:00
Chia-I Wu
fc2feea685 glapi: Fix a race in accessing context/dispatch TSD.
If multiple threads set/get a TSD at roughly same time for the first
time, glthread might (wrongly) initialize it more than once.  This patch
solves the race by initializing context/dispatch TSDs early.

Acked-by: Ian Romanick <ian.d.romanick@intel.com>
Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-24 11:45:57 -06:00
Chia-I Wu
99939982ec glapi: Protect _glapi_check_multithread by a mutex.
Multiple threads might call _glapi_check_multithread at roughly the same
time.  It is possbile that all of them are wrongly regarded as firstCall
if there is no mutex.  This bug causes xeglthreads to crash sometimes.

Acked-by: Ian Romanick <ian.d.romanick@intel.com>
Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-24 11:45:57 -06:00
Brian Paul
53db19b57d mesa: _mesa_layout_parameters() returns a boolean value 2009-08-24 10:50:07 -06:00
Pauli Nieminen
55c0457fe9 radeon: Add debug output to radeonCountStateEmitSize. 2009-08-24 18:45:30 +03:00
Pauli Nieminen
ec61f677c3 r600: Fix indetion and add useful debug output. 2009-08-24 18:06:25 +03:00
Pauli Nieminen
75da0a6a56 Merge branch 'master' of ssh://git.freedesktop.org/git/mesa/mesa into r600_state_predict 2009-08-24 17:09:27 +03:00
Maciej Cencora
ed14a4cb7b r300: add support for EXT_framebuffer_blit 2009-08-24 14:52:33 +02:00
Cooper Yuan
a88678d3ee tgsi: Fix build error due to commit acc7da90 2009-08-24 19:50:38 +08:00
José Fonseca
02c523dfbb tgsi: Only free temp uregs.
Shorthand.
(cherry picked from commit de911220bbbe74cff0c79b260456ff36122b7b5b)
2009-08-24 12:11:24 +01:00
José Fonseca
acc7da9035 tgsi: Pass pipe_context as a parameter to ureg_create_shader.
Simplifies migration to tgsi_ureg.
(cherry picked from commit f574398c07c41cb8d31249a7186fc178ef7d552a)
2009-08-24 12:11:22 +01:00
Keith Whitwell
b570a7e6b6 tgsi: add generic instruction builder
When translating an incoming shader (rather than building one from scratch)
it's preferable to be able to call a single, generic instruction emitter
rather than figuring out which of the opcode-specific functions to call.
2009-08-24 11:33:38 +01:00
Cooper Yuan
7ee4f32dcd r300g: Set the vector address in the input memory for bypass_vs_clip_and_viewport case 2009-08-24 13:56:23 +08:00
Dave Airlie
2b29d21018 r600: scissor updates for dri2
Pulled from Dave's WIP patch.
2009-08-24 00:56:40 -04:00
Dave Airlie
f758a8bf2e r600: switch to common cs functions
needed for dri2.  Pulled from Dave's WIP patch.
2009-08-24 00:47:34 -04:00
Alex Deucher
436fb34369 r600: map 16 VS outputs
Should cover everything exported from the VS
2009-08-24 00:33:33 -04:00
Alex Deucher
d6f7ebd603 r600: fix logic copy paste error
Spotted by airlied.
2009-08-23 23:56:45 -04:00
Pauli Nieminen
fe42b4b757 r600: Improve emit prediction. 2009-08-24 02:44:27 +03:00
Pauli Nieminen
885906840d r600: Predict emit size for next rendering. 2009-08-24 02:01:15 +03:00
Pauli Nieminen
ccde276838 radeon: Fix dri1 ctx emit size. 2009-08-24 01:54:01 +03:00
Pauli Nieminen
7bb0f880db Merge branch 'master' of ssh://git.freedesktop.org/git/mesa/mesa into r600_state_predict
Conflicts:
	src/mesa/drivers/dri/r300/r300_cmdbuf.c
	src/mesa/drivers/dri/radeon/radeon_cmdbuf.h
2009-08-24 00:57:05 +03:00
Alex Deucher
4484ce9c7b radeon: add radeon_cs_write_table to the legacy path 2009-08-23 16:22:01 -04:00
Alex Deucher
becb50f84d r600: bump reloc_chunk size
This fixes openarena reloc errors.  This needs to be
made more dynamic.
2009-08-23 16:06:31 -04:00
Alex Deucher
670bd47df9 r600: fix count for CB/DB target state 2009-08-23 15:35:55 -04:00
Maciej Cencora
e1801d861a r300: fix a typo 2009-08-23 21:30:43 +02:00
Maciej Cencora
bcbe27d0ca radeon: use proper macro 2009-08-23 21:11:13 +02:00
Maciej Cencora
7e7f0f61bf radeon: use bo_is_idle interface for checking if OQ result is available 2009-08-23 21:09:55 +02:00
Maciej Cencora
4aadda5f66 r300: minor optimization
use properly implemented OUT_BATCH_TABLE where possible
2009-08-23 20:21:48 +02:00
Ian Romanick
9b70c33e73 ARB prog lexer: Fix lexer to eat both DOS and Unix line endings 2009-08-23 11:15:32 -07:00
Alex Deucher
7a05a4c65c r600: use persistent bos for shaders 2009-08-23 13:41:43 -04:00
Alex Deucher
41934be254 r600: always emit CB base
Not doing so seems to cause lock-ups or rendering problems
on some chips.  I think there is an logic issue related to
CB and VGT on some chips.  We ran into similar issues in
r600_demo IIRC.
2009-08-23 13:05:52 -04:00
Pauli Nieminen
b34695375e radeon: Fix compilation with legacy memory manager. 2009-08-23 14:02:46 +03:00
Pauli Nieminen
66bbafb6f9 radeon: Check from kernel if dma buffer is idle.
This makes sure that objects are leaving wait list only when they are processed by gpu.

Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-23 13:39:32 +03:00
Alex Deucher
bf6d0ae598 r600: make state emit more fine grained
Gives a nice speed boost in most apps since
we only emit what state we need.
2009-08-22 18:03:26 -04:00
Renato Caldas
08e91e0315 shader: fix compilation warnings
This patch fixes some "implicit declaration of function" compilation
errors/warnings on the new shader code.

Signed-off-by: Renato Caldas <seventhguardian@gmail.com>
2009-08-22 14:00:23 -07:00
Luo Jinghua
523cb80d0f ARB prog parser: include imports.h to kill some compiler warnings 2009-08-22 13:59:48 -07:00
Julien Cristau
3f970a6d4e Bump debhelper build-dep for dh_lintian 2009-08-22 21:30:15 +02:00
Alex Deucher
180c304943 r600: move full state to radeon state atoms 2009-08-22 15:03:41 -04:00
Alex Deucher
17813931db r600: add support for RS880 2009-08-22 11:45:40 -04:00
Ian Romanick
c87ef0870a i965: Implement frag prog DPH like DP4
DPH can output to any component, not just to X.  This allows fpalu.c
to run without hitting the assertion in emit_dph.
2009-08-22 01:35:12 -07:00
Pauli Nieminen
effda2e2a7 r300: Fix debug output. 2009-08-22 04:37:24 +03:00
Jakob Bornecrantz
54fb71b863 st/dri: Remove some debug prints 2009-08-22 02:16:02 +01:00
Jakob Bornecrantz
a3e59b9d06 st/dri: Find out if the drawable is a pixmap
Part of this code is disabled since no performance gains
	where detected with it enabled.

	This code only detects if it is a pixmap that it is
	rendering to on the st/xorg DDX since it sets the fake
	front to the same handle as front.
2009-08-22 02:16:02 +01:00
Jakob Bornecrantz
6237ac2412 st/dri: Fix frontbuffer rendering with DRI2 2009-08-22 02:16:01 +01:00
Jakob Bornecrantz
29165a2fcc st/xorg: Handle fake fronts correctly for pixmaps 2009-08-22 02:10:18 +01:00
Jakob Bornecrantz
a469b4c459 i915g: Remove bad assert on fence 2009-08-22 02:09:59 +01:00
Pauli Nieminen
6c5c46f842 r300: Fix dri1 not to emit state that is not supported in old drm. 2009-08-22 02:54:34 +03:00
Pauli Nieminen
c0f4063703 radeon/r300: Code clean up and logic fix. 2009-08-22 02:43:00 +03:00
Michel Dänzer
029e643b24 glx/dri2: Always use X drawable ID for DRI2 protocol.
Fixes protocol errors in cases where the GLX ID is different.
2009-08-22 01:33:37 +02:00
Michel Dänzer
6b1f144d9b Fix r300 VBO support build on big endian. 2009-08-22 01:24:39 +02:00
Alex Deucher
bf5d6cf455 r600: better default state size.
Hopefully suokko's emit size impovements will
land soon.
2009-08-21 17:46:32 -04:00
Pauli Nieminen
bb43c5d1cb r300: Remove calls to rcommonEnsureCmdBufSpace.
All rendering is checked in r300PredictTryDrawPrimsSize which mamde these calls useless.
2009-08-21 23:48:39 +03:00
Pauli Nieminen
90647ff558 radeon: protect against buffer overflow in state atom debug code. 2009-08-21 22:37:13 +03:00
Ian Romanick
4cfb1b880b Merge branch 'asm-shader-rework-1' 2009-08-21 11:34:30 -07:00
Pauli Nieminen
b7ec2ebe33 radeon: Improve state emit code.
Trying to make understanding code easier with small refactoring and renaming.
2009-08-21 20:47:35 +03:00
Pauli Nieminen
0bf4308580 r300: Add debug output to show how much was emited in TryDrawPrims. 2009-08-21 20:26:41 +03:00
Brian Paul
ef98eed0a9 radeon: fix incorrect loop limit (warned by -O3) 2009-08-21 11:04:37 -06:00
Brian Paul
49c0825655 glx: initialize some local vars to silence warnings with -O3 2009-08-21 11:04:37 -06:00
Pauli Nieminen
d6b5464aaa r300: Predict emit size for next rendering operation.
We do flush for cmd buffer in case there isn't enough space left for whole
rendering operation. This protects dma regions from getting released in middle
of state emit.

Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-21 19:12:31 +03:00
Pauli Nieminen
12fe319c53 r300: Handle possible fall back if space check fails. 2009-08-21 19:12:30 +03:00
Pauli Nieminen
11d3ec1f93 r300: Delay allocation of dma regions in TryDrawprims.
This makes it easier to predict size of next rendering operation so we
can do early flush.
2009-08-21 19:12:30 +03:00
Pauli Nieminen
66513ba884 r300: Clean emit code.
This fixes some state atom check functions from returing wrong emit size.

There is emit code cleanup so that emit function selection is done in init
time instead of runtime.

Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-21 19:12:30 +03:00
Pauli Nieminen
d1a0ece907 radeon: Port flush preventation code from r200 to r100.
- emit prediction
- fixes to emit_sizes for data
- clean up of excesive use of radeonEnsureCmdBufferSpace

Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-21 19:12:30 +03:00
Pauli Nieminen
60d156f688 r200: Make swtcl use state size prediction for flush.
Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-21 19:12:30 +03:00
Pauli Nieminen
e083f53ce4 r200: Remove unnecessery Elts from r200 context.
Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-21 19:12:29 +03:00
Pauli Nieminen
9f7676c718 r200: Remove unnecessary calls to rcommonEnsureCmdBufSpace.
Calling EnsureCmdBufSpace is not required because rendering pipeline has to quarentee free space.

Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-21 19:12:29 +03:00
Pauli Nieminen
0f41259eff r200: Fix atom->check call to return emit size for atom.
This patch makes render emit size prediction count the corect maximum emit size
for state.

Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-21 19:12:29 +03:00
Pauli Nieminen
fb1d0bfd47 r200: Prevent flush in middle of rendering.
Patch adds prediction functionthat tries to predict emit size to the smallest
possible values that is quarenteed to be higher than worst case scenario in
rendering pipeline.

State emit size prediction code is in place but fix for emit sizes is included
in next patch.

Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-21 19:12:29 +03:00
Pauli Nieminen
7f8f486b36 radeon/r200: Add -Wall to default build flags like it is in r300/r600
Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-21 19:12:29 +03:00
Pauli Nieminen
45e3be3c07 glx: Make drawables persistent untill they are changed by glXMakeCurrent
This fixes bug that xdemos/manywin would segfault if it was run with command
./manywin 2. Demo is tring to call glXSwapBuffers while another context was
bind using glXMakeCurrent.

Fix is simple makes drawable and readable persistent untill they change or
context is destroyed.

I found a logic error when same dri context is used for multiple drawables
which caused readable and drawable to fall out of sync in special case. Fix
is simple just updating  drawables more often than in original patch.

Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-21 19:12:28 +03:00
Chia-I Wu
b1f156f0ec egl: Make _eglChooseDriver return the filename of the driver.
The real difference is that the driver suffix is now appended.  This
also fixes an annoying bug that EGL_DRIVER could not specify the path to
a driver because a suffix was always appended.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-21 08:34:34 -06:00
Chia-I Wu
5a459d58fc egl: Remove dependency on libX11.
libX11 is used to determine the screen number, which is in turned used
to determine the DRI driver.  However, the sysfs interface for
determining the DRI driver is gone, and no working driver depends on
this mechanism.

Display string parsing is moved to a new function,
_eglSplitDisplayString.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-21 08:34:34 -06:00
Chia-I Wu
1f871a4d15 egl_softpipe: Do not flush unlinked context.
An unlinked context is destroyed after _eglMakeCurrent.  Flushing such
context would cause segfault.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-21 08:34:34 -06:00
Chia-I Wu
408db29792 egl: Check for null display in handle checking.
The display may be NULL when checking a handle.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-21 08:34:34 -06:00
Jakob Bornecrantz
9b3e5df900 st/egl: Add support for drmModeDirtyFB command if found 2009-08-21 15:04:21 +02:00
Pauli Nieminen
0c0cea250d radeon: Add comment to explain logic for freeing dma buffers. 2009-08-21 16:40:14 +03:00
Ian Romanick
ac5551fbb9 ARB prog parser: Revert part of previous change to constant parsing
The commit "ARP prog parser: Implement the spec, not what makes sense"
broke the parsing of scalar constants.  This commit reverts that part
of that commit.  Now vp_swizzle.c passes.
2009-08-20 18:29:41 -07:00
Alex Deucher
ba48e78b1f r600: convert to using common radeon state atoms
switches more state handling to common code.  We need
should be more fine grained with the state atoms
eventually.
2009-08-20 18:55:41 -04:00
Alex Deucher
a47bb56d45 r600: improve state emission
Slowing migrating to atom based system like
the other radeon drivers.
2009-08-20 17:21:50 -04:00
Alex Deucher
ad36058e21 r600: split state emit into block specific functions
We probably want to go finer grained eventually, but
this is a good start.
2009-08-20 17:21:50 -04:00
Brian Paul
a215da5e9c progs/glsl: report compile/link times in shtest.c 2009-08-20 14:43:32 -06:00
Brian Paul
f300db379e progs/util: added GetShaderCompile/LinkTime() to get compilation/link times 2009-08-20 14:43:32 -06:00
Brian Paul
8a883d1657 progs/glsl: update multitex.shtest for new texture syntax 2009-08-20 14:43:32 -06:00
Brian Paul
0062bd68b3 progs/glsl: update shtest.c to handle 1D/3D/CUBE/RECT textures 2009-08-20 14:43:32 -06:00
Brian Paul
174054c973 progs/glsl: tweaks to shtest.c
1. Larger sphere to match cube size
2. Allow -geometry option to override window size
3. Cube samplers
2009-08-20 14:43:32 -06:00
Christoph Bumiller
d7c55555ac nv50: use VTX_ATTR_nF for constant vtxelts 2009-08-20 21:41:39 +02:00
Christoph Bumiller
6d1f63f520 nv50: set vertex buffer limits 2009-08-20 21:41:39 +02:00
Christoph Bumiller
80c5ab1586 nv50: modify vbo format to hw translation, add BGRA swizzle 2009-08-20 21:41:39 +02:00
Jakob Bornecrantz
e93d41d24f st/egl: Open the first drm node
At least its better then hardcoded to i915
2009-08-20 17:50:30 +02:00
Brian Paul
94d14f6cd2 progs/glsl: more comments in shtest.c 2009-08-20 10:52:13 -06:00
Brian Paul
45cd9d80db tgsi: when printing/dumping programs indent loops and conditionals 2009-08-20 10:52:12 -06:00
Brian Paul
1645adc551 tgsi: check for SOA dependencies in SSE and PPC code generators
Fall back to interpreter for now.  This doesn't happen very often.
2009-08-20 10:52:12 -06:00
Brian Paul
013bd4da1a tgsi: handle SOA dependencies for MOV/SWZ
SOA dependencies can happen when a register is used both as a source and
destination and the source is swizzled.  For example:

MOV T, T.yxwz; would expand into:

  MOV t0, t1;
  MOV t1, t0;
  MOV t2, t3;
  MOV t3, t2;

The second instruction will produce the wrong result since we wrote to t0
in the first instruction.  We need to use an intermediate temporary to fix
this.

This will take more work to fix for all TGSI instructions.  This seems to
happen with MOV instructions more than anything else so fix that case now
and warn on others.

Fixes piglit glsl-vs-loop test (when not using SSE). See bug 23317.
2009-08-20 10:52:12 -06:00
Brian Paul
fffcecc4d9 tgsi: added tgsi_full_instruction::Flags field
Users of the parser can make use of this.
2009-08-20 10:51:55 -06:00
Alex Deucher
0f0a9e3ee7 r600: try and get everything in the draw in one IB
fixes corruption issues with apps like teapot and
geartrain.
2009-08-20 12:12:23 -04:00
Alex Deucher
1b1d591373 r600: move misc regs from general state
These regs don't use the SET_CONTEXT_REG packet,
so they weren't getting set correctly.
2009-08-20 12:12:23 -04:00
Brian Paul
39ec4a9253 mesa: add GL_DEPTH_STENCIL to glCopyPixels error check
Plus, add a comment about 'type' error checking.
See bug 19087.
2009-08-20 08:12:16 -06:00
Alex Deucher
525ddb1f56 r600: rework emit code
make sure we allocate enough space for relocs
2009-08-20 03:38:49 -04:00
Pauli Nieminen
ec1540052b radeon: Update regulary cs processing info from kernel.
This fixes problem that dma buffers were leaking in dri1 mode.

Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-20 03:38:49 -04:00
Brian Paul
8604a896a6 gallium: rename copy/fill_rect utility functions 2009-08-19 13:17:58 -06:00
Brian Paul
4522cdbfdd gallium: fix tags target in Makefile.template 2009-08-19 13:17:58 -06:00
Alex Deucher
174aeabc0f radeon: fix typo in last dma patch 2009-08-19 13:07:39 -04:00
Eric Anholt
29e51c3872 intel: Fix failure to commit -a --amend before last push. 2009-08-19 09:30:47 -07:00
Eric Anholt
a70e131584 intel: Align cubemap texture height to its padding requirements. 2009-08-19 09:19:06 -07:00
Eric Anholt
b053474378 intel: Align untiled region height to 2 according to 965 docs.
This may or may not be required pre-965, but it doesn't seem unlikely, and
I'd rather be safe.
2009-08-19 09:19:06 -07:00
Pauli Nieminen
947df2e5a8 radeon: Add debug output for dma buffer object numbers.
Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-19 11:59:47 -04:00
Pauli Nieminen
66e019c6c9 radeon: Fix dma buffer object pool to scale object sizes.
This fixes problems when application is using large vertex arrays for drawing.

Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-19 11:59:34 -04:00
Alex Deucher
d551b3ac88 r600: minor cleanup 2009-08-19 11:59:03 -04:00
Brian Paul
0259a2ad69 progs/xdemos: add multictx to .gitignore 2009-08-19 08:58:38 -06:00
José Fonseca
c69d9296fb tgsi: Add missing include.
(cherry picked from commit d2787c02c130b1fe20d0c032d468622f2fdaef79)
2009-08-19 12:03:34 +01:00
José Fonseca
b2f3f7dd12 tgsi: Fix typo in ureg constant creation.
(cherry picked from commit aa40c9abc7787fdf46cb661a4d0bb8bec513fc63)
2009-08-19 12:03:10 +01:00
Keith Whitwell
dd5ac3cafc st/xlib: remove a couple more 'fake' references 2009-08-19 12:02:53 +01:00
Keith Whitwell
515a820021 st/xlib: remove dead ungrab helper 2009-08-19 12:02:53 +01:00
Keith Whitwell
65079afcde tgsi: silence compiler warning 2009-08-19 12:00:24 +01:00
Keith Whitwell
7dc5527592 tgsi: remove unused function argument 2009-08-19 12:00:03 +01:00
Keith Whitwell
265e210edb tgsi: add missing functionality to support instructions with labels
Could previously emit opcodes with label arguments, but was no way to
patch them with the actual destinations of those labels.

Adds two functions:

  ureg_get_instruction_number - to get the id of the next instruction
     to be emitted

  ureg_fixup_label - to patch an emitted label to point to a given
     instruction number.

Need some more complex examples than u_simple_shader, so far this has
only been compile-tested.
2009-08-19 11:54:26 +01:00
Corbin Simpson
e327845e2b r300g: Force off ZTOP optimizations for now. 2009-08-18 21:25:53 -07:00
Corbin Simpson
0086a84e2d r300g: Utilize DONTBLOCK.
Also ALGYRHYTHMS.
2009-08-18 21:25:53 -07:00
Corbin Simpson
c0bc070ff5 radeon-gallium: Oh, look, we *do* already support DONTBLOCK.
Well, okay, the kernel doesn't, but that's no excuse for us! :3
2009-08-18 21:25:53 -07:00
Corbin Simpson
a381ee8266 r300g: Massively cleanup OQ.
Still broken, but compiles cleaner, behaves better, etc.
2009-08-18 21:25:53 -07:00
Corbin Simpson
4092f318db r300g: Add high_second_pipe cap for R3xx chipsets.
This name is totally subject to change if ever I need to separate R3xx
for some other reason.
2009-08-18 21:25:53 -07:00
Corbin Simpson
14378cbd2d radeon-gallium: Stop using outdated ioctls. 2009-08-18 21:25:53 -07:00
Corbin Simpson
c63bd15f81 Revert "r300-gallium, radeon-gallium: Nuke gb_pipes from orbit."
This reverts commit 6a40d1e9d9.

Turns out that we *do* need these for OQ after all. Go figure.

Conflicts:

	src/gallium/winsys/drm/radeon/core/radeon_r300.h
2009-08-18 21:25:53 -07:00
Brian Paul
73fc09a7bf Merge branch 'mesa_7_5_branch' 2009-08-18 17:55:27 -06:00
Brian Paul
e4aa62a6ce egl/xlib: move call to create_configs() after we set the Xdpy field 2009-08-18 17:54:44 -06:00
Brian Paul
b062a119ff mesa: call FLUSH_CURRENT() for GL_CURRENT_TEXTURE_COORDS query 2009-08-18 17:09:32 -06:00
Ian Romanick
a512985fd8 Merge branch 'master' into asm-shader-rework-1
Conflicts:
	src/mesa/shader/arbprogparse.c
2009-08-18 12:20:36 -07:00
Ian Romanick
0b5af41c6f ARB prog parser: Delete the old parser 2009-08-18 12:07:47 -07:00
Ian Romanick
ea8db5c332 ARB prog: Revert some changes to debug output 2009-08-18 12:07:47 -07:00
Pauli Nieminen
f9b8562f32 radeon: balance dma buffer mapping
In radeonRefillCurrentDmaRegion() make sure we
unmap the previous buffer.
2009-08-18 14:32:45 -04:00
Jakob Bornecrantz
657109bbc6 egl: Create the front texture the properly 2009-08-18 18:51:41 +01:00
Pauli Nieminen
caae3f1e8d r300: Movde debug output from stdout to stderr in copiler.
Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-18 13:44:00 -04:00
Dave Airlie
1279cdcb1f r200: make use of DMA buffers for Elts a lot better.
This allows us to return the unused portion of the dma buffer
to the allocator instead of wasting nearly 16k a pop.

Cherry picked and ported to new code by Pauli.
2009-08-18 13:19:45 -04:00
Pauli Nieminen
ae290fd93e r200: Fix missing offset from elt buffer pointer.
Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-18 13:19:34 -04:00
Pauli Nieminen
bbf2b5c4ff radeon: Optimize memory handling for dma operations.
We keep dma buffer objects in list untill they have been unused for many
draw operations. Current limit of having 100 flushes is just guess for
good performance/memory trade off.

Moving WARN_ONCE macro to common context because it is used in multiple drivers.

Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-18 13:19:25 -04:00
Alex Deucher
c745c87b3e r300: fix the build on big endian 2009-08-18 11:40:18 -04:00
Brian Paul
1c1ee1176d gallium: improved comments, minor whitespace changes 2009-08-18 09:31:22 -06:00
Chia-I Wu
34d8c13bff egl: Remove eglhash.c and eglhash.h.
Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-18 08:50:12 -06:00
Chia-I Wu
e484a92928 egl: Add back handle checking.
Handle checking was done using hash tables.  Now that they are gone, we
have to loop over the lists.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-18 08:50:06 -06:00
Chia-I Wu
e3734e4685 egl: Make lookup functions static inline.
progs/egl/demo3.c is also changed since it uses an internal function.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-18 08:50:00 -06:00
Chia-I Wu
38feefdc4e egl: Remove hash table for displays.
The hash table was used to map a display to a handle.  It is simpler to
cast directly.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-18 08:49:53 -06:00
Chia-I Wu
7a9f528009 egl: Remove hash table for surfaces.
The hash table was used to map a surface to a handle.  It is simpler to
cast directly.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-18 08:49:34 -06:00
Chia-I Wu
ccc2b0bc65 egl: _eglCloseDriver should be no-op.
Move drv->API.Terminate call to eglTerminate.  Remove
_eglReleaseDisplayResource as drivers are doing it.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-18 08:49:22 -06:00
Chia-I Wu
5a2c9372a0 egl: Some per-driver data should be per-display.
Move some fields of _EGLDriver to _EGLDisplay.  It also becomes
unnecessary to pass _EGLDisplay to drivers when _eglMain is called.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-18 08:49:09 -06:00
Chia-I Wu
0eaa02c836 egl: Change the way drivers are loaded.
Driver is chosen and preloaded when eglGetDisplay is called.  Later when
eglInitialize is called, the same driver is matched to initialize the
display.  Also, add new, but unused, hooks to EGLDriver to allow a
driver to probe a display or unload itself.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-18 08:44:44 -06:00
Chia-I Wu
2f2cf461c5 egl: Overhaul driver API.
The motivation is so that drivers do not need to look up and check for
bad display, context, and etc.  It also becomes unnecessary for drivers
to call the link functions.

This commit makes eglapi.[ch] do the lookup and check.  As a result, the
driver API is overhauled, and almost all sources and drivers need
update.  The updates are mainly find and replace with human brains.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-18 08:44:34 -06:00
Dave Airlie
521dea21d4 r600: fix build 2009-08-18 20:38:49 +10:00
Dave Airlie
771e19a861 r300: remove warning introduced with OQ 2009-08-18 20:30:15 +10:00
Dave Airlie
f74e00f4d1 radeon/r200: fix build after OQ commits 2009-08-18 20:29:02 +10:00
Dave Airlie
9ad76e9479 r300: OQ rework
Move to common code base so radeon/r200 can add support for this.
Make OQ start a state emitted like all normal state, and make no-tcl
flushing work in proper places.

Really need a generic post emit space reservation mechanism like max_state
so we can reserve some space for the emit

this code passes demos/arbocclude, piglit occlusion query and
glean occlusion query with TCL and NO-TCL on my rv530.
2009-08-18 20:10:50 +10:00
Dave Airlie
0e705c0dd3 r300: fix missing BEGIN/END batches 2009-08-18 20:10:08 +10:00
Dave Airlie
c80bc3abcd r300: fix big endian build 2009-08-18 13:55:12 +10:00
Brian Paul
3aafd22f6a gallium: memset() tgsi_exec_machine to all zeros in tgsi_exec_machine_create()
This fixes invalid values for CondStackTop, LoopStackTop, etc.
2009-08-17 17:13:17 -06:00
Brian Paul
680df529a3 demos/glsl: remove glutInitWindowPosition() calls 2009-08-17 17:13:17 -06:00
Alex Deucher
af1dc225c2 r600: fix counting error after the last commit 2009-08-17 18:16:38 -04:00
Alex Deucher
66c632b5a1 r600: make sure the number of indices is valid
make sure the number of indices is valid for the
requested prim type.  glxgears sends invalid
quad strips with only 2 indices for example.
2009-08-17 17:47:27 -04:00
Alex Deucher
c3380ded10 radeon: remove RADEON_DEBUG_BO stuff
This stuff was a vestige of the r600 bring up and
now mostly serves to periodically break the build.
2009-08-17 15:42:19 -04:00
Maarten Maathuis
caf40d5d14 nv50: remove a few cases of directly casting struct pipe_context 2009-08-17 18:48:14 +02:00
Maarten Maathuis
97cc526eb7 nv50: borrow some flushing code from the ddx
- This fixes neverball corruption.
- I'm unsure about what we're actually flushing here.
2009-08-17 18:48:14 +02:00
Maarten Maathuis
f199dbdb76 gallium: Make PIPE_TRANSFER_{READ,WRITE,READ_WRITE} bitmask friendly. 2009-08-17 18:48:14 +02:00
Maarten Maathuis
93ce4c99d4 nv50: whitespace fixes and deobfuscation 2009-08-17 18:48:13 +02:00
Brian Paul
7c4223876b cell: fix incorrect pipe_transfer tests
The value is an enum, not a bitmask.
2009-08-17 08:28:22 -06:00
Jerome Glisse
c952c1f109 r300: split vbo rendering with big drawarray case
Split vbo rendering when the number of elements requested
by drawarrays is bigger than 65536.
2009-08-17 12:50:27 +02:00
Christoph Bumiller
0204c7d8d7 nv50: fix stencil state
It's the front stencil methods that have contiguous offsets,
not the back ones.
Unfortunately the names in the header still have FRONT/BACK
reversed, so I'm using hex values until it gets updated.
2009-08-17 12:26:54 +02:00
Dave Airlie
743c4af5cd radeon: turn off bo debugging 2009-08-17 19:09:15 +10:00
Maciej Cencora
fd97f2f8b8 r300: disable ZTOP only when occlusion queries are used 2009-08-16 02:04:29 +02:00
Maciej Cencora
30e9c753b8 Merge branch 'oq' 2009-08-16 01:56:29 +02:00
Pauli Nieminen
57f55af219 mesa: Add 2 new demos to .gitignore. 2009-08-15 13:30:15 -06:00
Maarten Maathuis
a7adb85827 nv50: avoid a NULL-ptr dereference when the pipe context changes
- We cannot assume all state objects are present when the pipe context changes.
2009-08-15 16:57:00 +02:00
Christoph Bumiller
a2af40b846 nv50: align registers used with TEX to 4
The TEX instruction is passed the first index of a contiguous
range of 4 TEMP registers that contain coordinates / LOD and,
after execution, the texel values.
It seems the first index is required to be a multiple of 4 on
some (older ?) cards.
2009-08-15 16:22:27 +02:00
Maciej Cencora
60587182d4 r300: enable ARB_occlusion_query
Supported only on HW with TCL block and with proper radeon drm.
Required minimum radeon drm version is 1.30 or KMS.
2009-08-15 15:14:29 +02:00
Maciej Cencora
d2b1b9e8d5 radeon: add flag for drm OQ support 2009-08-15 15:14:25 +02:00
Maciej Cencora
f3e1d7d6f8 r300: temporary occlusion query hack 2009-08-15 15:14:24 +02:00
Maciej Cencora
8d60c0b751 r300: clear not_flushed OQ list after flush 2009-08-15 15:14:24 +02:00
Maciej Cencora
c903834d4d r300/oq: add some debugging info 2009-08-15 15:14:23 +02:00
Maciej Cencora
0d0f01e2e0 r300: add occlusion queries support
TODO:
- use proper interface for checking if bo is idle when it's available
- disable ZTOP only when needed
- make it work under KMS
2009-08-15 15:14:11 +02:00
Dave Airlie
f2daded812 radeon space: realign with drm space check code 2009-08-15 21:34:17 +10:00
Dave Airlie
a6cc45e135 r300: fixup space checks since VBO code
Hopefully this gets the ordering correct so the space checks don't fail.
2009-08-15 21:18:30 +10:00
Dave Airlie
3cc9a28b9b r300: add just in case warn I don't think this can actually happen 2009-08-15 20:30:45 +10:00
Dave Airlie
5e4e8effec radeon: enable vertex splitting for IBs
Based on Maciej's code, just fixed up the alignments for INDX_BUFFER

ut2004 runs AS-Convoy
2009-08-15 20:22:13 +10:00
Roland Scheidegger
b9789948e0 i965: disable bounds checking on arrays with stride 0
if stride is 0 we cannot use count as max index for bounds checking,
since the hardware will simply return 0 as data for indices failing
bounds check. If stride is 0 any index should be valid hence simply
disable bounds checking in this case.
This fixes bugs introduced with e643bc5fc7.
2009-08-15 03:44:43 +02:00
Ian Romanick
e304c65a2b i965: Add support for GL_ARB_seamless_cube_map 2009-08-14 16:28:51 -07:00
Ian Romanick
8b0b33530c demos/cubemap: Add support for GL_ARB_seamless_cube_map 2009-08-14 16:28:51 -07:00
Ian Romanick
06ae1db4a9 Regenerate files for GL_ARB_seamless_cube_map 2009-08-14 16:28:51 -07:00
Ian Romanick
9d5bb3c6f8 Infrastructure for GL_ARB_seamless_cube_map 2009-08-14 16:28:51 -07:00
Ian Romanick
970f768666 Regenerate files for GL_APPLE_flush_buffer_range 2009-08-14 16:28:50 -07:00
Maciej Cencora
a89963cec1 Merge branch 'vbo_clean'
Conflicts:
	src/mesa/drivers/dri/r300/r300_draw.c
2009-08-15 00:52:44 +02:00
Maciej Cencora
7fe0dd2e6e r300: mark VBO buffer objects as persistent 2009-08-15 00:39:19 +02:00
Maciej Cencora
cd703049db r300: unmap buffer objects after usage 2009-08-14 23:56:04 +02:00
Brian Paul
71b1610941 mesa: append uniform values to the log file the first time we use a shader
This info is essential to using/debugging a shader outside of its normal
application.
2009-08-14 12:58:21 -06:00
Brian Paul
12199ed96c mesa: also pass the GPU program to _mesa_append_uniforms_to_file()
We want the post-link program at this points.
2009-08-14 12:57:39 -06:00
Brian Paul
e3d47515f9 vbo: call _mesa_valid_to_render() 2009-08-14 11:31:00 -06:00
Brian Paul
d09a19bf6e Merge branch 'mesa_7_5_branch' 2009-08-14 11:27:51 -06:00
Brian Paul
db598b8998 mesa: new _mesa_append_uniforms_to_file() debug/logging function 2009-08-14 11:27:33 -06:00
Brian Paul
b6e5600bd4 mesa: call _mesa_valid_to_render() 2009-08-14 11:27:33 -06:00
Brian Paul
d03dde16eb vbo: call _mesa_valid_to_render() 2009-08-14 11:27:33 -06:00
Brian Paul
56c4226fcc mesa: new _mesa_valid_to_render() function
Tests if the current shader/program is valid and that the framebuffer is
complete.  To be called by glBegin, glDrawArrays, etc.
2009-08-14 11:27:33 -06:00
Brian Paul
a48b0a5ce7 mesa: minor error string changes 2009-08-14 11:27:33 -06:00
Keith Whitwell
51c47383f9 st/xlib: reduce the proliferation of GLX context types
Now there is just a single, struct __GLXcontextRec, which is the
GLXContext typedef has already been defined as a pointer to.  I
believe this is the intended usage, that GLX implementations should
define that struct as they require.

Merge the two previous structs into one and get rid of the
no-longer-necessary type casts and sub-classing.
2009-08-14 17:56:47 +01:00
Keith Whitwell
9616e4ad1c st/dri: remove unused dummyContext value 2009-08-14 17:42:27 +01:00
Christoph Bumiller
442a5e4343 nv50: fix mipmap offsets and tiling
The hardware expects a texture's tile mode to change with
the mipmap level.
Also, only multiply by block size once to obtain size.
2009-08-14 18:23:55 +02:00
Christoph Bumiller
3506d7d3e2 nv50: make sure we don't re-emit outdated scissor state
Since we don't turn off scissors, we need to update the
stateobj when the framebuffer size changes.
2009-08-14 18:16:46 +02:00
Christoph Bumiller
74e8b1a30b nv50: make use of the y-origin switch
Now that we know how to make the hardware have y-coordinate origin
top, we can get rid of all the inversion introduced earlier.
2009-08-14 18:06:24 +02:00
Maciej Cencora
cdaf63d0ea r300: remove broken vertex splitting
Revert to previous behaviour of dropping to big render operations.
2009-08-14 17:10:21 +02:00
Maciej Cencora
9e018d8225 r300: rework index buffer setup
Copy elements directly to DMA bo to get rid of one memcpy, and prepare for using VBOs for index buffer.
2009-08-14 17:10:15 +02:00
Maciej Cencora
7c060bff13 r300: remove unused software TNL path
This doesn't remove software TCL path - so RS480 and RS690 work as before.
2009-08-14 17:06:02 +02:00
Maciej Cencora
5fb5ea97f4 r300: use VBOs for vertex attributes 2009-08-14 17:05:50 +02:00
Brian Paul
c3f9c2eb75 docs: document new --with-max-width/height config options 2009-08-14 09:00:15 -06:00
Tom Fogal
9a8781bd24 Add a FAQ about internal buffer sizes. 2009-08-14 08:58:59 -06:00
Tom Fogal
7085dce750 Add configure options for MAX_WIDTH/HEIGHT.
This adds two --with configure options for setting defines for
MAX_WIDTH and MAX_HEIGHT.  It's conceivably just as easy to define
these in CFLAGS manually, but this way users don't need to know
about internal Mesa details.

Patch updated by BrianP to set DEFINES, not CFLAGS.
2009-08-14 08:58:37 -06:00
Tom Fogal
66bc17e80e Allow external settings of MAX_WIDTH/HEIGHT.
Conditionalize MAX_WIDTH / MAX_HEIGHT defines so that users can
set them via CFLAGS.
2009-08-14 08:56:51 -06:00
Tobias Doerffel
87946d206f intel: in intel_context struct use typedef for sarea struct
Using drm_i915_sarea_t instead of struct drm_i915_sarea seems to be
a common standard now, therefore fix it also in intel_context
structure. Additionally this silences a compiler warning:

intel_swapbuffers.c: In function `intelFixupVblank':
intel_swapbuffers.c:48: warning: initialization from incompatible pointer type

Signed-off-by: Tobias Doerffel <tobias.doerffel@gmail.com>
2009-08-14 08:50:52 -06:00
Thierry Vignaud
2674d1ba50 mesa: make sure r300/compiler/ sources are included in tarball 2009-08-14 08:16:54 -06:00
Chia-I Wu
67b639c7ab st/vega: Add more symbols defined by mesa/st.
Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-14 08:11:38 -06:00
Maciej Cencora
895f7c33d4 r300: add required symlinks
Reported by adamk on #radeon
2009-08-14 16:02:11 +02:00
Maciej Cencora
e029c91fd3 radeon: handle debug versions of radeon_bo_open 2009-08-14 16:02:10 +02:00
Christoph Bumiller
f1aa2a43b7 nv50: fix typo in REALLOC's 2nd argument in ctor_immd 2009-08-14 15:54:49 +02:00
Maciej Cencora
6bcbeb02d6 radeon: add VBO support (not enabled yet) 2009-08-14 15:31:11 +02:00
Maciej Cencora
2233ac61e1 radeon: export emitvec* functions 2009-08-14 15:31:06 +02:00
Maciej Cencora
d534648d90 radeon: constify some parameters 2009-08-14 15:30:55 +02:00
Alex Deucher
7069a7548f r600: emit SURFACE_BASE_UPDATE on depth base updates on rv6xx 2009-08-14 01:37:36 -04:00
Dave Airlie
ceb9459ed5 glsl: re-write Makefile after I called it bad. 2009-08-14 10:05:10 +10:00
Brian Paul
0c717bcd5d progs/glsl: added multitex.shtest config file 2009-08-13 17:03:57 -06:00
Brian Paul
08ecd863ee progs/glsl: set generic vertex attribute values 2009-08-13 17:03:56 -06:00
Brian Paul
62d1132160 progs/glsl: add type field to shtest config files
Plus, texture loading.
2009-08-13 17:03:56 -06:00
Brian Paul
823703418e mesa: added *.shtest files to demo tarball 2009-08-13 17:03:56 -06:00
Dave Airlie
25cd4dc1d6 glsl/tests: skinning.o
worst Makefile ever. not sure what is going on here, hopefully
this fixes tinderbox
2009-08-14 08:35:49 +10:00
Alex Deucher
9d96095c1e r600: move non-surface related cb state to general state 2009-08-13 17:55:42 -04:00
Alex Deucher
083b04e809 r600: move non-surface related depth state to general state 2009-08-13 17:43:03 -04:00
RALOVICH, Kristóf
0896268b97 glx: indent -br -i3 -npcs --no-tabs
Some manual intervention applied since XEXT_* and other macro magic
fooled indent. Auto generated files were also skipped.
2009-08-13 15:13:21 -06:00
Brian Paul
741869d73a progs/util: ignore pre-defined uniforms in SetUniformValues() 2009-08-13 12:53:20 -06:00
Brian Paul
ae99e4c67e progs/glsl: new shtest program, a simple shader test harness app
This commit includes some sample config files (*.shtest)
2009-08-13 12:52:13 -06:00
Brian Paul
03ba461c19 glsl: fix incorrect attribute size 2009-08-13 12:50:57 -06:00
Brian Paul
53dfd5d870 tnl: if NAN_CHECK is enabled, also assert that pos.x != 0 2009-08-13 12:50:57 -06:00
Brian Paul
c10002361c mesa: s/assert/ASSERT/ in _mesa_reference_texobj()
We want the no-op ASSERT for non-debug builds.
2009-08-13 12:50:57 -06:00
Brian Paul
8a9795e5c6 mesa: rework error check in glGetTexLevelParameter(), remove tex_image_dimensions() 2009-08-13 12:50:57 -06:00
Brian Paul
423a53f635 mesa: if maxLevels==0, target is invalid 2009-08-13 12:50:56 -06:00
Brian Paul
fe988d786c mesa: add extension checks in _mesa_max_texture_levels() 2009-08-13 12:50:56 -06:00
Brian Paul
47a385b43b mesa: minor clean-ups in bumpmap functions 2009-08-13 12:50:56 -06:00
Brian Paul
6aa7a03d85 mesa: use _mesa_get_current_tex_unit() in more places 2009-08-13 12:50:56 -06:00
Brian Paul
73b150c816 mesa: refactor: move _mesa_is_color/depth/stencil_format() helpers to image.c 2009-08-13 12:50:56 -06:00
Brian Paul
ba2a55ccd6 mesa: move _mesa_Get[Compressed]TexImage() to texgetimage.c
All the glGetTexImage code is in one file now.
2009-08-13 12:50:56 -06:00
Brian Paul
b9f67df6e7 mesa: short-circuit no-change in _mesa_DepthRange() 2009-08-13 12:25:53 -06:00
Michel Dänzer
ace98f09e6 st/dri: Add support for GLX_EXT_texture_from_pixmap with direct rendering. 2009-08-13 20:24:09 +02:00
Michel Dänzer
7c08614b32 gallium/drm: Handle circular dependencies in the auxiliary libraries with make. 2009-08-13 18:46:53 +02:00
Michel Dänzer
7ef8c79a8c st/xorg: Fix DRI2 CopyRegion hook.
Use GC CopyArea op for proper translation and clipping, and throttle full
buffer swaps / frontbuffer flushes.
2009-08-13 18:46:53 +02:00
Keith Whitwell
f2fcd5822a tgsi: add simple facility for releasing and reusing temporaries 2009-08-13 17:32:25 +01:00
Keith Whitwell
b56d2ba7b2 tgsi: rename ureg src/dest converters
Also fix a typo in ureg_src().
2009-08-13 17:32:25 +01:00
José Fonseca
5c5364a0f6 draw: Remove unused variable. 2009-08-13 16:33:50 +01:00
José Fonseca
7b39194e2d scons: Handle Circular dependencies in the libraries. 2009-08-13 16:32:51 +01:00
Keith Whitwell
bf57eda0ec Merge branch 'mesa_7_5_branch' 2009-08-13 15:57:23 +01:00
Keith Whitwell
78918c8760 tgsi: turn off debugging 2009-08-13 14:28:01 +01:00
Keith Whitwell
749e52049d tgsi: use REALLOC for growing token pool 2009-08-13 14:27:42 +01:00
Keith Whitwell
120e76866b util: silence warnings for third REALLOC argument
Our fallback realloc path requires an old_size argument, but the posix
varient doesn't need this.  Add some code to avoid gcc unused variable
warnings for this extra argument.
2009-08-13 14:26:50 +01:00
Keith Whitwell
b1d82f1f19 util: remove unneeded includes 2009-08-13 13:43:25 +01:00
Keith Whitwell
002c76cfef util: convert u_simple_shaders to use tgsi_ureg
Much nicer now.
2009-08-13 13:02:59 +01:00
Keith Whitwell
8a7d1e7b76 tgsi: add tgsi_ureg, a simplified tgsi shader builder
This is modelled on the nice & easy-to-use facilities we had
for building shaders in mesa, eg. in texenvprogram.c and friends.

Key points include pass-by-value register structs that can be manipulated
in a functional style, eg:

   negate(swizzle(reg, X,X,X,X))

and per-opcode instruction functions, eg:

   emit_MOV( p, writemask(dst, 0x1), negate(src));

and similar.

Additionally, the interface allows mixed emit of instructions and decls,
which are sorted out internally to obey TGSI ordering.

Immediates may be emitted at any time and are scanned against existing
immediates to try and reduce redundancy.

Not all TGSI functionality is accessible through this interface, but
most or all of what mesa uses should be.
2009-08-13 13:02:47 +01:00
Xiang, Haihao
1f40ffca63 i965: fix cube map on IGDNG 2009-08-13 18:42:52 +08:00
Brian Paul
4ce73ad92c glsl: remove duplicate frag input entry 2009-08-12 20:37:34 -06:00
Brian Paul
f3b215cba2 Merge branch 'new-frag-attribs'
This branch introduces new FRAG_ATTRIB_FACE and FRAG_ATTRIB_PNTC fragment
program inputs for GLSL gl_FrontFacing and gl_PointCoord.  Before, these
attributes were packed with the FOG attribute.  That made things
complicated elsewhere.
2009-08-12 20:32:41 -06:00
Brian Paul
fdfb0d4b0e progs/glsl: change uniform_info::type field to use GLSL vector types 2009-08-12 17:28:45 -06:00
Brian Paul
af3d7f6889 demos: call SetUniformValues() 2009-08-12 17:28:45 -06:00
Brian Paul
f95b82b486 mesa: const qualifiers 2009-08-12 17:28:45 -06:00
Brian Paul
bd4c6a2e50 vbo: use _mesa_is_bufferobj() 2009-08-12 17:28:45 -06:00
Brian Paul
684049d97d demos: rename InitUniforms() to SetUniformValues()
And call new PrintUniforms() in demos.
2009-08-12 17:28:45 -06:00
Brian Paul
378bff0edd progs/util: added more shader utility functions 2009-08-12 17:28:45 -06:00
Brian Paul
434ec3ada8 mesa: use _mesa_is_bufferobj() 2009-08-12 17:28:45 -06:00
Brian Paul
604031563c mesa: use _mesa_is_bufferobj() 2009-08-12 17:28:45 -06:00
Brian Paul
abbf83551f mesa: new _mesa_is_bufferobj() function
Tests if the given buffer object is a user-created, non-default buffer object.
Use this instead of testing bufferobj->Name != 0.
2009-08-12 17:28:45 -06:00
Eric Anholt
d64649a316 i965: Make the cube mapping RCP use a writemask.
Fixes cube mapping since the scalar changes.
2009-08-12 13:50:09 -07:00
Eric Anholt
5faa0dc591 i965: Allocate destination registers for GLSL TEX instructions contiguously.
This matches brw_wm_pass*.c behavior, and fixes the norsetto shadow demo.

Bug #19489
2009-08-12 13:18:47 -07:00
Eric Anholt
63fa5fd319 i965: drop dead scalar handling in GLSL. 2009-08-12 13:05:59 -07:00
Eric Anholt
08687c8b40 i965: Correct brw_wm_nr_args for WM_DELTAXY and WM_PIXELXY. 2009-08-12 12:54:43 -07:00
Eric Anholt
863ae3a527 i965: Drop GLSL ABS code, which is translated away in brw_wm_fp. 2009-08-12 12:43:43 -07:00
Eric Anholt
4de8b8902f i965: Drop code for emitting OPCODE_SUB, since brw_wm_fp.c makes it an ADD. 2009-08-12 12:43:43 -07:00
Eric Anholt
0eb819a2d1 i965: Store the dispatch width in the WM compile struct.
I'll be using this in merging brw_wm_emit.c and brw_wm_glsl.c
2009-08-12 12:43:43 -07:00
Eric Anholt
536476f243 i965: Handle scalar result swizzling in shared GLSL/non-GLSL code.
This is preparation for merging of brw_wm_glsl.c and
brw_wm_emit.c, and glsl.c doesn't swizzle channel results around.
2009-08-12 12:43:43 -07:00
Eric Anholt
792c49968e i965: Flag ARL-using programs as requiring brw_wm_glsl.c
This doesn't fix the glean testcase, but I guess it provides hope.
2009-08-12 12:43:42 -07:00
Eric Anholt
4e477aa1ba i965: Remove some unused WM opcode args. 2009-08-12 12:43:42 -07:00
Eric Anholt
255e5be265 i965: Avoid re-uploading the index buffer when we don't need to.
No performance difference proven at 95% confidence with my GLSL demo (n=10).
2009-08-12 12:43:42 -07:00
Alex Deucher
a245c05dd3 r600: fix warning 2009-08-12 15:40:15 -04:00
Alex Deucher
b0c191acaf r600: state cleanups 2009-08-12 15:40:15 -04:00
Alex Deucher
2f6675b816 r600: clean up Create/DestroyContext 2009-08-12 15:40:15 -04:00
Pauli Nieminen
b6a4f5f1d3 r200: Prevent TexGenMatrix from leaking when destroying r200 context.
Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-12 15:40:14 -04:00
Brian Paul
855374a76a vbo: fix incorrect pointer 2009-08-12 13:16:41 -06:00
Brian Paul
8f9ee06925 glsl: add gl_Vertex, gl_Normal, etc to list of active attributes
If a vertex shader uses gl_Vertex, gl_Normal, etc, we need to include them
when the user queries the list of active attributes.  Before this we were
just including the user-defined attributes.
2009-08-12 12:35:13 -06:00
Brian Paul
fd5eda1423 glsl: move predefined shader input/output info/code to slang_builtin.c
This is a more logical place for this code.
Also add some functions for querying vertex shader input names, types, etc.
2009-08-12 12:35:12 -06:00
Eric Anholt
2708ddfb06 vbo: Avoid extra validation of DrawElements.
This saves mapping the index buffer to get a bounds on the indices that
drivers just drop on the floor in the VBO case (cache win), saves a bonus
walk of the indices in the CheckArrayBounds case, and other miscellaneous
validation.  On intel it's a particularly a large win (50-100% in my app)
because even though we let the indices stay in both CPU and GPU caches, we
still end up waiting for the GPU to be done with the buffer before reading
from it.

Drivers that want the min/max_index fields must now check index_bounds_valid
and use vbo_get_minmax_index before using them.
2009-08-12 11:28:34 -07:00
Eric Anholt
ef3ad412c7 radeon: Minor warnings cleanup. 2009-08-12 11:28:34 -07:00
Eric Anholt
e643bc5fc7 i965: Use _MaxElement instead of index-calculated min/max for VBO bounds. 2009-08-12 11:28:33 -07:00
Pauli Nieminen
29173d3d5c radeon: Add protection against recursive DRM locking.
Reference counting protects DRM lock call from recursive locking that would
cause hang. Code also adds optional debugging output for recursive call that
is compiled only if NDEBUG is not defined.

This code is not 100% thread safe because mesa doesn't include increment and
test atomic operation. There is built-in gcc functions but they are only
available from gcc 4.2.
2009-08-12 14:14:29 -04:00
Michel Dänzer
5eeb44f398 st/xorg: Acquire/drop DRM master in order to work with multiple servers. 2009-08-12 19:11:11 +02:00
Brian Paul
f21b0e9a04 gallium/glx/xlib: main/ prefix on Mesa includes, remove -I$(TOP)/src/mesa/main/ 2009-08-12 10:32:22 -06:00
Brian Paul
10eb2ca954 gallium/glx/xlib: updated comments 2009-08-12 10:32:22 -06:00
Brian Paul
80b8fbcaba gallium/glx/xlib: delete fakeglx.h 2009-08-12 10:32:22 -06:00
Brian Paul
275d0e7e92 gallium/glx/xlib: rename fakeglx.c to glx_api.c 2009-08-12 10:32:22 -06:00
Brian Paul
622d531296 gallium/glx/xlib: delete glxapi.h 2009-08-12 10:32:22 -06:00
Brian Paul
f5dd1cff94 gallium/glx/xlib: rename fakeglx_fonts.c to glx_usefont.c 2009-08-12 10:32:22 -06:00
Brian Paul
0528d6c704 gallium/glx/xlib: rename glxapi.c to glx_getproc.c 2009-08-12 10:32:22 -06:00
Brian Paul
f546fa00aa gallium/glx/xlib: don't include fakeglx.h 2009-08-12 10:32:22 -06:00
Brian Paul
4a4039e199 gallium/glx/xlib: overhaul and simplification of the Gallium Xlib-based GLX
The old GLX dispatch table stuff isn't needed (same story for the Mesa/Xlib
driver).  The intention of that code was being able to switch on the fly
between the real GLX library and the fake/Xlib-based emulation.  That hasn't
been used in a long time.

Next up: some file renaming.
2009-08-12 10:32:22 -06:00
Cooper Yuan
1e52b8b4e0 r600: A shader is bound that exports Z as a float into Red channel 2009-08-12 17:39:18 +08:00
Chia-I Wu
64e7bb3262 egl: Use _eglAddAtExitCall to free thread infos and displays.
Thread infos and displays are usually not freed by applications.  This
commit add atexit calls to free them.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-11 22:14:35 -06:00
Chia-I Wu
435c7ac24d egl: Add _eglAddAtExitCall.
Add a convenient wrapper to register atexit calls.  Add mutex to
_eglGlobal along the way.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-11 22:14:35 -06:00
Chia-I Wu
0e3687e33d egl: Make _eglGlobal initialize statically.
Now that display and surface hash tables are moved out, _eglGlobal can
be initialized statically.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-11 22:14:35 -06:00
Chia-I Wu
413969a920 egl: Implement _eglFiniDisplay.
_eglFiniDisplay is called at exit time to free allocated displays.  It
is, however, not used right now.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-11 22:14:35 -06:00
Chia-I Wu
621801abd2 egl: Make display and surface hash tables local.
Move display and surface hash tables to egldisplay.c, and have them
initialized on demand.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-11 22:14:35 -06:00
Chia-I Wu
56d2119280 egl: Initialize current thread management on demand.
Current thread management was initialized in _eglInitGlobals, which is
called only in eglGetDisplay.  Since EGL does not require eglGetDisplay
to be called first, the initialization is better to be done on demand.

_eglFiniCurrent is removed, as it is not called at all.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-11 22:14:35 -06:00
Chia-I Wu
f6c2f5e379 egl: Destroy eglThreadInfo on thread exit.
This is done through pthread TSD destructor.  It destroys all thread
infos except for main thread's.  The thread info of the main thread is
destroyed by _eglFiniCurrent.

TLS case is not supported yet.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-11 22:14:35 -06:00
Chia-I Wu
e79d21ca1f egl: Add eglmutex.h.
The implementation uses pthread mutex when available.  Otherwise, it is
no-op.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-11 22:14:35 -06:00
RALOVICH, Kristóf
50f8ca2344 glx: fix signedness warning 2009-08-11 22:14:35 -06:00
Brian Paul
fd90d8000c mesa: handle glDrawPixels images which are larger than max rect texture size 2009-08-11 20:34:22 -06:00
Brian Paul
dba6d52ba0 mesa: added _mesa_meta_draw_pixels() 2009-08-11 20:34:21 -06:00
Brian Paul
f821866360 mesa: added META_FOG and optimize some meta_begin/end() code 2009-08-11 20:34:21 -06:00
Brian Paul
9ba19b892c gallium/trace: remove stray semicolons 2009-08-11 20:34:21 -06:00
Brian Paul
b681f396e6 gallium/xlib: add missing tex_usage parameter 2009-08-11 20:34:21 -06:00
Brian Paul
6deaa6d4b1 gallium/egl: add missing tex_usage parameter 2009-08-11 20:34:21 -06:00
Brian Paul
2e8be3ab79 gallium/xlib: add missing tex_usage parameter 2009-08-11 20:34:21 -06:00
Brian Paul
26a762c2f6 gallium/identity: remove stray semicolons 2009-08-11 20:34:21 -06:00
Alex Deucher
c2b29b5df5 r600: use the drm ioctls for swap and texture upload
NOTE:  THIS REQUIRES AN UPDATED DRM!
2009-08-11 22:21:26 -04:00
Jakob Bornecrantz
164d8e8701 i915g: Reduce max relocs 2009-08-12 03:58:38 +02:00
Jakob Bornecrantz
df9f27822e i915g: Check relocs as well 2009-08-12 03:58:37 +02:00
Jakob Bornecrantz
7a60ed2015 i915g: Implement surface_buffer_create for softpipe
In order to run softpipe on st/xorg we need this function
2009-08-11 18:37:09 +01:00
Jakob Bornecrantz
a41a253ce3 gallium: Add texture usage information to surface_buffer_create
We need aditional meta data about the usage of the surface
	in softpipe because we need to be able tell the diffrence
	between PRIMARY and DISPLAY_TARGET surfaces.
2009-08-11 18:34:43 +01:00
Brian Paul
7013a4dfb8 mesa/glapi: regenerated files from gl_API.xml 2009-08-11 10:00:02 -06:00
Brian Paul
bb45e6f07b gallium: fix debug_printf() format string 2009-08-11 09:30:12 -06:00
Brian Paul
a9d37f6837 glut: fix incorrect Vista maximisation size due to WM_GETMINMAXINFO handling
See bug 23182.
2009-08-11 08:54:25 -06:00
Brian Paul
20e4421fe3 mesa: remove _mesa_set_vp_override() from _mesa_Bitmap()
This reverts part of commit 2c9812e3d3.
The calls to _mesa_set_vp_override() were causing extra state validation
and caused the gallium state tracker's bitmap cache to get flushed on
every call.
2009-08-11 08:38:51 -06:00
Michel Dänzer
e93be5132c r300g: Fix up remaining VAP_CNTL_STATUS writes for big endian. 2009-08-11 09:16:48 +02:00
Michel Dänzer
bb91368003 r300g: Emit relocations for pitch registers.
Fixes CS failures with tiling enabled kernels.
2009-08-11 09:13:12 +02:00
Cooper Yuan
2cbd3fce8f r300g: a typo of debug message 2009-08-11 14:39:58 +08:00
Cooper Yuan
2ccd66d8a0 r600: update num of interp if posizition is used 2009-08-11 14:36:01 +08:00
Eric Anholt
74504c48ad demos: Fix the VBO usage in glsl/multitex.
The fix for 965 to be noisy when apps sent pointers instead of VBO offsets
caught this app in the act of doing exactly that.

Bug #23203
2009-08-10 15:53:47 -07:00
Brian Paul
16a1f68c39 intel: use new _mesa_meta_copy_pixels() function
glCopyPixels() no longer hits a software fallback when zooming, blending, etc.
2009-08-10 15:48:02 -06:00
Brian Paul
edb991b7bc mesa: save/restore texture matrix in meta code
Also, save/restore viewport and texture state in _mesa_meta_copy_pixels()
2009-08-10 15:44:05 -06:00
Brian Paul
2ad10c966c mesa: for meta blit, check max texture size, use glCopyTexSubImage2D() when possible 2009-08-10 15:09:38 -06:00
Brian Paul
c16fa388d3 mesa: initial meta implementation of glCopyPixels() 2009-08-10 15:09:38 -06:00
Brian Paul
36a222cf04 mesa: remove debug flush call 2009-08-10 14:15:56 -06:00
Brian Paul
0109e1b9f3 intel: add missing \n to fprintf() 2009-08-10 13:58:56 -06:00
Brian Paul
8cb389ce35 intel: use new _mesa_meta_blit_framebuffer() function
The previous version of framebuffer blit was a quick hack.  The new meta
version works pretty well.
2009-08-10 13:55:32 -06:00
Brian Paul
33a838beb9 mesa: new driver meta-ops module
Implement glClear() in terms of quad rendering, implement glBlitFramebuffer()
in terms of glCopyTexImage2D + textured quad, etc.

There have been several places in the drivers where we've implemented
meta rendering similar to this.  This is an effort to do it in a more
portable and more efficient form.

The _mesa_meta_begin/end() functions act like glPush/PopAttrib() but are
lighter-weight.  Plus, _mesa_meta_begin() resets GL state back to default
values (texturing off, identity vertex transform, etc) so the meta drawing
functions don't have to worry about it.

For now only _mesa_mesa_blit_framebuffer() and _mesa_meta_clear() are
implemented.  glDrawPixels() and glCopyPixels() would be the next candidates.
2009-08-10 13:55:31 -06:00
Brian Paul
e9d9dab0cd mesa: added GLcontext::Meta field for meta rendering state 2009-08-10 13:55:31 -06:00
Dave Airlie
b4c9569715 radeon_fbo: switch short to byte for 565 2009-08-10 19:58:11 +10:00
Dave Airlie
e0c9157671 radeon: fix cut-n-paste in alphabits in fbo code 2009-08-10 10:10:13 +10:00
Pauli Nieminen
11038989c1 egl: Add depend and depend.bak to clean target
Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-09 08:42:50 -06:00
Dave Airlie
728da99737 r600: looks like a typo 2009-08-09 20:46:12 +10:00
Cooper Yuan
b2927a6204 r600: load per-pixel position into PS in order to use fragment.position.
This patch can fix /progs/fp/tri-depth, tri-depth2, tri-depthwrite,
tri-depthwrite2 and point-position.
2009-08-09 12:18:40 +08:00
Brian Paul
483a7916d1 mesa: update framebuffer status as needed in _mesa_source/dest_buffer_exists() 2009-08-08 07:30:26 -06:00
Brian Paul
101c2f907e mesa: simplify glPushAttrib() list building code 2009-08-08 07:30:26 -06:00
Brian Paul
924ba48499 mesa: remove old, prototype code 2009-08-08 07:30:26 -06:00
Brian Paul
b153340351 swrast: replace GLenum, GLint with GLbitfield for buffer vars 2009-08-08 07:30:26 -06:00
Brian Paul
4482f96c59 mesa: use _mesa_bufferobj_mapped() 2009-08-08 07:30:26 -06:00
Corbin Simpson
10b9d9f895 r300g: Knock out another fragment of invariant state.
Colorbuffer setup will always happen.
2009-08-07 20:50:42 -07:00
Corbin Simpson
847fcb645c gallium: Move minify() to u_math.
minify() is usually used in mipmap size calculation. Strangely enough,
we all defined it as MAX2(1, d >> 1); imagine that. :3
2009-08-07 20:50:42 -07:00
Corbin Simpson
c58133b81a r300g: Remove r300_constant_buffer::user_count.
Not needed with new compiler.
2009-08-07 20:50:42 -07:00
Eric Anholt
a962c07cc3 Revert "i965: Disable texture tiling by default."
This reverts commit b8e638d489.

Now that the known hangs and misrendering issues are fixed, I'm ready to
start encouraging it by default again.
2009-08-07 18:33:08 -07:00
Eric Anholt
ceb8afcca5 intel: Align region height as required for tiled regions.
Otherwise, we would address beyond the end of our buffers.  Fixes reliable
GPU segfault with texture_tiling=true and oglconform shadow.c.

Bug #22406.
2009-08-07 18:33:08 -07:00
Eric Anholt
12c6973c6e i965: Add a note justifying domain choice for the SF VP. 2009-08-07 18:33:08 -07:00
Eric Anholt
b82abaabee intel: Add some more safety asserts in the blit code. 2009-08-07 18:33:08 -07:00
Eric Anholt
9f981ec27d i965: Replace the subroutine-skipping jump in VS with a NOP if it's a NOP.
This showed a 1.9% (+/-.3%, n=3) improvement in OA performance with high
geometry settings.
2009-08-07 18:33:08 -07:00
Jakob Bornecrantz
7de5e60c18 i915g: Don't forget x/y coords in transfers
Fixes demos/ray.
2009-08-08 03:20:24 +02:00
Jakob Bornecrantz
738e02c3c8 i915g: Don't try to free a mapped buffer at shutdown 2009-08-08 03:19:01 +02:00
Alex Deucher
f7474a577d radeon: correct fix for tiling with the legacy build 2009-08-07 17:36:07 -04:00
Eric Anholt
a2a3d8d7f0 intel: Fix googleearth by avoiding GL_VIEWPORT_BIT in meta clear push/pop
I have no idea why this fixes things, but being more efficient sounds good
anyway.  Fixes regression in 99d07d0f91
where most of the lit half of the world was not drawn.
2009-08-07 14:04:11 -07:00
Alex Deucher
caf4f0ede7 radeon: fix the build with older drm headers 2009-08-07 16:20:26 -04:00
Pauli Nieminen
0d7fafa0ed dri: Fix problems with unitialized values in dri screen object.
This fixes crash in r200 KMS driver when pSAREA was set to 1 randomly because of memory wasn't cleared.

Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-08-07 13:48:26 -06:00
Brian Paul
9de26ccbcc util: fix incorrect assertion
Check that the dest surface/format is renderable.
2009-08-07 13:48:26 -06:00
Brian Paul
f36d012191 util: include u_surface.h, added comment 2009-08-07 13:48:26 -06:00
Brian Paul
513a82cb1b util: use util_same_surface() to compare surface pointers 2009-08-07 13:48:26 -06:00
Brian Paul
abb120fe5b util: added util_same_surface() helper function 2009-08-07 13:48:26 -06:00
Robert Ellison
2caec748ad tests: have getprocaddress return a return code
These minor changes allow getprocaddress to return an error code
in the case of test failure.  This allows the program to be integrated
into the piglit test suite.
2009-08-07 12:23:19 -06:00
Robert Ellison
99d5139078 mesa: improve getprocaddress test
- Allow the getprocaddress test to test extensions not supported by
  Mesa.  The original getprocaddress.py script only included OpenGL
  extension functions that were in Mesa dispatch tables.  Now all
  known extension functions (as detailed in gl_API.xml) are included.
  As the test does not link against any extension function symbols
  (i.e. it uses glXGetProcAddress() for all extension functions),
  it still compiles and links against Mesa; but now the same
  binary can be used to test extensions not yet supported by Mesa.

- Extend the list of tested extension functions.  The last revision
  of this test exercised 16 extension functions; this revision adds
  support for 95 more.
2009-08-07 12:06:17 -06:00
Brian Paul
1359d69f11 st/mesa: remove redundant calls to _mesa_set_vp_override()
Called from core Mesa now.
2009-08-07 10:49:38 -06:00
Brian Paul
c02b38d169 progs/xdemos: added multictx.c (multi-context rendering demo)
Create one window and render into it with two GLX contexts.  Setup the
rendering state differently for each context to be sure there's no state
"bleeding" between contexts.
2009-08-07 09:52:18 -06:00
Brian Paul
2c9812e3d3 mesa: use _mesa_set_vp_override() in glDraw/CopyPixels and glBitmap
We don't use the vertex program in these functions and the driver may
install its own.  This fixes the broken glCopyPixels swrast fallback in
i965 and possibly other drivers.  In particular, glCopyPixels sometimes
didn't work because the fixed-function fragment program was replacing all
fragment colors with the current raster color.
2009-08-07 09:51:50 -06:00
Brian Paul
6807d96f8e mesa: reformat code to allow setting breakpoints on the true-statement 2009-08-07 09:50:38 -06:00
Brian Paul
84e67330e1 glxgears: make functions static, update comments 2009-08-07 09:50:38 -06:00
Brian Paul
7bf6efe780 mesa: use _mesa_bufferobj_mapped() 2009-08-07 09:50:38 -06:00
Brian Paul
67153a4518 mesa: new _mesa_bufferobj_mapped() helper function 2009-08-07 09:50:38 -06:00
Brian Paul
f738b913e6 mesa: use valid_fragment_program() helper 2009-08-07 09:50:38 -06:00
Brian Paul
94504be63a mesa: test DrawBuffer, not ReadBuffer in _mesa_dest_buffer_exists()
Also, update comments.
2009-08-07 09:50:38 -06:00
Brian Paul
2dec62405f mesa: fix some incorrect error checks in _mesa_error_check_format_type()
Plus, simplify the code a bit.
2009-08-07 09:50:38 -06:00
Brian Paul
3335b847bf mesa: do error checking on glCopyPixels() type parameter
Plus, move some other error checks before state validation and update
some comments.
2009-08-07 09:50:38 -06:00
Brian Paul
28cfd37bb3 mesa: use a more logical flag in _mesa_set_vp_override() 2009-08-07 09:50:38 -06:00
Brian Paul
b28854088b mesa: new _mesa_copy_client_array() function 2009-08-07 09:50:38 -06:00
Brian Paul
692c50b388 i965: minor context comments 2009-08-07 09:50:38 -06:00
Brian Paul
922ef4a119 intel: minor context comments 2009-08-07 09:50:38 -06:00
Brian Paul
6e0be1cc34 intel: move blit call out of assert() 2009-08-07 09:50:38 -06:00
Brian Paul
4d24feddff intel: fix typo: s/softare/software/ 2009-08-07 09:50:37 -06:00
Brian Paul
3105fd760b mesa: fix comment 2009-08-07 09:50:37 -06:00
Dave Airlie
239c8bfb10 radeon: enable tiling fallbacks in 3D driver.
Only really got good testing on r500 so far, need to enable in
DDX and play some more.
2009-08-07 19:40:59 +10:00
Dave Airlie
2dc3fb7803 radeon span: add r200 depth/stencil span read/writing
this should only really affect DRI2 since we mostly have a surface in DRI1.

I don't think this is perfect yet, but it is a better start than nothing.
2009-08-07 16:16:08 +10:00
Dave Airlie
eaf87e84c3 r200: fix scissor emission for r200 under kms 2009-08-07 14:13:19 +10:00
Ian Romanick
3cb6f3bf21 GL_ARB_vertex_array_bgra is (basically) a synonym for the EXT version 2009-08-06 15:26:35 -05:00
Alan Hourihane
45b12edcbe Ensure GL_EXT_blend_equation_separate is enabled when 2.0 is enabled. 2009-08-06 15:56:05 +01:00
Chia-I Wu
e179ab2815 progs/egl: Add xeglbindtex, really.
Missed this file in the earlier commit.
2009-08-06 08:40:03 -06:00
Jakob Bornecrantz
8fdda95162 mesa: Ignores
Got tired of seeing these files in git status all the time
2009-08-06 13:59:48 +01:00
Jakob Bornecrantz
8662f2c542 i915g: Compile with scons 2009-08-06 13:50:46 +01:00
Jakob Bornecrantz
c818efd0b3 identity: Use the correct texture 2009-08-06 13:20:49 +01:00
Eric Anholt
f44916414e i965: Fix source depth reg setting for FSes reading and writing to depth.
For some IZ setups, we'd forget to account for the source depth register
being present, so we'd both read the wrong reg, and write output depth to
the wrong reg.

Bug #22603.
2009-08-05 20:20:02 -07:00
Jakob Bornecrantz
b6c6551686 st/xorg: If we have DRI2 we should also have some sort of hw support 2009-08-06 00:52:13 +01:00
Jakob Bornecrantz
b6c9401f13 i915g: Always run in sync with the HW 2009-08-06 00:52:13 +01:00
Jakob Bornecrantz
901b87547e i915g: The i915 seems more happier with sampler domain so lets use that 2009-08-06 00:52:13 +01:00
Jakob Bornecrantz
7a20f50c60 i915g: Dirty fix for VBO module double flush assert 2009-08-06 00:52:13 +01:00
Jakob Bornecrantz
66b00380a2 i915g: Switch to mapping the batch buffer instead of using subdata 2009-08-06 00:52:13 +01:00
Chia-I Wu
246f58d922 progs/egl: Add xeglbindtex.
This is a simple demo for eglBindTexImage.  It uses a OpenGL context,
instead of the required OpenGL ES one.  But it still suffices the demo
and test purpose.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-05 16:08:48 -06:00
Chia-I Wu
6f97a41964 egl_softpipe: Add support for pbuffer binding.
This adds support for eglBindTexImage and eglReleaseTexImage.  They rely
on the state tracker to do the real work.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-05 16:08:07 -06:00
Chia-I Wu
0153614cb0 egl_softpipe: Flush when switching current context.
Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-05 16:07:39 -06:00
Chia-I Wu
54a7115fc2 mesa/st: Add support for binding pipe surface to texture.
This commit adds functions to bind a pipe surface to a texture.  This
allows texturing directly from the surface.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-05 16:07:19 -06:00
Chia-I Wu
42b6b067ac mesa/main: Add functions to clear and dirty texture objects.
This commit adds a function to clear a texture object such that there is
no image data associated with it, and a function to dirty it so that it
will be re-tested for completeness.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-05 16:06:50 -06:00
Brian Paul
1f71305993 Merge branch 'mesa_7_5_branch'
Conflicts:

	src/mesa/main/state.c
2009-08-05 14:13:48 -06:00
Jakob Bornecrantz
3905119b47 st/xorg: Make it work again 2009-08-05 19:29:31 +01:00
Jakob Bornecrantz
8ccec83e63 st/egl: Create primary texture not display target 2009-08-05 19:29:30 +01:00
Jakob Bornecrantz
0500404cdf i915g: Treat primary textures as scanout buffers 2009-08-05 19:29:30 +01:00
Jakob Bornecrantz
ec269c198a i915g: Link with trace on EGL and Xorg 2009-08-05 19:29:30 +01:00
Jakob Bornecrantz
1f9ee623d1 trace: Use correct texture in drm_api wrapper 2009-08-05 19:29:29 +01:00
Jakob Bornecrantz
6160c8be57 softpipe: Also defere primary textures to backend 2009-08-05 19:29:29 +01:00
Dave Airlie
ac3de85eb6 r200: emit colorpitch 2009-08-05 11:26:29 +10:00
Eric Anholt
63d7a2f53f i965: Fix dangerous warning I let slip in. 2009-08-04 18:07:01 -07:00
Eric Anholt
78c022acd0 i965: Respect CondSwizzle in OPCODE_IF.
Fixes piglit glsl-vs-if-bool and progs/glsl/twoside, and will likely be
useful for the looping code.

Bug #18992
2009-08-04 18:06:34 -07:00
Eric Anholt
7007f8b352 i965: Emit conditional code updates as required for GLSL VS if statements.
Previously, we'd be branching based on whatever condition code happened to be
laying around.
2009-08-04 18:06:34 -07:00
Eric Anholt
011244853b i965: Don't set pop_count in the reserved MBZ area of IF statements. 2009-08-04 18:06:34 -07:00
Eric Anholt
8288ab4518 i965: Print out ELSE and ENDIF src1 arguments like IF does. 2009-08-04 18:06:34 -07:00
Roland Scheidegger
8b9a5cfce0 r200: fix off-by-one errors causing 6th texture unit to not work
both for normal and cube textures, this fixes demos/multiarb
(with 6 enabled texture units) and fixes #23142.
2009-08-05 02:33:34 +02:00
Roland Scheidegger
7c0fb3a1be r200: fix compiler warning (unused var) 2009-08-05 02:33:34 +02:00
Roland Scheidegger
15f5f839b1 radeon: fix miptree comparison breakage
another case of image never matching miptree in case of compressed textures
2009-08-05 01:13:22 +02:00
Roland Scheidegger
80cab49481 intel: implement intelCompressedTexSubImage2D
similar to the radeon code.
passes tests/texcompsub
2009-08-05 01:13:22 +02:00
Roland Scheidegger
0abc9e7565 tests: also test xoffset in texcompsub test
use glCompressedTexSubImage2DARB also with xoffset by splitting into 3 calls
in total. Dunno if the top/bottom reversal is intentional but leave as is.
2009-08-05 01:13:21 +02:00
Eric Anholt
de80eeea0e intel: Add support for EXT_provoking_vertex. 2009-08-04 15:32:18 -07:00
Eric Anholt
b010814e9c i965: Spell "conditional" correctly. 2009-08-04 15:32:18 -07:00
Eric Anholt
1d4bace9fc i965: Hook up the disassembler for INTEL_DEBUG={wm,vs}.
I was getting tired of doing the dance of INTEL_DEBUG=batch, copying it out,
and running intel-gen4disasm on it.
2009-08-04 15:32:18 -07:00
Eric Anholt
ce63e9929c i965: Initial import of disasm code from intel-gen4asm.
There's a bunch of stuff from gen4asm and gpu-tools that we probably want
to make into a library instead of cargo-culting it around.
2009-08-04 15:32:18 -07:00
Eric Anholt
def85826a0 i965: warning fix 2009-08-04 15:32:17 -07:00
Brian Paul
cd7a8225e8 tests/getteximage: test more texture sizes, including npot 2009-08-04 16:17:09 -06:00
Brian Paul
a746ef28df mesa: log the shader checksum 2009-08-04 15:36:29 -06:00
Brian Paul
f7783badb5 mesa: compute, print shader checksum 2009-08-04 15:36:29 -06:00
Brian Paul
b501263bf5 mesa: added gl_shader::SourceChecksum field (for debug purposes) 2009-08-04 15:36:28 -06:00
Brian Paul
9f8110adcc mesa: added _mesa_str_checksum() 2009-08-04 15:36:28 -06:00
Brian Paul
84c8315ae6 mesa: clean-up error debug/count code 2009-08-04 15:36:28 -06:00
Brian Paul
def77160d6 mesa: reset ErrorDebugCount to zero in glGetString() 2009-08-04 15:36:28 -06:00
Brian Paul
b98f0f2d51 mesa: better texture dump/debug code 2009-08-04 15:36:28 -06:00
Brian Paul
2b82bc93e2 mesa: more error message info for vertex pointer functions 2009-08-04 15:36:28 -06:00
Brian Paul
2465c4fa9c mesa: more glGetTexImage() error checking consolidation, new assertion 2009-08-04 15:36:28 -06:00
Eric Anholt
191e028de2 i965: Fix RECT shadow sampling by not losing the other texcoords.
Bug #20821
2009-08-04 12:43:18 -07:00
Dan Nicholson
23671e5358 mklib: Ensure target directory exists for library
Instead of relying on the Makefile to always generate $(TOP)/$(LIB_DIR),
just have mklib handle creating the directory. This should fix any races
when using parallel make.

Signed-off-by: Dan Nicholson <dbn.lists@gmail.com>
2009-08-04 06:25:26 -07:00
Michel Dänzer
048f988aeb r300g: Slightly saner initialization of some texture / transfer fields. 2009-08-04 10:57:47 +02:00
Eric Anholt
d7430d942f i965: Assert that the offset in the VBO is below the VBO size.
This avoids sending a bad buffer address to the GPU due to programmer error,
and is permitted by the ARB_vbo spec.  Note that we still have the opportunity
to dereference past the end of the GPU, because we aren't clipping to a
correct _MaxElement, but that appears to be harder than it should be.  This
gets us the 90% solution.

Bug #19911.
2009-08-03 17:56:49 -07:00
Eric Anholt
e340d4f986 i965: Even if no VS inputs are set, still load some amount of URB as required.
See comment on Vertex URB Entry Read Length for VS_STATE.

This, combined with the previous three commits, fixes #22945.
2009-08-03 17:19:03 -07:00
Eric Anholt
e93848e595 i965: Make sure the VS URB size is big enough to fit a VF VUE.
This fix is just from code and docs inspection, but it may fix hangs on
some applications.
2009-08-03 17:19:03 -07:00
Eric Anholt
d1fbfd0f96 i965: Don't emit bad packets when no VBs are referenced.
It appears that sometimes Mesa (and I suppose a VS could as well) emits
a program which references no vertex data, and thus we end up with
nr_enabled == 0 even though some VBs are enabled.  We'd end up emitting
VB/VE packet headers of 0xffffffff in that case, leading to GPU hangs.

Bug #22945 (wine with an uncompiled VS)
2009-08-03 17:19:03 -07:00
Eric Anholt
9b9cb30d12 i965: Calculate enabled[] and nr_enabled once and re-use the values.
The code duplication bothered me.
2009-08-03 17:19:03 -07:00
Robert Ellison
1f1ead9947 typo fix
somehow, this change was missed on the last checkin
2009-08-03 17:09:14 -06:00
Robert Ellison
0d18e9259e mesa: fix up some GLAPI XML
- Added specifications for the extensions GL_APPLE_flush_buffer_range and
  GL_APPLE_texture_range

- EXT_framebuffer_object.xml strangely held specifications for both
  the GL_EXT_framebuffer_object extension and the GL_EXT_texture_array
  extension.  Split out the GL_EXT_texture_array data into its own
  file.
2009-08-03 17:04:50 -06:00
Roland Scheidegger
50c736589e radeon: more fixes for compressed textures
- fix not respecting required hardware stride with compressedTexImage -
  this fixes #22615.
- make sure correct stride is used in various places
- fix stored miptree never matching with a TexImage call with compressed
  texture
- don't always store data with compressedtexsubimage at offset 0,
  and actually use the supplied pixel data... (untested)
- make sure rows for compressed texture handling are rounded up not down

Note that trying to access stored compressed textures in hardware miptrees
from core mesa (get_compressed_teximage, swrast fallbacks) can't work correctly,
since RowStride isn't really set to anything useful, plus some places (at least
get_compressed_teximage) assume this data has native stride and no padding.
2009-08-04 00:21:07 +02:00
Eric Anholt
4221e81b24 radeon: Fix inverted test for disabling flushing of front buffer output.
(corresponding fix to the intel driver one)
2009-08-03 14:40:46 -07:00
Eric Anholt
fd65418f60 intel: Fix inverted test for disabling flushing of front buffer output.
The comment disagreed with the code, and nicely drew my eyes to what was
going wrong.

Bug #21774 (blender)
Bug #21788 (readpix)
2009-08-03 14:33:40 -07:00
Eric Anholt
0828579a65 intel: Wait on the last swapbuffers to complete before queuing a new one.
This fixes jerkiness in doom3 and other apps since the kernel change to
throttle less absurdly, which led to a thundering herd of frames.

Because this is a rather minimal fix, there is at least one downside: If
the whole scene completes in one batchbuffer, we'll end up stalling the GPU.

Thanks to Michel Dänzer for suggesting using glFlush to signal frame end
instead of going to all the effort of adding a new DRI2 extension.
2009-08-03 13:34:07 -07:00
Alex Deucher
e0d61fd696 r600: add some new r7xx pci ids 2009-08-03 16:10:32 -04:00
Eric Anholt
a9ba1bfeb3 texenv: Use VP->Current, since _Current isn't updated at this point. 2009-08-03 12:54:41 -07:00
Eric Anholt
40990d9dfb texenv: Match state.c in deciding whether we'll be using a vertex shader. 2009-08-03 12:54:33 -07:00
Eric Anholt
03187571b6 texenv: Add missing dependency on VP changes.
Funny thing is I annotated this dependency in
e5f63c403b, but didn't actually use it.
2009-08-03 12:54:17 -07:00
Chia-I Wu
7420e33848 egl_softpipe: Add support for pbuffer surface.
Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-03 11:36:08 -06:00
Chia-I Wu
8a130a65aa egl: Correct the default values of surface attributes.
EGL_TEXTURE_FORMAT and EGL_TEXTURE_TARGET should default to
EGL_NO_TEXTURE.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-03 11:35:44 -06:00
Chia-I Wu
8cdc6c66f9 egl: Make eglMakeCurrent more robust.
Now that a current surface points back to its binding context, and a
current context points back to its binding thread, make sure there is no
dangling pointers.  This commit reworks eglMakeCurrent, adds more checks
to avoid stealing context or surfaces from another thread, and correctly
destroys unlinked context and surfaces.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-03 11:35:14 -06:00
Chia-I Wu
07ee01365a egl: Replace IsBound by a pointer to the binding.
IsBound tells if a context or surface is current.  What it does not tell
is, to which thread a context is current, or to which context a surface
is current.  This commit replaces IsBound by a pointer to the binding
thread or context.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-08-03 11:34:37 -06:00
Brian Paul
27148ccaba gl: upgrade wglext.h to version 15 2009-08-03 11:24:09 -06:00
Brian Paul
39bf48f281 gl: upgrade glxext.h to version 23 2009-08-03 11:24:09 -06:00
Brian Paul
2d725dac40 gl: upgrade glext.h to version 54 2009-08-03 11:24:09 -06:00
Brian Paul
4f61bc135a tgsi: report opcode name in addition to the number when translation fails 2009-08-03 11:24:09 -06:00
Brian Paul
c3c90c2dd9 tgsi: added tgsi_get_opcode_name() 2009-08-03 11:24:09 -06:00
Brian Paul
2e9bf10014 gallium: comments, reformatting 2009-08-03 11:24:09 -06:00
Alex Deucher
f538d02753 r600: add some missing pci ids 2009-08-03 11:21:10 -04:00
Alex Deucher
583ed4aae5 r600: fix the build when RADEON_DEBUG_BO is set 2009-08-03 03:12:56 -04:00
Alex Deucher
282c0c411c r600: fix r600SetTexOffset
We need to properly set up a fake bo for the texture override,
so add a new function to radeon_bo_legacy.c.  This could probably
be used on radeon/r200/r300 to unify the bo handling for
texture override.

compiz now works :)
2009-08-03 02:28:22 -04:00
Corbin Simpson
30bca7a4e6 Merge commit 'nha/r300-compiler-gallium' 2009-08-02 16:56:52 -07:00
Alex Deucher
d07bf2b35c r600: handle state emit better
- move shader-related state with the rest of the shader setup/emit
- start to track dirty state better
2009-08-02 18:26:12 -04:00
vehemens
562ca49611 r600: Logic Operations Fix
fixes bug 23087
2009-08-02 18:03:58 -04:00
Alex Deucher
5e51903606 r600: fix regression in texenv
Emit shader consts with the shader program itself
2009-08-02 13:29:18 -04:00
Nicolai Hähnle
b1700b03af r300: Fix a regression on non-KMS
The regression was introduced by 9a1c336253

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-08-02 16:24:52 +02:00
Alex Deucher
86ac0ae0b0 r600: fix rectangle textures
It might be better to add an instruction to normalize the
coordinates for rectanglular textures as there are some limitations
to wrap modes on unnormalized tex coords.

fixes texrect
2009-08-01 20:55:43 -04:00
Nicolai Hähnle
9a1c336253 r300: Fix corner-case of KIL on R300
R300 hardware (but _not_ R500) hardware requires an enabled texture unit
if KIL is used in fragment programs. We now work around the CS checker
correctly when enabling such a fake texture unit.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-08-01 19:00:55 +02:00
Nicolai Hähnle
3d21e3d3a2 r300: Fix Z buffer re-emit after window resize
We used to not always correctly re-emit the Z buffer size in all cases,
in particular the clear path, and invalidated state was not always picked
up correctly.

This fixes a bug where the kernel CS checker correctly complains about
a Z buffer that is too small.

Note that this bug was probably only visible with ridiculously high
framerates, i.e. glxgears.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-08-01 17:16:50 +02:00
Patrice Mandin
fc3d564dae mesa st: Use POT texture for draw pixels operations if NPOT texture is not supported 2009-08-01 11:15:18 +02:00
Patrice Mandin
c1785c19ca mesa st: Move logbase2 function to util/u_math.h 2009-08-01 11:03:30 +02:00
Roland Scheidegger
801c3fcbca radeon: fix r100/r200 compressed texture stride
This almost fixes compressed mipmapped textures on r200, though some small
mip levels are still broken.
Leave r300 compressed texture stride as is though afaik it's different
to pre-radeon-rewrite too. Also do the fixup for rs600 uncompressed row stride
at same place.
2009-07-31 23:24:44 +02:00
Roland Scheidegger
2730ee75c7 radeon: s/r300/radeon in shared code error message 2009-07-31 23:20:22 +02:00
Brian Paul
f7618f4f37 swrast: fix incorrect texcoord attribute test 2009-07-31 13:57:03 -06:00
Brian Paul
23c0e812bc draw: fix-ups for point coord attribute
progs/glsl/pointcoord.c works again
2009-07-31 13:56:17 -06:00
Pauli Nieminen
55bc8b1390 radeon: Cliprects has to be updated before doing anything with clip rectangles
Reported to fix corruption while dragging an active window by John Bridgman.

Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-31 21:44:31 +02:00
Pauli Nieminen
1fcb321e2f radeon: Remove unused variable from context.
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-31 21:39:25 +02:00
Alex Deucher
95b64c0ed2 r600: make sure bos are valid before usign that 2009-07-31 15:11:41 -04:00
Alex Deucher
80d80d23b6 r600: fix reloc setup
re-use the same reloc index for bos that are referenced
multiple times.

Fixes rain demo.
2009-07-31 14:52:56 -04:00
Alex Deucher
177c33c481 r600: remove unused offset_mod stuff
this is a step in migrating to the common cs code
2009-07-31 14:52:56 -04:00
Alex Deucher
19ce428c8a r600: ensure we have enough room for full state emit
full state is roughly 4000 dwords, but will vary depending
on the rendering.
Also fix some warnings.
2009-07-31 14:52:56 -04:00
Alex Deucher
54a1641923 r600: unify state emit into one function 2009-07-31 14:52:55 -04:00
Alex Deucher
be1687a892 r600: re-arrange state setup and emit so they are not mixed 2009-07-31 14:52:55 -04:00
Michal Krol
cb90c43676 Rename TGSI LOOP instruction to better match theri usage.
The LOOP/ENDLOOP pair is renamed to BGNFOR/ENDFOR as its behaviour
is similar to a C language for-loop.

The BGNLOOP2/ENDLOOP2 pair is renamed to BGNLOOP/ENDLOOP as now
there is no name collision.
2009-07-31 18:14:40 +02:00
Chia-Wu
dc516d6e2a egl: Silence warnings on x86-64.
Casting an unsigned int to or from a pointer directly gives warnings on
x86-64.  Add wrappers to silence the warnings.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-07-31 07:30:13 -06:00
Alex Deucher
826f1f9c6f r600: get updated pending age from cs ioctl
REQUIRES AN UPDATED DRM
2009-07-31 02:13:43 -04:00
Alex Deucher
643d52a394 r600: warning fixes 2009-07-30 21:32:36 -04:00
Alex Deucher
e0e51ab1ea r600: split primitive draw into a separate function 2009-07-30 21:32:36 -04:00
Nicolai Hähnle
d0c398a8e2 r300g: Use radeon compiler for fragment programs
This is entirely untested on R500, and needs more testing on R300.
2009-07-30 23:55:12 +02:00
Nicolai Hähnle
fbc88a7334 r300g: Remove extraneous printf
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-30 23:45:18 +02:00
Nicolai Hähnle
188f8c6792 r300g: Use r300compiler for vertex shaders 2009-07-30 23:45:18 +02:00
Nicolai Hähnle
cab62aa28f r300/compiler: Remove inst_offset from r500_fragment_program_code
The field is not used, and in any case it would be more interesting to
manipulate from *outside* the compiler if we ever wanted to load several
fragment programs at the same time or something.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-30 23:42:59 +02:00
Ian Romanick
9f26f801dc progs/vp: Correct the PARAM array sizes in arl-*.txt 2009-07-30 14:08:53 -07:00
Ian Romanick
565a2a8f38 ARB prog parser: Add support for RGBA components to SWZ instruction in fp 2009-07-30 10:51:43 -07:00
Chia-I Wu
27fb3ff858 softpipe: Mark texture dirty when unmapped.
When a texutre transfer is mapped for writing, mark the texture dirty
when unmapped.  This was done in surface creation, and this commit moves
it to happen in texture unmapping.

This fixes subtex test in progs/tests/.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-07-30 10:42:46 -06:00
Ian Romanick
17534ab88c ARB prog parser: Prevent NULL ptr deref for KIL instruction
The KIL instruction doesn't have a destination register, so
dereferencing dst in asm_instruction_ctor would cause a segfault.
2009-07-30 09:41:35 -07:00
Brian Paul
9c936403de mesa: re-enable _mesa_source_buffer_exists() call
Somehow this code wound up inside a comment a while back.
2009-07-30 10:04:42 -06:00
Brian Paul
4406f79402 mesa: get_current_tex_unit() helper function 2009-07-30 09:59:52 -06:00
Brian Paul
25be043940 mesa: refactor glGetTexImage error checking code 2009-07-30 09:50:36 -06:00
Brian Paul
783a93a2c3 tests: glGetTexImage() test 2009-07-30 09:46:57 -06:00
Brian Paul
c156eeb682 mesa: simplify _mesa_select_tex_image() 2009-07-30 09:24:01 -06:00
Brian Paul
9c9a9abd7b mesa: simplify _mesa_set_tex_image() 2009-07-30 09:10:26 -06:00
Brian Paul
1e355a0cb3 Merge branch 'mesa_7_5_branch' 2009-07-30 09:03:43 -06:00
Brian Paul
288299ae12 Merge branch 'mesa_7_5_branch' 2009-07-30 08:24:10 -06:00
Brian Paul
e87320b5e0 Merge branch 'mesa_7_5_branch' 2009-07-30 08:22:57 -06:00
Brian Paul
aefaeba54a docs: document new i915/945 extensions 2009-07-30 08:22:26 -06:00
Thomas Hellstrom
98ba6cfb4c mesa st: Change the preferred internal format for some RGB formats.
For GL_RGB5, GL_RGB4 and GL_R3_G3_B2, prefer
PIPE_FORMAT_R5G6B5_UNORM over PIPE_FORMAT_A1R5G5B5_UNORM, since hardware
is more likely to support the previous format for rendering.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2009-07-30 12:43:35 +02:00
Thomas Hellstrom
f583745519 mesa st: Report unsupported render-to-texture formats.
If a texture image is bound to a framebuffer for render-to-texture, but
the hardware doesn't support rendering to its internal format,
report the framebuffer as incomplete with FRAMEBUFFER_UNSUPPORTED.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2009-07-30 12:43:35 +02:00
Michal Krol
6c70285e33 tgsi: Add proper constraints to sanity. 2009-07-30 11:39:06 +02:00
Michal Krol
cf8907018e tgsi: Declare a LOOP register.
The only valid usage for LOOP/ENDLOOP instructions
is LOOP[0] as a destination register.
The only valid usage for the remaining instructions
is LOOP[0].x as an indirect register.
2009-07-30 10:34:06 +02:00
Michal Krol
65fb2c52f9 tgsi: Fix number operands for LOOP/ENDLOOP. 2009-07-30 10:33:18 +02:00
Michal Krol
1e9d3ad4e1 vbo: Fix build on windows. 2009-07-30 10:31:57 +02:00
Michal Krol
b724dd28e2 tgsi: Document LOOP/ENDLOOP instruction operation. 2009-07-30 10:14:17 +02:00
Xiang, Haihao
3e2b6a2049 i965: Postpone ff_sync message in CLIP kernel on IGDNG
In addition, it guarantees ff_sync message is issued
2009-07-30 15:40:08 +08:00
Alex Deucher
0fdac3529c r600: fix mipmaps
redbook mipmap works
2009-07-30 03:31:37 -04:00
Eric Anholt
246729162c i915: Add support for EXT_stencil_two_side and ATI_separate_stencil.
Passes tests/stencil_twoside and glean/stencil2.
2009-07-29 21:25:39 -07:00
Ian Romanick
600710907c ARP prog parser: Implement the spec, not what makes sense 2009-07-29 21:07:41 -07:00
Eric Anholt
92b9aa1646 i915: Add ARB_point_sprite since we already expose NV_point_sprite.
It's all fallbacks anyway due to the DD_POINT_ATTEN fallback.
2009-07-29 20:56:14 -07:00
Ian Romanick
48183ca8b6 ARB prog parser: Get program limits from the context
Some debug code from the older stand-alone version of the assembler
was hanging around and needed to go.
2009-07-29 20:51:38 -07:00
Ian Romanick
cbe4133109 ARB prog lexer: attenuation is not just for vp 2009-07-29 20:42:28 -07:00
Ian Romanick
333bb4f291 ARB prog parser: Finish implementing fp state.depth.range 2009-07-29 20:41:48 -07:00
Ian Romanick
e511633985 ARB prog: Fix the order of swizzle application
The swizzle used to generate the "original" value from the value
stored in the parameter array happens before the swizzle specified in
the instruction.  This fixes problems seen in progs/vp/vp-tris with arl-*.txt.
2009-07-29 20:07:59 -07:00
Brian Paul
9d0b8d72d8 mesa: add new FRAG_ATTRIB_FACE and FRAG_ATTRIB_PNTC fragment program inputs
Previously, the FOGC attribute contained the fragment fog coord, front/back-
face flag and the gl_PointCoord.xy values.  Now each of those things are
separate fragment program attributes.  This simplifies quite a few things in
Mesa and gallium.

Need to test i965 driver and fix up point coord handling in the gallium/draw
module...
2009-07-29 20:07:41 -06:00
Brian Paul
b9889517f5 gallium: fix SSE shadow texture instructions
When sampling a 2D shadow map we need 3 texcoord components, not 2.
The third component (distance from light source) is compared against
the texture sample to return the result (visible vs. occluded).

Also, enable proper handling of TGSI_TEXTURE_SHADOW targets in Mesa->TGSI
translation.  There's a possibility for breakage in gallium drivers if
they fail to handle the TGSI_TEXTURE_SHADOW1D / TGSI_TEXTURE_SHADOW2D /
TGSI_TEXTURE_SHADOWRECT texture targets for TGSI_OPCODE_TEX/TXP instructions,
but that should be easy to fix.

With these changes, progs/demos/shadowtex.c renders properly again with
softpipe.
2009-07-29 16:33:58 -06:00
Alex Deucher
9c4c9f2837 r600: remove extraneous semicolon 2009-07-29 18:12:33 -04:00
Alex Deucher
b116f57bac r600: fix texture pitch alignment
fixes texwrap
2009-07-29 18:06:20 -04:00
Alex Deucher
1e207ba9c1 r600: minor fixes
- set MAX_LOD properly
- min texel pitch is 8 texels
- emit old command buffer when re-initing base state
2009-07-29 17:25:56 -04:00
Nicolai Hähnle
0723cd1b0a r300: Cleanup r300_fragment_program_code
Configuration register values are now stored directly in that structure.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-29 21:15:00 +02:00
Nicolai Hähnle
d3a1fc62f4 r300/compiler: Adapt AllocateHwInputs interface to common usage pattern
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-29 21:15:00 +02:00
Eric Anholt
88ebf514a4 swrast: enable ARB_vertex_array_object.
It was getting enabled anyway but without the entrypoints installed.  Whoops.
2009-07-29 11:17:53 -07:00
Ian Romanick
8a430dd4da Indentation fixes. 2009-07-29 09:50:06 -07:00
Ian Romanick
4c5879ff31 ARB prog parser: Set NumAttributes based on the number of attribs read 2009-07-29 09:47:14 -07:00
Cooper Yuan
03607708b0 r600: emit fog color in PS input map, fix fog related applications 2009-07-29 15:31:41 +08:00
Cooper Yuan
0f6d3aece7 R6xx/r7xx: VS export fog color as parameter 2009-07-29 15:23:56 +08:00
Ian Romanick
648dac4251 ARB prog parser: Set component negation mask for SWZ instruction 2009-07-28 21:57:28 -07:00
Ian Romanick
86b33b5649 ARB prog parser: Set correct register file for OUTPUT variables 2009-07-28 21:56:42 -07:00
Ben Skeggs
693f900b16 nv50: support non-blocking query_result() 2009-07-29 11:19:52 +10:00
Ben Skeggs
625bc0cfa2 nouveau: map_range returning -EBUSY isn't necessarily an error 2009-07-29 10:58:05 +10:00
Christoph Bumiller
84166a021f nv50: correct zeta formats
What was Z24S8 before is actually S8Z24, and what we had for Z16
is actually X8Z24. Now, we also have the REAL Z24S8 and I added
Z32_FLOAT as well; most of the formats need different tile_flags.
2009-07-29 09:40:35 +10:00
Christoph Bumiller
987c59c486 nv50: use new 2D surface format names 2009-07-29 09:40:35 +10:00
Christoph Bumiller
1f17b8ff59 nv50: support more vtxelt formats
NOTE: we must not try to emit buffer relocations when
vtxbuf_nr is 0 but vtxelt_nr is not
2009-07-29 09:40:35 +10:00
Christoph Bumiller
72813ba5b6 nv50: should use uint32_t ptr in draw_elements_inline_u32 2009-07-29 09:40:34 +10:00
Christoph Bumiller
df189c9efc nv50: TIC/TSC fixes and additions
Red and blue were interchanged in TIC.
Add border color and some formats.
2009-07-29 09:40:34 +10:00
Christoph Bumiller
f498ccd654 nv50: fix sx/dx typo in transfer_rect_m2mf 2009-07-29 09:40:34 +10:00
Christoph Bumiller
d1b9183e64 nv50: fix viewport transform
The translation also needs to be inverted, and in bypass mode
the state tracker incorrectly assumes that Y = 0 = TOP, so we
need inversion there to; NDC clipping has to be deactivated
explicitly.
2009-07-29 09:40:34 +10:00
Christoph Bumiller
b0341f994f nv50: use correct scissor reg 2009-07-29 09:40:33 +10:00
Alex Deucher
8c56029b1e r600: fix tex clamp modes
This makes texwrap look better.
2009-07-28 18:09:38 -04:00
Alex Deucher
e629c50e2b r600: implement texture border color 2009-07-28 17:59:54 -04:00
Alex Deucher
719abd7fc0 r600: fix flat shading
Set the flat shading bit on the appropriate PS input
depending on the type of attribute it is.  The VS output
and PS input routing should probably be made more dynamic
at some point.  We may want to use semantic ids to make
it easier.
2009-07-28 16:58:41 -04:00
Alex Deucher
dbdb3952c1 r600: don't call r700UpdateShaders twice for each render 2009-07-28 15:58:01 -04:00
Alex Deucher
b1f7c844a3 r600: move r700TranslateFragmentShader into r700UpdateShaders 2009-07-28 15:53:45 -04:00
Alex Deucher
4d648523aa r600: disable flat shade fix in 506bacb8e4
This breaks textures.  We need to only set this bit for
attributes that that need flat shading.
2009-07-28 11:12:36 -04:00
Brian Paul
d2f6d6ce49 Merge branch 'mesa_7_5_branch'
Conflicts:

	Makefile
	configs/default
	docs/relnotes.html
	src/mesa/main/version.h
2009-07-28 08:58:25 -06:00
Brian Paul
94726bc69e gallium: minor code/comments clean-up 2009-07-28 08:55:43 -06:00
Chia-I Wu
a744a496d5 egl: Comment out unused tables in_eglFillInConfigs
This silences a compiler warning.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-07-28 08:55:43 -06:00
Cooper Yuan
506bacb8e4 R6xx/r7xx: enable flat shading, this can fix quadric/accanti/accpersp 2009-07-28 13:57:07 +08:00
Ian Romanick
aafd576259 ARB prog parser: Add support for GL_MESA_texture_array
This isn't really tested yet as no drivers actually support this extension.
2009-07-27 17:22:21 -07:00
Ian Romanick
41d5696628 ARB prog parser: More robust error message for bad OPTION string 2009-07-27 17:10:01 -07:00
Ian Romanick
1edd13bf23 ARB prog parser: Add support for GL_ARB_fragment_program_shadow
Passes the piglit asmparsertest shadow-0[123].txt tests and
progs/demos/shadowtex.
2009-07-27 16:24:49 -07:00
Ian Romanick
88018e2e07 ARB prog parser: Fix handling of RECT
Require that GL_{ARB,EXT,NV}_texture_rectangle be supported before
allowing use of RECT texture target.
2009-07-27 15:47:52 -07:00
Ian Romanick
4821099429 ARB prog: Fix parameters to _mesa_calloc
So totally awesome that _mesa_calloc has a different parameter
signature than calloc.  Why do these libc wrappers still exist?!?
2009-07-27 15:46:07 -07:00
Alex Deucher
fcf317ac16 r600: fix _REV texture format component swizzles 2009-07-27 18:14:45 -04:00
Brian Paul
6c03563af7 mesa: regenerated file 2009-07-27 15:42:29 -06:00
RALOVICH, Kristóf
8363dff251 glx: remove XTHREADS support 2009-07-27 15:38:04 -06:00
RALOVICH, Kristóf
27e55588e0 docs: do not mentions xthreads any more 2009-07-27 15:38:04 -06:00
RALOVICH, Kristóf
bdb8ee5186 glapi: regenerated GL API assembly files 2009-07-27 15:38:04 -06:00
RALOVICH, Kristóf
8f397bffa8 glapi: remove XTHREADS support 2009-07-27 15:38:04 -06:00
Ian Romanick
054ab5a50a ARB prog parser: Correct handling of some extensions that interact w/ARB_vp 2009-07-27 14:18:40 -07:00
Nicolai Hähnle
3ccf89d584 r300/compiler: Make calculate_inputs_outputs available to external users
In the long run, it's probably better to just get rid of InputsRead and
OutputsWritten.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 22:51:40 +02:00
Nicolai Hähnle
59fff53492 r300/compiler: Add vertex program code dumper from Gallium driver 2009-07-27 22:51:39 +02:00
Nicolai Hähnle
6bc0e1054a r300/compiler: Prepare for hookup to Gallium 2009-07-27 22:51:39 +02:00
Nicolai Hähnle
e82a50a6a1 r300/fragprog: Move wpos_attr and fog_attr where they belong
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 22:51:39 +02:00
Nicolai Hähnle
790334883a r300/fragprog: Remove hardcoded FRAG_ATTRIB_xxx constants
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 22:51:38 +02:00
Nicolai Hähnle
e034683eda r300/fragprog: No longer rely on hardcoded FRAG_RESULT_xxx constants
Also, this makes radeon_program_pair depend on the r300 fragment program
compiler. Since we now know that r600+ no longer use the same pairing
style in their ALU, we can stop pretending that program_pair is useful
for anything but r300-r500 fragment programs.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 22:51:38 +02:00
Nicolai Hähnle
836050ba5e r300/fragprog: Move some of the attribute handling out of the compiler
Attribute indices will probably be different in Gallium, so make the compiler
independent of magic values.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 22:51:38 +02:00
Nicolai Hähnle
1348a7ebc0 r300/fragprog: Finally get rid of the duplicate program copy
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 22:51:38 +02:00
Nicolai Hähnle
3f78381687 r300/vertprog: Move Mesa-dependent input/output handling out of compiler
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 22:51:37 +02:00
Nicolai Hähnle
d6a304800b r300: Remove ugly PSIZ hack
Instead of setting Sourced, we simply force writemasks to begin with.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 22:51:37 +02:00
Nicolai Hähnle
05a51f4b3d r300/vertprog: Refactor wpos rewrite using rc_program
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 22:51:37 +02:00
Nicolai Hähnle
ce0c32e3d2 r300/vertprog: Refactor fog_as_texcoord to use rc_program
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 22:51:36 +02:00
Nicolai Hähnle
a1e8992ffa r300/vertprog: Refactor addArtificialOutputs to use rc_program
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 22:51:36 +02:00
Nicolai Hähnle
273af68570 r300/fragprog: Refactor wpos rewrite to use rc_program
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 22:51:36 +02:00
Nicolai Hähnle
9dc1be4158 r300/compiler: Refactor fragment program fog rewrite to use rc_program
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 22:51:36 +02:00
Nicolai Hähnle
aab949cb9d r300/compiler: Refactor rewrite_depth_out to use rc_program
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 22:51:35 +02:00
Nicolai Hähnle
6f4608f53c r300/compiler: Refactor local transforms to use rc_program
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 22:51:14 +02:00
Ian Romanick
be32fb779b ARB prog: Update generated files missed on previous two commits
The changes are, as it turns out, purely cosmetic.
2009-07-27 12:48:44 -07:00
Ian Romanick
6d3ccaf366 ARB prog: Delete comment about possibly needing to free a buffer
Valgrind doesn't complain about a leak here, so delete the comment
about possibly needing to free the state returned by yy_scan_bytes.
2009-07-27 12:38:52 -07:00
Ian Romanick
94b4556704 ARB prog: Clean up several memory leaks
As far as I am able to determine via code inspection and using
Valgrind, that should be all of the leaks in the parser.
2009-07-27 12:21:26 -07:00
Ian Romanick
946ea82bff Add destructor for symbol_table 2009-07-27 12:19:14 -07:00
Ian Romanick
0044d3ba94 Add destructor for hash_table 2009-07-27 12:17:06 -07:00
Nicolai Hähnle
800f482586 r300: Allow compiler to add constants in a cleaner way
Adding constants is used in a number of non-native instruction
rewrites, and it required us to keep copies of modified gl_programs
around. This is a first step towards ending this.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:07 +02:00
Nicolai Hähnle
92f7a599c7 r300/compiler: Refactor nqssadce to use rc_program
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:07 +02:00
Nicolai Hähnle
a898e7d66c r300/compiler: Refactor for rc_program usage
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:07 +02:00
Nicolai Hähnle
2237d136cd r300/compiler: Add rc_print_program
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:07 +02:00
Nicolai Hähnle
8bcb6ef786 r300/compiler: Lay groundwork for better error handling
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:06 +02:00
Nicolai Hähnle
c5cb9a3378 r300: Remove dependency on GLcontext from compiler
Unfortunately, this does cause some code duplication (which we can hopefully
eliminate eventually).

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:06 +02:00
Nicolai Hähnle
d65404225d r300/vertprog: Cleanup source conflict handling
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:06 +02:00
Nicolai Hähnle
86e3334333 r300/vertprog: Massively reduce code duplication
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:06 +02:00
Nicolai Hähnle
127ca61fa3 r300/vertprog: Use generic transforms and throw away unneeded code
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:06 +02:00
Nicolai Hähnle
84445273ed r300: Move vertex program compilation to compiler
This is just the first step of refactoring. The separation is not yet
clean enough with this commit.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:05 +02:00
Nicolai Hähnle
11cd795940 r300: Cleanup vertex_program structure
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:05 +02:00
Nicolai Hähnle
927f5f1682 r300: Remove faux lazy translation of vertex programs
De facto, vertex programs were translated immediately in all situations,
so let's just stop pretending that we do lazy translation.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:05 +02:00
Nicolai Hähnle
a808b10ce8 r300: Reduce include dependencies
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:05 +02:00
Nicolai Hähnle
9198ab8bfc r300: Introduce rc_program and use it in radeon_pair
The goal is to convert both Mesa and TGSI programs into an intermediate format
that happens to be convenient for us.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:05 +02:00
Nicolai Hähnle
9cd5e3e13a r300: Add radeon_compiler as a base for compilation-related tasks
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:04 +02:00
Nicolai Hähnle
647766494f r300: Remove some unnecessary includes
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:04 +02:00
Nicolai Hähnle
77a6ae64b6 r300/compiler: Compile the compiler seperately into an archive
This is all part of untangling the compiler from the classic driver, so that
it may be used in Gallium without depending on Mesa stuff if possible

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:04 +02:00
Nicolai Hähnle
d6275ccf79 r300: Further reduce dependency between compiler and classic driver
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:04 +02:00
Nicolai Hähnle
f70d3ee371 r300: Remove some dependencies on additional fragment program copies
The copy is still needed because some program transforms add state variables
or constants.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:04 +02:00
Nicolai Hähnle
b54e083201 r300: Remove GLcontext from r300_fragment_program_compiler
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:03 +02:00
Nicolai Hähnle
e93d70e3e9 r300: Remove GLcontext requirement from radeonLocalTransform
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:03 +02:00
Nicolai Hähnle
9ceee4d3e4 r300: Remove unused enums
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:03 +02:00
Nicolai Hähnle
b4b286b980 r300: Remove GLcontext requirement from radeon_nqssadce
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:03 +02:00
Nicolai Hähnle
d29cdde569 r300: Remove GLcontext requirement from radeon_program_pair
Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:03 +02:00
Nicolai Hähnle
cb8c694adb r300/program_pair: Introduce driver-specific texture instruction structure
This is to prepare more experimentation and possible internal changes in the
compiler.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:02 +02:00
Nicolai Hähnle
78f88d8b87 r300/program_pair: Dynamically allocate instructions temporarily
In preparation of using TGSI, where we cannot easily predict the number
of instructions.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:02 +02:00
Nicolai Hähnle
e5bed439be r300: Detangle fragment program compiler from driver-specific structure
This is in preparation of sharing the fragment program compiler with Gallium:
Compiler code is moved into its own directory and modified so that it no
longer depends on driver structures.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-27 20:32:02 +02:00
Pauli Nieminen
6b142866ab radeon: Add r6xx/r7xx chip family to get_chip_family_name
This fixes problem that glxinfo was reporting r600+ cards as unknown.

Signed-off-by: Pauli Nieminen <suokkos@gmail.com>
2009-07-27 11:06:18 -04:00
Patrice Mandin
1ee3bcfff0 nouveau: swizzle a single row or column, doing it one pixel at a time 2009-07-27 10:58:11 +02:00
Alex Deucher
7d3190a85b r600: fix textures
We weren't allocating enough gprs for the fragment shader
in some cases.  There are likely other issues that still need
to be sorted out for textures, but at least they now work.
2009-07-27 03:52:37 -04:00
Alex Deucher
7e6819f843 r600: don't draw when num indices is 0
fixes engine demo
2009-07-27 02:26:41 -04:00
Alex Deucher
48b2fea142 r600: set VGT NUM_INSTANCES as part of the draw command
set VGT NUM_INSTANCES as part of the draw command rather
than as state as recommended by the pm4 guide.  Also,
use the NUM_INSTANCES packet.
2009-07-27 02:26:41 -04:00
Alex Deucher
600a53a32e r600: Use R600_SCRATCH_REG_OFFSET rather than RADEON_SCRATCH_REG_OFFSET
noticed by vehemens on IRC.
2009-07-27 02:26:41 -04:00
Alex Deucher
0b3d51ee31 r600: switch vtx resource setup to use SETfield macros
For consistency
2009-07-27 02:26:41 -04:00
Alex Deucher
2c5e55d919 r600: switch tex code to use SETfield macros
for consistency with the rest of the code.
2009-07-27 02:26:41 -04:00
Corbin Simpson
7a10472f09 r300g: Fix two trivial texture size issues.
Next thing to fix: progs/tests/mipgen.
2009-07-26 22:48:20 -07:00
Corbin Simpson
725c1f004c radeon-gallium: If BO allocation fails, return NULL. 2009-07-26 22:35:26 -07:00
Corbin Simpson
2cbd5ecfb6 r300g: Add some debugging, correct little bits of math in texture setup.
Simple stuff still works, but not sure about some of the more complex things.
2009-07-26 21:38:24 -07:00
Julien Cristau
a151efc6cc Use dh_lintian. 2009-07-27 00:29:45 +02:00
Julien Cristau
05c0e10a9e Override 'package-name-doesnt-match-sonames' lintian warnings 2009-07-27 00:29:44 +02:00
Patrice Mandin
8df35b7b57 nouveau: only swizzle square textures for copy 2009-07-26 22:30:35 +02:00
Patrice Mandin
2b8a8f75f3 nouveau: Take into account destination position for copy_swizzle, need to split copy a bit more 2009-07-26 16:18:06 +02:00
Patrice Mandin
77a8a650e6 nouveau: Recursively swizzle an NPOT sized copy 2009-07-26 12:30:12 +02:00
Ian Romanick
258f640eda ARB prog: Layout parameters from parameter type, not src type
Use the type stored in the Parameters array to determine the layout
instead of the type in the instruction register field.  Also, update
the instruction register field based on the parameter type.

This makes Google Earth work exactly like with Mesa master.
2009-07-24 18:14:47 -07:00
Ian Romanick
a7400e7364 ARB prog: _mesa_print_program output should go to same place as _mesa_printf 2009-07-24 18:03:02 -07:00
Ian Romanick
f3cba9d66a ARB prog parse: Fix cut-and-paste error for constant vectors 2009-07-24 18:01:59 -07:00
Ian Romanick
6f8214cae6 ARB prog: get frag prog texture info from the right place
This gets basic texturing working.  w00t!
2009-07-24 17:33:30 -07:00
Patrice Mandin
8c30292a6e nouveau: use nv04_surface_copy_swizzle only for POT sizes 2009-07-24 23:37:46 +02:00
Joakim Sindholt
12b183d250 radeon-gallium: remove old getparam ioctl 2009-07-24 14:54:00 +02:00
Brice Goglin
3c4727a4e9 Prepare changelog for upload 2009-07-24 00:29:35 +02:00
Brice Goglin
40f217aea7 Enable i686 optimized libraries on hurd-i386 2009-07-24 00:29:25 +02:00
Alex Deucher
3b4235d4eb r600: fix segfault in morph3d
These attributes still need work, but it shouldn't hurt to
enable them.
2009-07-23 18:26:02 -04:00
Brice Goglin
d3403389cd Only install the huge upstream changelog in mesa-common-dev 2009-07-23 23:41:19 +02:00
Brice Goglin
a70d1eb1ee Pull from upstream mesa_7_5_branch 2009-07-23 21:11:22 +02:00
Brice Goglin
d7aa5d5ca0 Merge branch 'mesa_7_5_branch' of git://anongit.freedesktop.org/mesa/mesa into debian-unstable 2009-07-23 21:09:47 +02:00
Keith Whitwell
aa99a765c1 draw: correct address for machine struct in llvm path
This changed after a recent commit.
2009-07-23 18:48:04 +01:00
Keith Whitwell
adc6f8cdfc gallivm: updates for TGSI changes
make linux-llvm succeeds, but doesn't seem to be working, at least with
llvm 2.5
2009-07-23 17:59:08 +01:00
Corbin Simpson
ca83d5a8db r300g, radeon-gallium: Fix API, cleanup.
Something called "validate" should return FALSE on failure, not TRUE.
2009-07-23 07:18:29 -07:00
Nicolai Hähnle
27b3c435ba radeon-gallium: Build fixes wrt changed libdrm_radeon space check API
Had to be hacked up a bit to apply to master. Sorry 'bout that. :3
2009-07-23 07:18:29 -07:00
Corbin Simpson
256eacbde4 r300g: PIPE_CAP_BLEND_EQUATION_SEPARATE. 2009-07-23 07:18:29 -07:00
Keith Whitwell
d0d98f3ecf gallium: clean up opcode definitions
Remove commented-out opcodes.  Remove information about API mappings
to opcodes, but add a reference to tgsi-instruction-set.txt where
that information is better presented.
2009-07-23 14:39:07 +01:00
Keith Whitwell
78379abcbf gallium: remove deprecated TGSI opcodes
Various opcodes which can be implemented trivially with other TGSI opcodes,
such as matrix multiplication and negation.  These were not used by any
state tracker or implemented by any of the drivers.
2009-07-23 14:38:26 +01:00
José Fonseca
8b78294d21 r600: Remove CRLF line endings. 2009-07-23 14:11:10 +01:00
Vinson Lee
af1163cc41 util: Add support for Mac OS. 2009-07-23 14:08:07 +01:00
Corbin Simpson
07961bb05e r300g: Actually mark shaders as translated/untranslated.
Also trust that Gallium will not give us TGSI that miscounts shader consts.

This creates a 20x speedup on glxgears, from 8 FPS to 160 FPS.
2009-07-23 00:00:28 -07:00
Brian Paul
895c435def cell: update TGSI_OPCODE_ cases 2009-07-22 21:04:07 -06:00
Ian Romanick
ef80c2012d parser: Clean up a bunch of silly compiler warnings 2009-07-22 17:13:08 -07:00
Ian Romanick
0db5ef0741 parser: Track a few more frag prog related values 2009-07-22 16:21:54 -07:00
Ian Romanick
28b13038d8 parser: Ensure that param_binding_type is set correctly 2009-07-22 16:03:32 -07:00
Michel Dänzer
d602966f89 gallium: Fix PPC build. 2009-07-23 00:47:32 +02:00
Ian Romanick
5f090bb074 GIT ignore program_parse.output 2009-07-22 15:28:31 -07:00
Ian Romanick
c2ee82d693 parser: Set NumParameters 2009-07-22 15:27:31 -07:00
Ian Romanick
44843c7533 parser: Clean up generation of error strings during assembly 2009-07-22 15:06:49 -07:00
Patrice Mandin
b7042399fd nouveau: nv30: wrong variable for format 2009-07-22 22:26:08 +02:00
Maciej Cencora
b129c55f42 r300: fix address register handling in NQSSADCE
For address register we always use X component
2009-07-22 22:10:22 +02:00
Ian Romanick
aec4291706 parser: Initialize unused instruction source registers
The 965 driver expects unused source registers (e.g., SrcReg[2] of a
DP3 instruction) to have a register file of PROGRAM_UNDEFINED.
Initializing these source registers ensures that this happens.
2009-07-22 12:29:48 -07:00
Patrice Mandin
db40bb0287 nouveau: Take into account sx,sy parameters to read from source surface 2009-07-22 21:10:20 +02:00
Ian Romanick
69d3d19b54 parser: Anonymous constants come from the PROGRAM_CONSTANT file 2009-07-22 10:51:18 -07:00
Keith Whitwell
ede9f3b52e gallium: remove multiple aliases for TGSI opcodes
This is a source of ongoing confusion.  TGSI has multiple names for
opcodes where the same semantics originate in multiple shader APIs.

For instance, TGSI includes both Mesa/GLSL and DX/SM30 names for
opcodes with the same semantics, but aliases those names to the same
underlying opcode number.

This makes it very difficult to visually inspect two sets of opcodes
(eg in state tracker & driver) and check if they implement the same
functionality.

This patch arbitarily rips out the versions of the opcodes not currently
favoured by the mesa state tracker and leaves us with a single name
for each distinct operation.
2009-07-22 12:42:09 +01:00
Keith Whitwell
fd31f92cea gallium: simplify tgsi_full_immediate struct
Remove the need to have a pointer in this struct by just including
the immediate data inline.  Having a pointer in the struct introduces
complications like needing to alloc/free the data pointed to, uncertainty
about who owns the data, etc.  There doesn't seem to be a need for it,
and it is unlikely to make much difference plus or minus to performance.

Added some asserts as we now will trip up on immediates with more
than four elements.  There were actually already quite a few such asserts,
but the >4 case could be used in the future to specify indexable immediate
ranges, such as lookup tables.
2009-07-22 12:42:09 +01:00
Richard Li
5e3c62b550 r600: fix dst reg indexing for real
This fixes segfaults in apps like teapot and tunnel
2009-07-21 17:56:06 -04:00
Alex Deucher
7edb2a9eef Revert "r600: fix dst reg indexing"
This reverts commit cc893d9a98.

Richard has the proper fix.
2009-07-21 17:44:36 -04:00
Alex Deucher
72a3d8845f r600: add stencil support 2009-07-21 17:10:54 -04:00
Alex Deucher
db0160bb9d r600: use state functions to set default state 2009-07-21 17:10:54 -04:00
Alex Deucher
bd62cd735f r600: fill in point functions 2009-07-21 17:10:54 -04:00
Alex Deucher
5a615e7e65 r600: set provoking vertex to last vertex for OGL 2009-07-21 17:10:54 -04:00
Alex Deucher
60787df1e5 r600: fill in r700UpdateViewportOffset 2009-07-21 17:10:53 -04:00
Alex Deucher
549b8e6f1a r600: first pass at polyoffset support
not working yet
2009-07-21 17:10:53 -04:00
Brice Goglin
04493de67b Prepare changelog for upload 2009-07-21 22:22:07 +02:00
Brice Goglin
e06e2b001f Install the upstream ChangeLog 2009-07-21 22:21:47 +02:00
Jerome Glisse
7247446ba8 radeon: fix colorbuffer pitch emission regarding tiling in KMS/CS case
We need to emit a relocation for pitch register so that kernel can
check and properly setup tiling on the color buffer.
2009-07-21 21:14:19 +02:00
Brice Goglin
d740456ee5 Install the upstream ChangeLog 2009-07-21 20:42:50 +02:00
Brice Goglin
45c5ed4bb8 Pull from upstream mesa_7_5_branch 2009-07-21 20:38:30 +02:00
Brice Goglin
19a8ce6f70 Merge branch 'mesa_7_5_branch' of git://anongit.freedesktop.org/mesa/mesa into debian-unstable 2009-07-21 20:05:24 +02:00
Alex Deucher
ecead30111 R600: fix up some build problems 2009-07-21 11:09:05 -04:00
Alex Deucher
9e6d38f8a2 r600: add alpha test support 2009-07-21 10:53:20 -04:00
Michel Dänzer
cf24119d38 Track Radeon driver symlinks in Git. 2009-07-21 10:47:42 +02:00
Peter Hutterer
5358e54d1a Add missing X11_INCLUDES to egl/drivers/demo and egl/main.
Compiling mesa on a system with no X headers installed in the default
include paths fails due to missing X11 includes. The header includes are
picked up by configure but not applied.

Signed-off-by: Peter Hutterer <peter.hutterer@who-t.net>
Signed-off-by: Dave Airlie <airlied@redhat.com>
2009-07-21 11:45:49 +10:00
Eric Anholt
81d5550684 i965: Don't clip everything if FRONT_AND_BACK culling while culling disabled.
Fixes everything-black with meta_clear_tris on quake4-mpdemo and doom3-demo.

Bug #18844, 22077.
2009-07-20 18:31:13 -07:00
Ian Romanick
770cebbc29 ARB_fp/vp: Initial import of new ARB vp/fp assembler
This still needs quite a bit of work, but a bunch of the programs in progs/vp
produce correct results.
2009-07-20 17:44:36 -07:00
Alex Deucher
6617fa6fab r600: fix typo in blend code 2009-07-20 19:33:05 -04:00
Kevin DeKorte
cc893d9a98 r600: fix dst reg indexing
This fixes segfaults in apps like teapot and tunnel
2009-07-20 19:00:57 -04:00
Alex Deucher
265d5eba65 r600: add blending support 2009-07-20 19:00:57 -04:00
Alex Deucher
a369963b18 r600: add user clip plane support 2009-07-20 19:00:57 -04:00
Alex Deucher
ce9c5a1a27 r600: add logicop support 2009-07-20 19:00:57 -04:00
Ian Romanick
480567d5c4 Add new _mesa_new_parameter_list_sized to pre-allocate a parameter list 2009-07-20 15:37:24 -07:00
Keith Whitwell
cad82cd063 tgsi: get texturing working in vertex shader sse2 path
Missing file from previous commit.
2009-07-20 19:47:38 +01:00
Michel Dänzer
cd63e35603 Merge branch 'mesa_7_5_branch' 2009-07-20 20:41:11 +02:00
Keith Whitwell
442101dad7 tgsi: get texturing working in vertex shader sse2 path 2009-07-20 19:32:28 +01:00
Keith Whitwell
27a19be8d1 tgsi: fix regression in indexed const lookups
This function was calling get_input_base() and get_output_base() to
get the names of a couple of register to use as temps.  Those
functions no longer return registers, so adjust it to get the
registers elsewhere.

This change doesn't address the issue that it's a fairly poor way to
grab a register name by calling a function with an apparently
unrelated meaning.
2009-07-20 19:32:28 +01:00
Kevin DeKorte
91512fa019 r600: Fix compilation 2009-07-20 09:27:17 -04:00
Cooper Yuan
19249a1ae7 R6xx/r7xx: Fix line stipple and width issue 2009-07-20 17:42:47 +08:00
Michel Dänzer
cf721c8137 Add common_ppc.c to MESA_GALLIUM_SOURCES. 2009-07-20 02:11:17 +02:00
Michel Dänzer
3d0009ce45 r300g: Fix SCons build. 2009-07-20 02:06:37 +02:00
Michel Dänzer
0b7a907f39 gallium/trace: Fix SCons build. 2009-07-20 02:05:38 +02:00
Michel Dänzer
3326be6c0a r300g: Guard R500 register writes by is_r500 check.
Flagged by the DRM command stream checker. This allows the driver to work on
non-R500 cards.
2009-07-20 01:53:15 +02:00
Brice Goglin
767c0b16f3 Prepare changelog for upload 2009-07-19 12:54:22 +02:00
Brice Goglin
3041819a4e New upstream release 2009-07-19 12:51:08 +02:00
Brice Goglin
4a9beaf2e9 Merge tag 'mesa_7_5' into debian-experimental
Conflicts:
	progs/tests/.gitignore
	progs/tests/Makefile
	progs/tests/SConscript
	progs/trivial/Makefile
	scons/dxsdk.py
	scons/gallium.py
2009-07-19 12:50:28 +02:00
Dave Airlie
a8921d0b52 gallium: make g3dvl build again 2009-07-18 17:44:44 +10:00
Brian Paul
b96ae1b2c4 Merge branch 'mesa_7_5_branch'
Conflicts:

	Makefile
	progs/glsl/multitex.c
	src/mesa/main/enums.c
	src/mesa/main/state.c
	src/mesa/main/texenvprogram.c
	src/mesa/main/version.h
2009-07-17 22:00:47 -06:00
Alex Deucher
f81f57e25d R6xx/R7xx: add fine grained syncing support 2009-07-17 19:05:30 -04:00
Alex Deucher
b192b9dac6 R6xx/r7xx: send depth state in it's own function 2009-07-17 19:05:29 -04:00
Andrew Randrianasulu
2a6f58460a st/egl: Fix broken build after EGL thread changes 2009-07-18 00:55:12 +02:00
Alex Deucher
5008269cfe R200: fix build when RADEON_DEBUG_BO is set 2009-07-17 18:19:01 -04:00
Dave Airlie
a046beaffe radeon: disable BO debug 2009-07-18 08:00:23 +10:00
Brian Paul
40fd101919 egl: commit missing eglcurrent.[ch] files
Not sure how these got left out from earlier commit.
2009-07-17 13:36:58 -06:00
Alex Deucher
e910f6831b Merge branch 'master' of git+ssh://agd5f@git.freedesktop.org/git/mesa/mesa into r6xx-rewrite 2009-07-17 14:46:40 -04:00
Kevin DeKorte
79a170108f R6xx/r7xx: warning fixes
patch from Kevin DeKorte with some minor fixes from me.
2009-07-17 14:43:42 -04:00
Chia-I Wu
30bccf8ea9 xeglthreads: Check current context for EGL per-thread support.
Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-07-17 11:56:32 -06:00
Chia-I Wu
15fdbc8361 egl: Remove redundant DeletePending flag.
A context or surface that is neither linked to a display nor current to
a thread should be destroyed.  Therefore, an unlinked context or surface
implies a pending delete automatically.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-07-17 11:56:00 -06:00
Chia-I Wu
3f7e0d5302 egl: Destroy display's resources upon termination.
eglTerminate should destroy the contexts and surfaces of the display.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-07-17 11:54:06 -06:00
Chia-I Wu
be9d1ab171 egl: Return the same EGL Display for the same native display.
The latest revision of the spec explicitly requires the same handle to
be returned for the same native display.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-07-17 11:53:39 -06:00
Chia-I Wu
cca31340b5 egl: Use the link functions to manage resources.
This commit uses the newly introduced link functions to manage EGL
contexts and surfaces.  As a result of this, the API for drivers are
changed.  All drivers are updated for the change.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-07-17 11:53:03 -06:00
Chia-I Wu
18457cb263 egl: Add funtions to link contexts and surfaces to displays.
EGL contexts and surfaces are resources of displays.  They should be
managed by displays.  This commit adds a bunch of functions to
egldisplay.c to help establish the links between contexts/surfaces and
displays.  How links are established is considered opaque outside
display.  Functions like _eglGetSurfaceHandle or _eglLookupSurface are
therefore moved to egldisplay.c, with some small modifications.

The idea is also extended to display.  That is, displays need to link to
themselves to be looked up.

This commit only adds the functions.  A commit to use them should
follow.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-07-17 11:48:27 -06:00
Chia-I Wu
21b635ffa8 egl: Extend per-thread info for multiple current contexts.
EGL allows multiple current contexts, as long as they are bound to
different client APIs.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-07-17 11:42:04 -06:00
Chia-I Wu
75da80b295 egl: Support per-thread info.
This commit introduces a "current" system to manage per-thread info.  It
uses TLS, if GLX_USE_TLS is defined, or pthread, if PTHREADS is defined.
If none of them are defined, it uses a dummy implementation that is just
like before.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-07-17 11:41:02 -06:00
Chia-I Wu
8e92ec9fdd egl: Add eglcompiler.h for compiler features.
Only INLINE (from mesa/main/compiler.h) is defined now.  It may be used
to deal with symbol visibility and int/pointer conversion in the future.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
Signed-off-by: Brian Paul <brianp@vmware.com>
2009-07-17 11:36:45 -06:00
Alex Deucher
c4ab08a0cd R6xx/r7xx: disable depth/stencil compression for now 2009-07-17 12:21:33 -04:00
Brice Goglin
fe9b9fec39 Enable i686 optimized libraries on kfreebsd-i386 2009-07-17 18:21:27 +02:00
Alex Deucher
60d681f367 R6xx/r7xx: add some missing state regs 2009-07-17 12:07:15 -04:00
Eric Anholt
9cea84b6b5 texenv: Calculate whether we need to do secondary color on our own.
The _TriangleCaps bit is deprecated, not updated when we require, and
is set based on state that hasn't been updated at that point in
_mesa_update_state_locked().

Fixes incorrect clear color in glsl/twoside.c with meta_clear_tris.
2009-07-16 19:02:04 -07:00
Eric Anholt
99174e7630 i965: Add missing state dependency of sf_unit on _NEW_BUFFERS. 2009-07-16 19:00:34 -07:00
Alex Deucher
6f63698d26 R6xx: fix rendering on r6xx/rs780 chips
You always need to emit a fetch shader (fs) even if you
aren't using it.  For now, just emit the fs with the
vs address to make the kernel happy.
2009-07-16 17:35:44 -04:00
Keith Whitwell
04dd8b71b4 draw: fix ppc build regression
Found by x.org tinderbox, reported by Chris Ball.
2009-07-16 19:01:29 +01:00
Kevin DeKorte
c42a616314 Warning fixes 2009-07-16 11:57:14 -04:00
Alex Deucher
0850776f1a R6xx/r7xx: remove unused function
Spotted by kdekorte on IRC
2009-07-16 11:53:58 -04:00
Brian Paul
3e8832d24b st/mesa: add some array index bounds assertions 2009-07-16 08:44:51 -06:00
Chia-I Wu
721f80b82a egl: Add xeglthreads
Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
2009-07-16 08:29:57 -06:00
Richard Li
00a216fd1e Restore vp input mapping, fix vtx stream missing problem. 2009-07-16 10:28:58 -04:00
Keith Whitwell
caf5d52d48 tgsi: simplify and fix sse KIL implementation
Use sse_movmskps to extract the correct bits of the comparison result
for use in updating the killmask.  Simplify some logic around
identifying the set of necessary comparisons to make.
2009-07-16 12:49:27 +01:00
Keith Whitwell
e1ad38ad8e rtasm: export sse_movmskps 2009-07-16 12:47:11 +01:00
Keith Whitwell
3858f47994 tgsi: initial texturing support on sse path
Most obvious problem is drawpixels comes out blocky, but this may be
an existing issue of KIL on the sse path.
2009-07-16 11:37:52 +01:00
Keith Whitwell
a01383ff6a tgsi: make sse function callout mechanism more generic
Take a list of arguments rather than hardcoding TEMP_R0.
2009-07-16 10:11:46 +01:00
Keith Whitwell
ebc4a9bf2e tgsi: reduce x86 reg usage in tgsi_sse generated programs
Pass the tgsi_exec_machine struct in directly and just hold a single
pointer to this struct, rather than keeping one for each of its
internal members.
2009-07-16 09:53:08 +01:00
Keith Whitwell
4e3002b50f tgsi: no need to separately malloc input and output arrays
Can now guarantee alignment in the initial allocation of the tgsi exec machine.
2009-07-16 09:53:08 +01:00
Keith Whitwell
c202fe187c gallium: reduce recursive include of tgsi_exec.h
A lot of draw code no longer needs to see this header.
2009-07-16 09:53:07 +01:00
Keith Whitwell
7fb702705a tgsi: make function call code in tgsi_sse.c less opaque
Explictly pass src and dst arguments (previously dst argument was also
being used as a src).  Separate argument handling from the rest of
the function call emit.
2009-07-16 09:53:07 +01:00
Keith Whitwell
6175653d0b gallium: proper constructor and destructor for tgsi_exec_machine
Centralize the creation, initialization and destruction of this struct.
Use align_malloc instead of home-brew alternatives.
2009-07-16 09:53:07 +01:00
Alex Deucher
11606e873d Fix more merge fallout 2009-07-16 02:59:36 -04:00
Kevin DeKorte
92a2f0164a R6xx/r7xx: warning fixes 2009-07-15 17:13:09 -04:00
Richard Li
01b793ec7d R6xx/r7xx: fix missing vertex stream
Somehow context->radeon.tcl.aos[j].bo is not null sometimes,
but it is safe for now because it is only a pointer to
dma.current so overwriting it would not hurt anything.
2009-07-15 17:00:42 -04:00
Alex Deucher
1e8a6068ee radeon bo: Fix merge fall out 2009-07-15 15:59:04 -04:00
Alex Deucher
582838a666 R6xx/r7xx: more Makefile fixes 2009-07-15 15:40:35 -04:00
Alex Deucher
2ab328e5e4 Fix r600 makefile for lastest CS changes 2009-07-15 15:23:11 -04:00
Alex Deucher
c5c19919ce Merge branch 'master' of git+ssh://agd5f@git.freedesktop.org/git/mesa/mesa into r6xx-rewrite
This builds, but I get an assertion in radeonGetLock() due to
the drawable being null.
2009-07-15 14:17:07 -04:00
Alex Deucher
a0d4a12614 make sure ctx->Driver.Flush is valid before calling it 2009-07-15 11:31:24 -04:00
Alex Deucher
efe7ad233c Use memcpy directly in the common code
This alleviates the need for an additional symbol.
2009-07-15 11:16:41 -04:00
Dave Airlie
3a3b83e511 radeon: update span reading micro tile code
tested on r500 with zreaddraw with Z buffer in all 3 modes
2009-07-15 14:23:14 +10:00
Dave Airlie
bd4ed25222 r300: emit z depth pitch reloc in preparation for tiling 2009-07-15 14:23:14 +10:00
Dave Airlie
94d2a809f9 radeon: r300 fix span reading for macro tiled buffers.
this uses the correct formula for macro tiled buffers for readback
2009-07-15 14:23:13 +10:00
Dave Airlie
9b17f041d1 radeon: for tiling you really need to use GET/PUT VALUE not PTR.
since the surfaces aren't linear you can't just use GET_PTR
2009-07-15 14:23:13 +10:00
Xiang, Haihao
868aa16074 i965: the offset of any branch/jump instruction is in unit of 64bits on IGDNG 2009-07-15 10:48:13 +08:00
Alex Deucher
10b3e64bca R6xx/r7xx: implement memcpy buffer swaps
This allows double buffered apps to run, but perfomance
will be awful until we implement something faster.

You must update to the latest kernel modules.
2009-07-14 21:19:32 -04:00
Dave Airlie
f6f0e117a4 intel/radeon: add common metaops code.
Move all the metaops to a dri_metaops file and port radeon/intel
to use the new common meta ops code.
2009-07-15 10:30:23 +10:00
Alex Deucher
9385e4e1ff r6xx/r7xx: fix buffer aging bug
We were using sparse indexing for aos, while the common
code expected packed indexing.
2009-07-14 20:08:27 -04:00
Alex Deucher
9ae78dc0bc R6xx/R7xx: no irqs yet. 2009-07-14 20:06:29 -04:00
Dave Airlie
681ede8836 radeon: fix unsigned vs signed comparison in stencil code.
This function takes a GLint not a GLuint, passing in -1
breaks internally.
2009-07-15 08:19:34 +10:00
Eric Anholt
99d07d0f91 intel: Fix ClearDepth to not be affected by DepthRange.
Fixes new piglit depthrange-clear.c test.
2009-07-14 15:14:52 -07:00
Eric Anholt
b677c40abb intel: Set DepthRange in the metaops using RasterPos[2].
RasterPos[2] is already sent through the window transform, which includes
DepthRange handling.  So make DepthRange for the metaops a noop.

Fixes a failure in oglconform depthrange.c
2009-07-14 15:14:52 -07:00
Eric Anholt
e5f63c403b Fix state flag dependencies for fixed function fragment program updates.
I started looking into why _NEW_ARRAY punishes us, and while annotating
dependencies noticed that a bunch of dependencies were missing.
2009-07-14 15:14:52 -07:00
Eric Anholt
374110bc98 intel: Flag _NEW_ARRAY state when doing array object binding in clears.
This is just following bind_vertex_array()'s behavior.
2009-07-14 15:14:51 -07:00
Alex Deucher
a1ecbb2356 Disable shader dumps 2009-07-14 18:01:29 -04:00
Brian Paul
e786ecbfb5 mesa: regenerated enums.c file 2009-07-14 07:47:19 -06:00
Corbin Simpson
b727150b14 dri-st: Unbreak GL_EXT_blend_equation_separate.
Since it has a dispatch table entry (for BlendEquationSeparateEXT,)
can't omit it from this list. It'll still get disabled if the cap
(PIPE_CAP_BLEND_EQUATION_SEPARATE) isn't set.

Somebody that doesn't suck at GL (read: not me) should probably add
this into progs/samples/blendeq or similar so we can test it.
2009-07-14 01:16:25 -07:00
Patrice Mandin
54cf63278f gallium: Define PIPE_CAP_BLEND_EQUATION_SEPARATE, remove extension from default extension list 2009-07-14 09:44:49 +02:00
Michel Dänzer
33f56b4612 radeon: Differentiate 16 bpp destination formats.
Fixes those formats in fbo_firecube.

Only tested with r300, radeon and r200 compile tested only.
2009-07-14 08:25:27 +02:00
Michel Dänzer
60e60bb302 radeon: Invert front face winding when rendering to FBO.
Fixes fgl_glxgears and progs/demos/fbotexture after pressing 'c'.

Tested with r300, radeon and r200 compile tested only.
2009-07-14 08:00:49 +02:00
Cooper Yuan
f4646f3247 R6xx/r7xx: Fix specular lighting issue 2009-07-14 10:39:07 +08:00
Nicolai Hähnle
59155f70e7 r300g: Small compile warning fixes.
Signed-off-by: Corbin Simpson <MostAwesomeDude@gmail.com>
2009-07-13 16:26:29 -07:00
Nicolai Hähnle
b3f1d370a2 r300g, radeon: Whitespace fixes.
Signed-off-by: Corbin Simpson <MostAwesomeDude@gmail.com>
2009-07-13 16:26:29 -07:00
Corbin Simpson
ca28e591f2 r300g: Use align() instead of inline maths. 2009-07-13 16:26:29 -07:00
Maciej Cencora
9226e3d6a6 Merge branch 'shaders_cleanup' 2009-07-13 20:29:11 +02:00
Eric Anholt
0dc700850a intel: Partially fix fallback detection for glCopyTexSubImage.
Really, we should be checking that the MesaTexFormat for the read buffer
and the texture match, but the previous code wasn't even doing that, so
matching the cpp should be an improvement (and potentially fix some hangs!).
The previous code also rejected GL_RGB even though blitting the alpha
channel to the ignored channel of an x8r8g8b8 texture should be fine, which
tripped up compiz's blur plugin.
2009-07-13 10:57:12 -07:00
Maciej Cencora
582bd34665 r300: always assume all components are read by fragment program
Components of input attributes that are used by fragment program aren't part of vertex program key, and that may lead to situations when vertex program writes only TEX1.xy and fragment program reads TEX1.xyz, resulting in rendering errors.

Reported-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-13 19:28:15 +02:00
Nicolai Hähnle
f06910f6c3 r300: Fix fogcoord rewriting
We only care about the actual fogcoord itself now, reducing the rewriting
done for the vertex program.

The rewriting of source operand swizzles in the fragment program takes
care that fogcoord.yzw = 001.

This should fix fogcoord rewriting entirely, which had been horribly
broken in the face of dot-product instructions, and just broken (though
not horribly so) in the face of almost every other instruction (the W
component would be incorrect for most arithmetic instructions).

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-13 19:28:15 +02:00
Maciej Cencora
3f5382819e r300: fix swizzle masking in getUsedComponents 2009-07-13 19:28:15 +02:00
Maciej Cencora
acd3360041 r300: minor fix
Split initializations becase the vars are of different type.

Reported-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-13 19:28:15 +02:00
Maciej Cencora
1a5520fcd3 r300: move variables declarations 2009-07-13 19:28:14 +02:00
Maciej Cencora
b3716eeb61 r300: document r300_vertex_program_cont structure
Reported-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-13 19:28:14 +02:00
Maciej Cencora
a0204ce456 r300: document r300_fragment_program_cont struct 2009-07-13 19:28:14 +02:00
Maciej Cencora
ec854729d1 r300: fix indentation
Reported-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-13 19:28:13 +02:00
Maciej Cencora
48cc352a71 r300: fix StrideB == 0 case when converting data format
Reported-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-13 19:28:13 +02:00
Maciej Cencora
4eff323731 r300: hw can handle per component negations in vertex shaders
Reported-by: Nicolai Haehnle <nhaehnle@gmail.com>
2009-07-13 19:28:13 +02:00
Maciej Cencora
4efb9f053c r300: fix WPOS for SWTCL 2009-07-13 19:28:13 +02:00
Maciej Cencora
bdc8a95fc9 r300: removed unnecessary params
We don't have check which attributes are used by fragment program - it's already done by NQSSADCE.
2009-07-13 19:28:12 +02:00
Maciej Cencora
65d9f23c7c r300: use NQSSADCE for vertex programs 2009-07-13 19:28:12 +02:00
Maciej Cencora
70448b9f95 r300: operate on copy of a program when pairing instructions
We need to keep unpaired program for vertex program NQSSADCE.
2009-07-13 19:28:12 +02:00
Maciej Cencora
12a6d73c75 r300: handle relative addressing in NQSSADCE 2009-07-13 19:28:11 +02:00
Maciej Cencora
96b2eb18c5 r300: handle ARB_vertex_program specific instructions in NQSSADCE 2009-07-13 19:28:07 +02:00
Maciej Cencora
e43cc28c1b r300: move depth output rewrite out of NQSSADCE 2009-07-13 19:25:59 +02:00
Maciej Cencora
f79ef95df4 r300: rewrite FOGC and HPOS attribs handling
Rewrite vertex and fragment programs so that we don't have to do any hacks on lower level.
2009-07-13 19:25:59 +02:00
Maciej Cencora
df5fe747fa r300: bind vertex program to fragment program 2009-07-13 19:25:58 +02:00
Maciej Cencora
d1e4caa6e2 r300: recalculate used inputs and outputs after dead code removal 2009-07-13 19:25:58 +02:00
Maciej Cencora
7360f83364 r300: move fragment program selection before vertex program selection
Prepare for wpos and fogc handling rewrite.
2009-07-13 19:25:58 +02:00
Maciej Cencora
37c319f62f r300: implement proper IsProgramNative check for vertex programs 2009-07-13 19:25:57 +02:00
Maciej Cencora
bce224c1f1 r300: don't modify original vertex program
Keep the original vertex program untouched because it may be needed after some state change for generating new r300 specific vertex program.
2009-07-13 19:25:57 +02:00
Maciej Cencora
7829b7a1b8 r300: cache translated fragment programs 2009-07-13 19:25:56 +02:00
Maciej Cencora
28066ed012 r300: update state parameters only once per rendering operation 2009-07-13 19:25:56 +02:00
Maciej Cencora
21db37d432 r300: translate non native insts earlier for easier debugging 2009-07-13 19:25:55 +02:00
Maciej Cencora
0b411a72f3 r300: print vertex program after adding artificial output insts 2009-07-13 19:25:55 +02:00
Maciej Cencora
4a6899e080 r300: use mesa provided function for adding MVP code 2009-07-13 19:25:54 +02:00
Maciej Cencora
9b781ca2ce r300: simplify insert_wpos a little 2009-07-13 19:25:54 +02:00
Brian Paul
9615daa932 Merge branch 'mesa_7_5_branch' 2009-07-13 08:47:37 -06:00
Dave Airlie
bb4c703587 radeon: port more front fixes from intel.
Port fixes to read buffer from front.
2009-07-14 01:23:24 +10:00
Dave Airlie
504d01b275 radeon/r200: fix color masking under dri2
Need to retrieve the bits from the rrb not from screen struct
2009-07-14 01:23:24 +10:00
Dave Airlie
a79aefb177 radeon: Use Stencil.Enabled instead of Stencil._Enabled in DrawBuffers.
The _Enabled field isn't updated at the point that DrawBuffers is called,
and the Driver.Enable() function does the testing for stencil buffer
presence anyway.
2009-07-14 01:23:23 +10:00
Dave Airlie
d9913d7c09 radeon/fbo: stencil bits fix from Michel in intel fbo code 2009-07-14 01:23:23 +10:00
Xiang, Haihao
2995bf0d68 i965: add support for new chipsets
1. new PCI ids
2. fix some 3D commands on new chipset
3. fix send instruction on new chipset
4. new VUE vertex header
5. ff_sync message (added by Zou Nan Hai <nanhai.zou@intel.com>)
6. the offset in JMPI is in unit of 64bits on new chipset
7. new cube map layout
2009-07-13 11:01:13 +08:00
Dave Airlie
f030e2ba17 r300: move fallback warnings inside fallback debugging
random output is bad
2009-07-12 21:37:47 +10:00
Dave Airlie
dfecf217fa r300: fix clear mask to not use sw if not necessary 2009-07-12 21:37:46 +10:00
Nicolai Hähnle
b484c71036 radeon: Fix crash when rendering to incomplete texture and other formats
It is possible to bind texture images of an incomplete mipmapped texture.
Software fallbacks in this case incorrectly tried to mmap the entire texture.

Additionally, add span functions for 1555 and 4444 formats.

This fixes crashes in piglit's fbo-readpixels test; unfortunately, the test
itself still fails - this needs to be investigated.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-07-12 12:50:36 +02:00
Dave Airlie
a10244453c radeon: update clear code from Intel codebase.
This updates some of the clear code from Intel gives a 5x clearspd perf
for me here. played openarena also, not sure if the viewport changes
broke anything,
2009-07-12 17:28:14 +10:00
Dave Airlie
b06cb372bf radeon: fbo fix firecube crashes
it might still be misrendering not sure
2009-07-12 12:13:40 +10:00
Michel Dänzer
65059606e9 radeon: Fix scissor rectangle calculation when rendering to FBO.
fgl_glxgears -fbo runs, though the gears don't look right yet.
2009-07-11 20:25:09 +02:00
Dave Airlie
db618427ab radeon: enable GL_NV_texture_rectangle under dri2. 2009-07-11 03:17:13 +10:00
Dave Airlie
85957cb512 radeon: set texture in state properly.
make sure to turn off when no texture is used in hw
2009-07-11 03:17:12 +10:00
Dave Airlie
a6a11e1dc0 radeon: make swtcl emit size bigger 2009-07-11 03:17:12 +10:00
Alex Deucher
37c0cde80a R6xx/r7xx: use packet 3 for scratch emit
no need to allow packet 0 scratch regs in the drm
2009-07-10 12:04:56 -04:00
Alex Deucher
0de26dba2e R6xx/r7xx: disable CS dump
Don't fprintf to a xterm with the lock held.
2009-07-09 17:15:23 -04:00
Brian Paul
8987410ab6 Merge branch 'mesa_7_5_branch' 2009-07-09 08:05:56 -06:00
Richard Li
93ab69a0ef Fix buffer age implementaion bug. 2009-07-08 14:49:48 -04:00
Alex Deucher
f9db04878b R6xx/r7xx: remove some left over debugging 2009-07-07 15:44:44 -04:00
Alex Deucher
0396795689 R6xx/R7xx: fix texture reloc emit
Textures don't look right yet, but tex demos run.
2009-07-07 15:40:28 -04:00
Alex Deucher
f74d1c26ac r6xx/r7xx: add sw blit for tex upload
Can be used for buffer swap as well.
2009-07-07 02:12:38 -04:00
Alex Deucher
6799bc0b6b tex wip 2009-07-07 01:02:08 -04:00
Alex Deucher
1bad691a17 R6xx/r7xx: first pass at texture support
texture bo setup isn't quite working yet
2009-07-06 10:25:48 -04:00
Cooper Yuan
c6b0b46d6d R6xx/r7xx: DEPTH_CONTROL will be reset by this function 2009-07-06 16:30:43 +08:00
Jakob Bornecrantz
7ccb00b1ac Merge branch 'mesa_7_5_branch' 2009-07-05 04:14:41 +02:00
Brian Paul
f742f2c0b3 demos: indentation fix 2009-07-08 13:59:03 -06:00
Brian Paul
820436f978 demos: use glEnable/DisableClientState() for vertex arrays 2009-07-08 13:58:30 -06:00
RALOVICH, Kristóf
bf71ece171 glx: death to RCS tag 2009-07-08 13:34:57 -06:00
Corbin Simpson
67a43b2cfc r300g: Remove VAP_CNTL_STATUS from invariant state.
Seriously.
2009-07-08 11:59:56 -07:00
Corbin Simpson
c737e57357 r300g: Disable MSPOS registers for glisse's CS security checker.
These will come back in someday, when we can properly use them.
2009-07-08 11:55:27 -07:00
Corbin Simpson
746140e215 r300-gallium: Unify sampler and texture emit.
They have to cross into each other's registers.
2009-07-08 11:39:34 -07:00
Corbin Simpson
1aa38b2c2d r300-gallium: Mipmap setup.
(cherry picked from commit 88c01a15da5639dd68a6a0133724994cb66f1316)
2009-07-08 11:30:59 -07:00
Corbin Simpson
e46d12d394 r300g: Add endian fix to vertex fetcher setup.
As reported and initially tested by MrCooper.
2009-07-08 11:27:26 -07:00
Corbin Simpson
ce0f7954f8 gallium: Add endian detection to p_config. 2009-07-08 11:26:52 -07:00
Maciej Cencora
186d187ff7 r300: fix regression introduced by ca13937ef9
Stride == 0 means that we value for first vertex should be copied to every other vertices (e.g. constant color).

This fixes glean/vertProg1 and sauerbraten with enabled shaders.
2009-07-08 18:42:39 +02:00
Maciej Cencora
95df7bfc03 radeon: fix copy and paste typo 2009-07-08 18:42:39 +02:00
Maciej Cencora
afd687b0dc mesa/vbo: always recalculate min_index and max_index when splitting vertices 2009-07-08 18:42:39 +02:00
Jakob Bornecrantz
eb33c0ab8b progs/tests: Use compressed texture in mipmap_comp_tests 2009-07-04 16:01:45 +02:00
Eric Anholt
be64e66e5a intel: Fix flipped Y for glDrawPixels(GL_STENCIL_INDEX) to window system.
Even after fixing bugs in this code, it doesn't make me feel any cleaner.
Fixes piglit stencil-drawpixels.
2009-07-07 15:43:44 -07:00
Eric Anholt
bdd7506f10 intel: Fall back on glCopyPixels(GL_DEPTH) or GL_STENCIL. 2009-07-07 15:36:10 -07:00
Eric Anholt
510c3bd7a1 i965: Remove BRW_NEW_INPUT_VARYING
This state flag has been unused since the ffvertex_prog move to core.
2009-07-07 15:16:29 -07:00
Eric Anholt
058e96916b Cap array elements at 0 when passed an invalid pointer for an array object.
Otherwise, a pointer greater than the size would underflow and give a large
maximum element.

Reviewed-by: Brian Paul <brianp@vmware.com> (previous version)
2009-07-07 15:16:28 -07:00
Jakob Bornecrantz
28471cfa97 Merge branch 'mesa_7_5_branch' 2009-07-04 07:43:01 +02:00
Jakob Bornecrantz
9982821cda progs/tests: Tests more views in mipmap_comp_tests 2009-07-04 07:41:40 +02:00
Zack Rusin
edb0267170 Merge commit 'origin/openvg-1.0' 2009-07-06 21:43:26 -04:00
Zack Rusin
124a6b1958 gallium: rearrange some members to avoid memory holes/padding
plus it saves us a cacheline in the cso
2009-07-06 17:21:37 -04:00
Zack Rusin
5920b6b679 pipebuffer: handle possible null pointer dereference
reported by clang static analyzer
2009-07-06 17:21:37 -04:00
Zack Rusin
f311893bf4 cso: possible null pointer dereference
reported by clang static analyzer
2009-07-06 17:21:37 -04:00
Zack Rusin
4873031e29 util: fix possible null pointer usage
found by the clang static analyzer
2009-07-06 17:21:37 -04:00
Zack Rusin
21cce6afb0 exa: some infrastucture work for accelerating composite 2009-07-06 17:21:36 -04:00
Dave Airlie
d66de6c341 radeon: ensure cmdbuf space for state + AOS is available
The problem is if we find out later we don't have any cmdbuf space but
we've already written the arrays to the DMA buffer object, we end up
emitting the current cmdbuf which has references to the current DMA object
we then send that to the hw and we can't reference the arrays we just emitted
to the old DMA buffer. things go bad, crash boom.

This can probably be tuned further + swtcl probably needs some fixes
2009-07-06 20:39:49 +10:00
Dave Airlie
7266e33abd r200: fix makefile 2009-07-06 17:46:36 +10:00
Dave Airlie
f110c5fd6e radeon: fixup FBO depth 24 allocations to avoid assert 2009-07-06 15:50:24 +10:00
Dave Airlie
c27f21f92d radeon/r200/r300: port to new space checking code in libdrm
This moves a big chunk of the space checking code into libdrm so
it can be shared by the DDX.
2009-07-06 15:12:17 +10:00
Corbin Simpson
645bfa32c9 radeon-gallium: Compile warning fix.
Fixes flush during validation, in case a buffer is double-validated.
2009-07-05 11:56:40 -07:00
Corbin Simpson
c8e0d55ac6 radeon-gallium: Use FLINK to do proper global buffers. 2009-07-05 11:55:47 -07:00
Corbin Simpson
df04e72d25 radeon-gallium: Wait for BOs before mapping them. 2009-07-05 11:29:13 -07:00
Maciej Cencora
6fff62ee3f r300: fix vertex limits
- don't limit vertex count if we are using indices
- max indices count is 65535 not 65536
- remove some comments that don't apply anymore
- remove unreachable code
2009-07-05 15:22:37 +02:00
Jakob Bornecrantz
862488075c Merge branch 'mesa_7_5_branch'
Conflicts:
	src/mesa/main/dlist.c
	src/mesa/vbo/vbo_save_api.c
2009-07-03 18:53:58 +02:00
Michel Dänzer
060c7f2321 radeon: Wait for BO idle if necessary before mapping it.
Fixes fighting between GPU and software rendering with TTM.
2009-07-03 12:44:19 +02:00
Michel Dänzer
6b2461fec9 r300: Guard debugging output. 2009-07-03 12:44:02 +02:00
Eric Anholt
8ae02a3919 intel: Fall back on glBitmap with fog enabled.
We would have to build the program with the appropriate fog mode, and
also supply the fog coordinate if appropriate.

Bug #19413.
2009-07-02 19:31:51 -07:00
Eric Anholt
ae1bfb6427 intel: Flush when mapping buffer objects so writes don't get reordered.
While GEM covers this for execution it knows about, it doesn't know about
the batchbuffer we're preparing.  Fixes piglit vbo-map-remap.c testcase.
2009-07-02 18:53:56 -07:00
Corbin Simpson
9a0b570ab6 vbo: If MapBufferRange fails, try MapBuffer instead.
Fixes segfaults with radeon winsys.
(Probably libdrm_radeon doing something that it shouldn't.)
2009-07-02 16:32:59 -07:00
Corbin Simpson
aa5b9c050f Nuke old trace-drm integration.
AFAICT nobody will miss it.
2009-07-02 16:32:59 -07:00
Eric Anholt
6d66f23c50 intel: Fix leak of DRI option info due to using the wrong free routine. 2009-07-02 14:07:10 -07:00
Eric Anholt
ddef7dc87b intel: Clean up leak of driver context structure on context destroy. 2009-07-02 14:07:10 -07:00
Eric Anholt
cb4ef34214 intel: Init num_fences to clean up valgrind warning.
Valgrind doesn't know that a successful getparam sets the target of the
pointer, so just set the value beforehand.
2009-07-02 14:07:09 -07:00
Richard Li
bb429803e0 r6xx/r7xx: Better fix for fragment temps
This doesn't waste as many in generic cases.
2009-07-02 12:08:57 -04:00
Jakob Bornecrantz
d1c8a0a308 r300g: Readd trace driver support 2009-07-02 15:07:53 +02:00
Jakob Bornecrantz
59abfa8e42 i915g: Readd trace driver support 2009-07-02 15:05:17 +02:00
Jakob Bornecrantz
c0d7502a2c trace: Add drm api integration
This is okay since drm_api.h doesn't have any external
	dependancies, one could make it only compile on platforms
	that support drm.
2009-07-02 14:57:55 +02:00
Dave Airlie
54ee188a00 radeon/r200/r300: drop radeon renderbuffer private width/height
half stealing the code without taking the intel regions
2009-07-02 20:57:45 +10:00
Dave Airlie
2ed3eddf9a radeon/r300: use base width/height.
I suspect this might break TFP in some way but it makes firecube run here
2009-07-02 20:45:19 +10:00
Cooper Yuan
c571395e5d R6xx/r7xx: Fix line width issue, ROUND_MODE and QUANT_MODE aren't bits of LINE_CNTL 2009-07-02 16:52:11 +08:00
Cooper Yuan
da88333671 R6xx/r7xx: Correct the indeices of DRAW_INDEX_IMMD 2009-07-02 16:49:19 +08:00
Xiang, Haihao
73137997e2 i965: fixes for JMPI
1. the data type of <src1> (JMPI offset) must be D
2. execution size must be 1
3. NoMask
4. instruction compression isn't allowed.
2009-07-02 16:32:19 +08:00
Corbin Simpson
96ef7aae1d r300g: Fix recursive Draw flush.
Also just noticed that demos/copypix walks around the overlapping blit rules.

Bad, bad Mesa. :3
2009-07-01 23:25:47 -07:00
Corbin Simpson
8799a9d24d r300g: Use floats for surface_copy texcoords, use correct src and dest.
This makes demos/copypix better-looking. Horizontal dimensions are right now.
2009-07-01 23:09:18 -07:00
Corbin Simpson
338db0af61 radeon-gallium: Adapt to drm_api changes.
Note that trace debugging is temporarily gone. I'll rework it later.
2009-07-01 22:33:17 -07:00
Alex Deucher
8bda0f1f4f r6xx/r7xx: rework aos setup
In theory this should fix the stride = 0 case,
but I can't seem to reproduce that anymore
with mesa master.
2009-07-01 14:41:57 -04:00
Alex Deucher
65cdf9c561 R6xx/R7xx: Fix number of temps used in fragment program
Spotted by Cooper.  This gets hello, aargb, smooth, etc.
working.
2009-07-01 11:10:10 -04:00
Eric Anholt
5e6b593d35 intel: Avoid pointer arithmetic on void *.
Bug #22000.
2009-06-30 22:57:56 -07:00
Eric Anholt
c3499f6c66 i965: Increase G4X default VS URB allocation to actually allow 32 threads.
This improves the performance of my GLSL demo by 30%.  It also fixes the
VS deadlock that ut2004 had, for reasons I can't explain. Bug #21330.
2009-06-30 17:55:23 -07:00
Ian Romanick
f359165a82 demos: Set the depth mask correctly to get the desired blending 2009-06-30 17:29:52 -07:00
Ben Skeggs
18a1c36c2d nouveau: return some supported zeta formats 2009-07-01 09:26:57 +10:00
Ben Skeggs
55e5ac17c1 nouveau: deal with PIPE_CAP_TGSI_CONT_SUPPORTED 2009-07-01 09:26:57 +10:00
Ben Skeggs
55fc63cd7d nouveau: fix build... 2009-07-01 09:26:56 +10:00
Jakob Bornecrantz
64849d1236 drm/st: Remove drm_api struct from drivers
Remove the drm_api from the functions in the softpipe and
	i915simple drivers. Create wrapper functions in the
	backends instead.
2009-07-01 01:20:04 +02:00
Brian Paul
119eb40942 i965: first attempt at handling URB overflow when there's too many vs outputs
If we can't fit all the VS outputs into the MRF, we need to overflow into
temporary GRF registers, then use some MOVs and a second brw_urb_WRITE()
instruction to place the overflow vertex results into the URB.

This is hit when a vertex/fragment shader pair has a large number of varying
variables (12 or more).

There's still something broken here, but it seems close...
2009-06-30 17:12:44 -06:00
Brian Paul
1b6ae2e004 i965: use BRW_MAX_MRF 2009-06-30 17:12:44 -06:00
Brian Paul
76a5a5dace i965: use BRW_MAX_GRF, BRW_MAX_MRF 2009-06-30 17:12:44 -06:00
Brian Paul
0fe19bc91d i965: move BRW_MAX_GRF, define BRW_MAX_MRF 2009-06-30 17:12:44 -06:00
Brian Paul
0b7b8c8ddf i965: defined BRW_MAX_MRF 2009-06-30 17:12:44 -06:00
Brian Paul
6eb2ca500d i965: comments and a new assertion 2009-06-30 17:12:44 -06:00
Alex Deucher
d10006e67f R6xx/r7xx: fix locking for clear
this allows redbook hello to render correctly mostly.
2009-06-30 18:40:48 -04:00
Eric Anholt
57a06d3a48 i915: Fix assertion failure on remapping a non-BO-backed VBO.
Failure to set the obj->Pointer back to null tripped up the assertion.
Bug #22428.
2009-06-30 10:41:18 -07:00
Brian Paul
b40dc7e7fc Merge branch 'mesa_7_5_branch'
Conflicts:

	src/mesa/vbo/vbo_exec_draw.c
2009-06-30 08:56:53 -06:00
Brian Paul
b750b9fc3d gallium: remove the pipe_sampler_state::shadow_ambient field
This was only present for the sake of GL_ARB_shadow_ambient which we
never implemented in Gallium.  If we someday want GL_ARB_shadow_ambient
we can implement it in the state tracker by adding a MAD after the
relevant TEX instructions.
2009-06-30 08:51:32 -06:00
Jakob Bornecrantz
f7cbaae13d identity: Create a drm_api wrapper 2009-06-30 12:24:47 +02:00
Jakob Bornecrantz
303cbb45b5 drm/st: Return drm_api struct from a function 2009-06-30 12:20:39 +02:00
Brian Paul
efe9faf061 softpipe: use shadow_compare4() to compare texcoord to four texture samples 2009-06-29 22:46:55 -06:00
Brian Paul
005ee9f4e0 softpipe: pass sampler state to shadow_compare() 2009-06-29 22:46:49 -06:00
Younes Manton
0eb1b3fac1 nouveau: Expect right params to tex_transfer_destroy().
Never crashed on x86, ptx is in the same stack slot in either case.
Thanks to Bob Gleitsmann for catching this.
2009-06-29 22:22:25 -04:00
Younes Manton
78aaf2a4f1 nouveau: Turn off debug cannon. 2009-06-29 22:22:25 -04:00
Eric Anholt
1f070125e3 intel: Enable EXT_gpu_program_parameters.
There doesn't appear to be any driver impact for enabling this, and
tests/prog_parameter passes.
2009-06-29 15:14:50 -07:00
Brian Paul
b8c479d4b0 Merge branch 'mesa_7_5_branch' 2009-06-29 15:27:49 -06:00
Brian Paul
423f45d18a gallium/draw: sketch out some missing pointcoord code
The gl_PointCoord attribute is currently expected to be in the fog coord
register's z/w components.  This was never totally fleshed out though.
This is just some placeholder code.
2009-06-29 15:27:28 -06:00
Brian Paul
5c06c52116 st/mesa: enable GL_ARB_framebuffer_object
All gallium drivers should be able to support mixed-size color/depth/stencil
buffers.  If not, we'll need a new PIPE_CAP_ query.
2009-06-29 15:27:28 -06:00
Brian Paul
f44638fa61 mesa: check for ARB_framebuffer_object for GL_TEXTURE_STENCIL_SIZE_EXT query 2009-06-29 15:27:28 -06:00
Brian Paul
cb0ea416bd mesa: alphabetize lines 2009-06-29 15:27:28 -06:00
Eric Anholt
a96f86831e Revert "intel: Remove unneded pthread mutex in LOCK_HARDWARE."
This reverts commit de447afff2 but
puts the lock under DRI1-only.

From keithw:
> It's there because the DRI1 code doesn't actually achieve the mutexing
> which it looks as if it should.  For multi-threaded applications it was
> always possible to get two threads inside locked regions -- I have no
> idea how, but it certainly was and presumably still is possible.
2009-06-29 11:39:09 -07:00
Eric Anholt
94008088c1 intel: Move note_unlock() implementation to the one place it's needed. 2009-06-29 10:33:50 -07:00
Eric Anholt
de447afff2 intel: Remove unneded pthread mutex in LOCK_HARDWARE.
This would cause LOCK_HARDWARE to mutex all contexts in this process on
both DRI1 and DRI2.  On DRI1, LOCK_HARDWARE already does it for all
processes on the system.  On DRI2, LOCK_HARDWARE doesn't, but there shouldn't
be any state outside the context that needs any additional protection.
Notably, the bufmgr is protected by its own mutex and not
LOCK_HARDWARE.

This code was originally introduced with the i915tex code dump, so it's not
clear what it was there for.
2009-06-29 10:33:50 -07:00
Eric Anholt
3927874d9c intel: Make LOCK_HARDWARE recursive to avoid hand-rolling recursiveness. 2009-06-29 10:33:50 -07:00
Brian Paul
7b5373c434 Merge branch 'mesa_7_5_branch' 2009-06-29 11:20:07 -06:00
Timo Aaltonen
082f547492 Move dri.pc to mesa-common-dev (closes: #521667) 2009-06-29 15:22:21 +03:00
Julien Cristau
9032d6b40b Prepare changelog for upload 2009-06-28 20:22:05 +02:00
Julien Cristau
489ca73db1 Merge commit 'mesa-7.4.4-1' into debian-experimental
Conflicts:
	debian/changelog
2009-06-28 20:20:56 +02:00
Julien Cristau
2c8046b1bc Prepare changelog for upload 2009-06-28 18:58:41 +02:00
Julien Cristau
18bb120fce Refresh patches 2009-06-28 18:41:21 +02:00
Julien Cristau
d2c8712fa4 Remove some directories absent from the tarballs, and add some missing ones 2009-06-28 18:09:58 +02:00
Julien Cristau
b59211a602 Update changelog 2009-06-28 17:46:10 +02:00
Julien Cristau
adafe6d607 Merge commit 'mesa_7_5_rc4' into debian-experimental
Conflicts:
	progs/fp/point-position.c
	progs/fp/tri-depth.c
	progs/fp/tri-depth2.c
	progs/fp/tri-depthwrite.c
	progs/fp/tri-depthwrite2.c
	progs/fp/tri-inv.c
	progs/fp/tri-param.c
	progs/fp/tri-tex.c
	progs/tests/.gitignore
	progs/tests/Makefile
	progs/tests/zreaddraw.c
2009-06-28 17:41:50 +02:00
Cooper Yuan
d1bc9a29b9 Fix viewport issue 2009-06-26 17:04:53 +08:00
Cooper Yuan
eaadba6eee Fix color data can't be fetched issue 2009-06-25 19:48:43 +08:00
Julien Cristau
c38bc21cf5 add bug closer 2009-06-24 19:54:26 +02:00
Julien Cristau
1df36638c0 Don't build gallium for now. 2009-06-24 17:30:00 +02:00
Julien Cristau
dd89f8e3ea Merge branch 'debian-unstable' into debian-experimental
Conflicts:
	debian/changelog
	debian/patches/06_kfreebsd-ftbfs.diff
2009-06-24 17:26:42 +02:00
Julien Cristau
2ca61d4474 Merge commit 'mesa_7_4_4' into debian-experimental 2009-06-24 17:23:34 +02:00
Julien Cristau
22f1c449ae update changelog 2009-06-24 17:20:23 +02:00
Julien Cristau
2be8cd65cb Merge tag 'mesa_7_5_rc3' into debian-experimental 2009-06-24 17:19:16 +02:00
Julien Cristau
ec4c889266 Update 04_osmesa_version.diff, refresh 06_kfreebsd-ftbfs.diff. 2009-06-24 12:37:17 +02:00
Julien Cristau
c84a384fdf Update changelog 2009-06-24 12:32:20 +02:00
Julien Cristau
f56634caea Merge tag 'mesa_7_4_4' into debian-unstable 2009-06-24 12:27:10 +02:00
Brian Paul
d0c391b6a2 docs: set 7.4.4 release date 2009-06-23 18:53:31 -06:00
Cooper Yuan
5e1534f532 correct scissor and cliprect setting 2009-06-23 11:11:19 +08:00
Brian Paul
eaed8dc609 mesa: bump version to 7.4.4 2009-06-22 15:27:03 -06:00
Brian Paul
b5609e6444 docs: release notes for 7.4.4 2009-06-22 15:26:19 -06:00
Brian Paul
0b870bbb2a docs: 7.4.3 MD5 checksums 2009-06-22 11:24:09 -06:00
Brian Paul
1dbbc39f48 intel: added a null ptr check
This was hit during screen tear-down.
2009-06-22 11:23:44 -06:00
Brian Paul
4b8cd0b0ad intel: call _mesa_unreference_framebuffer() in intelDestroyBuffer()
This was a call to _mesa_reference_framebuffer(ptr, NULL) but the NULL
pointer is incorrect in Mesa 7.4.x.

Fixes a failed assertion during screen tear-down.
2009-06-22 11:23:13 -06:00
Cooper Yuan
3a3c7fd52e functions declaration with 'extern' 2009-06-22 15:10:57 +08:00
Cooper Yuan
2f6451042d Pass viewport id to r700SendViewportState function, otherwise the radom value may beyond R700_MAX_VIEWPORTS 2009-06-22 14:33:18 +08:00
Cooper Yuan
46ca8e5782 add LINK_STATES for SPI_PS and SEMANTIC 2009-06-22 10:16:01 +08:00
Brian Paul
5d387a35ff docs: set 7.4.3 release date 2009-06-19 15:16:01 -06:00
Brian Paul
2ae6859215 docs: bump version to 7.4.3 2009-06-19 15:14:49 -06:00
Brian Paul
afe0ca1f3f mesa: rework viewport/scissor initialization code
The first time a context is bound to a drawable, the viewport and scissor
bounds are initialized to the buffer's size.  This is actually a bit tricky.

A new _mesa_check_init_viewport() function is called in several places
to check if the viewport has been initialized.  We also use a new
ctx->ViewportInitialized flag instead of the overloaded
ctx->FirstTimeCurrent flag.

Hand-picked from mesa_7_5_branch, commit 3f856c6b6b
2009-06-17 08:43:17 -06:00
Brian Paul
6b782231d0 mesa: added null ptr check in Fake_glXCreatePixmap()
Fixes segfault in progs/xdemos/glxgears_pixmap.c

(cherry picked from master, commit d18c57aaea)
2009-06-17 08:40:16 -06:00
Brian Paul
2b890c9818 docs: document GLX/glean makeCurrent fix 2009-06-17 08:06:50 -06:00
Brian Paul
e0b13e15f1 GLX: attempt to fix glean makeCurrent test cases.
Two parts to this:

One we don't keep pointers to possibly freed memory anymore once we unbind the
drawables from the context. Brian I need to figure out what the comment
you made there, can we get a glean/piglit test so we can fix it properly?

If the new gc is the same as the oldGC, we call the unbind even though
we just bound it in that function. doh.

(cherry picked from master, commit 77506dac8e)
2009-06-17 08:05:54 -06:00
Brian Paul
420c74b870 docs: document viewport clamping bug 2009-06-16 09:40:22 -06:00
Brian Paul
a64f994a3a mesa: fix incorrect viewport clamping in _mesa_set_viewport()
A 0 by 0 viewport size is legal.  Don't clamp against lower bound of one.
The error checking earlier in the function prevents negative values.
2009-06-16 09:39:33 -06:00
Brian Paul
c568446dc6 docs: fixed bug 21872 2009-06-16 08:48:26 -06:00
Brian Paul
acbf9c6f3c mesa: fix REMAINDER() macro
The results were incorrect for some negative values of A.
See bug 21872.

(cherry picked from mesa_7_5_branch, commit ed7f4b4230)
2009-06-16 08:48:12 -06:00
Brian Paul
3b842feead docs: recent fixes for 7.4.3 2009-06-15 16:24:03 -06:00
Brian Paul
6d62b8d5c1 intel: Release fb backing regions in intelDestroyBuffer()
Fixes memory leak when destroying framebuffers.

(cherry picked from mesa_7_5_branch, commit d027e8feff)
2009-06-15 16:22:54 -06:00
Jakob Bornecrantz
2fe65e8f14 Merge branch 'mesa_7_5_branch' 2009-06-14 16:56:34 +02:00
Dave Airlie
6791576f6c Revert "r200: make use of DMA buffers for Elts a lot better."
This reverts commit 0952645fe0.

Need to revisit where this is going wrong
2009-06-29 20:15:47 +10:00
Corbin Simpson
928a568417 r300g: YCbCr and sRGB textures. 2009-06-27 12:07:59 -07:00
Corbin Simpson
f150e05afc r300g: Fix EXT_packed_depth_stencil functionality.
Allow Z24S8 to be a true texture.
2009-06-27 12:07:59 -07:00
Jakob Bornecrantz
1ac72aedb2 st/dri: Fix last depth bits logic 2009-06-27 19:55:37 +02:00
Nicolai Hähnle
dbb56687c8 radeon: Always initialize front and back renderbuffers if present
This fixes an assertion in glReadPixels from the front buffer.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-06-27 18:16:49 +02:00
Nicolai Hähnle
9fa0d25c54 radeon: Update .gitignore
Add all source files that are symlink'ed from common radeon code to the
ignore list.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-06-27 18:08:44 +02:00
Corbin Simpson
3f15acb7e8 r300g: EXT_provoking_vertex. 2009-06-26 21:48:09 -07:00
Corbin Simpson
6ebcdc7549 r300g: S3TC.
tests/texcompress2 doesn't work, but tests/texcmp does (more or less.)
2009-06-26 21:25:41 -07:00
Corbin Simpson
aac6648cd8 r300g: Use real texture formats.
What bugs me is that the YUV444 format somehow worked properly. :3
2009-06-26 21:25:41 -07:00
Corbin Simpson
7a3224c334 r300g: Definitively forbid unusable Z buffer/stencil formats. 2009-06-26 21:25:40 -07:00
Corbin Simpson
9e7d195fdc r300g: Comment out assert for now.
Will fix with better constant refactoring later.
2009-06-26 21:25:40 -07:00
Corbin Simpson
00ffc90dd2 r300g: Be more specific on surface_copy fallbacks. 2009-06-26 21:25:40 -07:00
Corbin Simpson
6a926f9997 r300g: PIPE_CAP_TGSI_CONT_SUPPORTED. 2009-06-26 21:25:40 -07:00
Corbin Simpson
f80b7f4683 r300-gallium: Ensure that no dirty state goes unemitted. 2009-06-26 21:25:40 -07:00
Brian Paul
f57280cc73 Merge branch 'arb_vertex_array_object' 2009-06-26 17:49:14 -06:00
Brian Paul
a18e209edb Merge branch 'mesa_7_5_branch'
Conflicts:

	Makefile
	src/gallium/drivers/softpipe/sp_screen.c
	src/mesa/main/version.h
2009-06-26 17:07:07 -06:00
Roland Scheidegger
4fdc6ad41b i965: fix fetching constants from constant buffer in glsl path
the driver used to overwrite grf0 then use implicit move by send instruction
to move contents of grf0 to mrf1. However, we must not overwrite grf0 since
it's still used later for fb write.
Instead, do the move directly do mrf1 (we could use implicit move from another
grf reg to mrf1 but since we need a mov to encode the data anyway it doesn't
seem to make sense).
I think the dp_READ/WRITE_16 functions may suffer from the same issue.
While here also remove unnecessary msg_reg_nr parameter from the dataport
functions since always message register 1 is used.
2009-06-26 20:39:49 +02:00
Vinson Lee
d3b46fc77f configs/darwin: Set CXX to g++. 2009-06-26 12:36:45 -06:00
Brian Paul
b2a1ca4fcf docs: document GL_ARB_vertex_array_object 2009-06-22 17:54:16 -06:00
Brian Paul
8affcd364b intel: enable GL_ARB_vertex_array_object extension 2009-06-22 17:54:00 -06:00
Brian Paul
cfb8158058 mesa: plug in glBindVertexArray, glGenVertexArrays functions 2009-06-22 17:52:08 -06:00
Brian Paul
31618f1a88 tests: update bufferobj.c to test GL_ARB_vertex_array_object 2009-06-22 17:51:30 -06:00
Brian Paul
2a795ad522 st/mesa: alphabetize lines 2009-06-22 17:01:44 -06:00
Brian Paul
32220c48ad st/mesa: enable GL_ARB_vertex_array_object 2009-06-22 17:01:00 -06:00
Brian Paul
e2b7249555 mesa: enforce the rule that arrays live in VBOs for GL_ARB_vertex_array_object 2009-06-22 16:56:35 -06:00
Brian Paul
7ebadecd87 mesa: added extension flag for ARB_vertex_array_object 2009-06-22 16:47:45 -06:00
Brian Paul
9342e6f5a9 mesa: implement _mesa_GenVertexArrays() for GL_ARB_vertex_array_object
This also involves adding a gl_array_object::VBOonly field.  For the
ARB extension, all arrays in the object must reside in a VBO.  This flag
keeps track of that requirement.
2009-06-19 18:17:25 -06:00
Brian Paul
b8000c874e mesa: implement _mesa_BindVertexArray() 2009-06-19 18:12:11 -06:00
Brian Paul
12cf98f5fc mesa: move vertex array objects from shared state to per-context
The ARB version requires VAOs to be per-context while the Apple extension
was ambiguous.
2009-06-19 18:11:52 -06:00
Brian Paul
bda551898a mesa: regenerated files related to GL_ARB_vertex_array_object 2009-06-19 18:11:29 -06:00
Brian Paul
54b03948e0 glapi: add new information for GL_ARB_vertex_array_object 2009-06-19 18:11:18 -06:00
Michel Dänzer
dd26899ca3 intel: Fixups for 'mesa: create/destroy buffer objects via driver functions'.
Initialize all driver function hooks before calling _mesa_initialize_context(),
and handle all buffer objects in intel_buffer_object().

Fixes assertion failure when running glxinfo.
2009-06-19 23:55:55 +02:00
Roland Scheidegger
4d2b392a0a radeon: fix cube maps for non-mm path
drm cmd checker would refuse cube emits
also fix an issue in the cs path which would calculate the register
offset off by one dword.
Only same testing done as original code (none except compile tested).
2009-06-19 22:56:32 +02:00
Brian Paul
fa5b81ea8b st/mesa: restore some parameter checking buffer object functions
These functions may be called from the VBO code (not just user GL calls)
so do some parameter sanity checking.
2009-06-19 14:43:55 -06:00
Roland Scheidegger
ffae82da4c r200: fix cube maps for non-mm path
drm cmd checker rightfully fell over any cube emit
2009-06-19 22:32:06 +02:00
Brian Paul
e90d6a3cbf i965: initial code for loops in vertex programs 2009-06-19 12:19:33 -06:00
Brian Paul
fd7d764514 i965: asst clean-ups, etc in brw_vs_emit() 2009-06-19 12:19:33 -06:00
Brian Paul
752204d362 i965: asst clean-ups, var renaming in brw_wm_emit_glsl() 2009-06-19 12:19:33 -06:00
Brian Paul
9d029e0e20 st/mesa: remove redundant st_buffer_object::size field and error checks
Just use the gl_buffer_object::Size field.  Remove unnecessary size/offset
error checks.  Core Mesa will have already done these checks before these
functions are called.
2009-06-19 12:19:15 -06:00
Brian Paul
1ffd074436 st/mesa: no longer special-case buffer object 0 in st_buffer_object() cast wrapper
Since commit 6629a35559 "mesa: create/destroy
buffer objects via driver functions" this is no longer needed, and actually
was causing a crash during context tear-down.
2009-06-19 12:13:15 -06:00
Roland Scheidegger
7ce814b25f radeons: use dp4 for position invariant vertex programs
Fixes #22181. R200 requires this since DP4 is used in hw tnl mode.
R300 prefers it (should be faster due to no instruction dependencies), but
both methods should be correct (when sw tcl is used though, MUL/MAD might
be faster). Probably doesn't make much difference for R100 since vertex progs
are executed in software anyway, but let's just keep it the same there too.
2009-06-19 20:01:14 +02:00
Brian Paul
a8da1feb23 mesa: make query-related driver fallback functions static
Plug them in via _mesa_init_query_object_functions().
2009-06-19 10:05:08 -06:00
Brian Paul
331eb58f68 mesa: make buffer object-related driver fallback functions static
Plug them in via _mesa_init_buffer_object_functions().
2009-06-19 10:00:03 -06:00
Brian Paul
6629a35559 mesa: create/destroy buffer objects via driver functions 2009-06-19 09:58:51 -06:00
Brian Paul
e164210f65 i965simple: use u_reduced_prim() function 2009-06-19 09:48:43 -06:00
Brian Paul
d2e4643767 draw: use u_reduced_prim() function 2009-06-19 09:45:23 -06:00
Brian Paul
09da78c235 softpipe: use u_reduced_prim() 2009-06-19 09:42:37 -06:00
Brian Paul
157d52143a gallium/util: s/boolean/unsigned/ 2009-06-19 09:39:56 -06:00
Brian Paul
b0b8832e6f softpipe: whitespace, reformatting 2009-06-19 09:38:12 -06:00
Brian Paul
9038b6c8bb Merge branch 'ext-provoking-vertex'
Conflicts:

	docs/relnotes-7.6.html
	progs/tests/Makefile
	src/gallium/drivers/softpipe/sp_prim_vbuf.c
	src/glx/x11/indirect.c
	src/mesa/glapi/Makefile
	src/mesa/glapi/dispatch.h
	src/mesa/glapi/glapioffsets.h
	src/mesa/glapi/glapitable.h
	src/mesa/glapi/glapitemp.h
	src/mesa/glapi/glprocs.h
	src/mesa/main/dlist.c
	src/mesa/main/enums.c
	src/mesa/sparc/glapi_sparc.S
	src/mesa/x86-64/glapi_x86-64.S
	src/mesa/x86/glapi_x86.S
2009-06-19 09:15:34 -06:00
Brian Paul
0ddc4dbe43 draw: use flatfirst variable 2009-06-18 23:00:37 -06:00
Brian Paul
9205a871e7 draw: remove debug code 2009-06-18 22:51:41 -06:00
Brian Paul
af5fff9c23 draw: fix first provoking vertex mode for quads, quad strips and polygons 2009-06-18 22:48:51 -06:00
Brian Paul
950171be3c draw: fix first provoking vertex mode for unfilled quads 2009-06-18 22:47:46 -06:00
Brian Paul
601065f153 mesa: fix first provoking vertex mode for unfilled tri strips 2009-06-18 22:45:57 -06:00
Brian Paul
c70a529d7c draw: clean up indentation 2009-06-18 18:33:29 -06:00
Thomas Hellstrom
0342229289 gallium dri st: Probe the driver for supported surface formats.
This is done when constructing the fbconfigs, and the result is saved
for window system framebuffer creation.

Note: For dri2 the server needs to have an identical format selection
logic. Otherwise the dri state-tracker and the xorg driver (state-tracker)
will disagree on which format to use for the attachments. Some more work
is needed in this area.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2009-06-17 03:07:01 +02:00
Thomas Hellstrom
c9f19571da mesa driconf: Add macro to specify an option with a quoted default value.
The default values true and false will expand to "1" and "0" when
gcc -std=c99, causing bool option defaults to generate runtime failures.

One solution is to specify bool option defaults quoted as "true" and "false".
Add a macro to assist this.

Signed-off-by: Thomas Hellstrom <thellstrom@vmware.com>
2009-06-17 03:07:00 +02:00
Jakob Bornecrantz
edbec6b112 progs/rbug: Add small program to add block rules 2009-06-18 14:36:19 +02:00
Eric Anholt
3addc4e307 i965: Add decode for the G4X x,y offset in surface state. 2009-06-17 21:01:48 -07:00
Eric Anholt
6c3f696891 i965: Fix up texture layout for small things with wide pitches (tiled)
We were packing according to the pitch, while the hardware appears to base
it on the base level width.

With this and the previous commit, fbo-cubemap now matches untiled behavior.
2009-06-17 21:01:48 -07:00
Eric Anholt
0f328c90db i965: Fall back or appropriately adjust offsets of drawing to tiled regions.
3D rendering to tiled textures was being done with non-tile-aligned offsets.
The G4X hardware has fields to let us support it easily and correctly, while
the pre-G4X hardware requires a path full of suffering, so we just fall back.
2009-06-17 21:01:48 -07:00
Dave Airlie
46000cecc3 r300: use vbo_split_prims to split up large vertex buffers.
This lets ut2004 avoid hitting the elt warning.
2009-06-18 13:25:38 +10:00
Eric Anholt
bd10f0e84f i965: Fix tiling for FBO depth attachments by making DEPTH_COMPONENT Y tiled.
This may hurt if miptree relayout occurs, since we can't blit Y tiled
objects.  But it corrects depth tests on FBOs using textures.
2009-06-17 20:19:19 -07:00
Dave Airlie
b165fa7d45 radeon: don't re-add BOs to validate list
if its on the list its on the list don't go readding it.

multitexturing from the same texture could cause this.
2009-06-18 13:16:06 +10:00
Brian Paul
3817a54912 glsl: call _mesa_postprocess_program(), disabled 2009-06-17 09:58:29 -06:00
Brian Paul
516d20fd26 mesa: silence warning 2009-06-17 09:58:29 -06:00
Brian Paul
ec6ad7ba3c mesa: added _mesa_postprocess_program() to aid shader debugging 2009-06-17 09:58:29 -06:00
Jerome Glisse
f806a03361 radeon: Flush command buffer on viewport change
We flush the command buffer so we don't emit mixed
state (with new and previous buffer size) command
buffer, this is especialy affecting zbuffer states.
2009-06-17 16:33:14 +02:00
Jerome Glisse
2506c4e8b1 r300: don't emit vap index offset on r5xx hw when using cs
vap index offset is programmed to 0 by the kernel, it
would add work to kernel checker to allow userspace
programming of this so it's now disallowed with CS
on KMS.
2009-06-17 13:54:09 +02:00
Dave Airlie
77506dac8e GLX: attempt to fix glean makeCurrent test cases.
Two parts to this:

One we don't keep pointers to possibly freed memory anymore once we unbind the
drawables from the context. Brian I need to figure out what the comment
you made there, can we get a glean/piglit test so we can fix it properly?

If the new gc is the same as the oldGC, we call the unbind even though
we just bound it in that function. doh.
2009-06-17 13:59:28 +10:00
Dave Airlie
856221d699 radeon: fix warnings in wrapper with libdrm 2009-06-17 11:12:57 +10:00
Brian Paul
8d48222791 Merge branch 'mesa_7_5_branch'
Conflicts:

	src/mesa/main/api_validate.c
2009-06-16 18:25:52 -06:00
Roland Scheidegger
4ef1f8e3b5 i965: handle OPCODE_SWZ in the glsl path
glsl compiler will not generate OPCODE_SWZ, and as a first step it would
be translated away to a MOV anyway (why?), but later internally this opcode is
generated (for EXT_texture_swizzling).
2009-06-16 21:40:41 +02:00
Brian Paul
1510c3cae1 docs: minor relnotes clean-up 2009-06-15 16:44:26 -06:00
Brian Paul
70d247c69b Merge branch 'arb_map_buffer_range'
Conflicts:

	docs/relnotes-7.6.html
	src/mesa/main/mtypes.h
2009-06-15 16:42:42 -06:00
Brian Paul
01f7bda44c mesa: revert some recent VBO buffer object refcounting changes
Reverts part of commit d7ea9ddf58.
We were calling _mesa_reference_buffer_object() on some heap-allocated
memory that was uninitialized and could trigger an assertion.
We can actually go back to "looser" ref counting of the Null/default
buffer object in these cases.
2009-06-15 10:58:04 -06:00
Brian Paul
b0d874bfbe mesa: regenerated gl_mange.h file 2009-06-15 10:47:07 -06:00
Roland Scheidegger
63c407db3e enable ARB_half_float_pixel for intel drivers 2009-06-15 18:31:03 +02:00
Roland Scheidegger
4ed2c0dddc intel: fix (cosmetic) typo flag used twice 2009-06-15 18:30:51 +02:00
Thomas Hellstrom
f5888d9ca5 Merge branch 'mesa_7_5_branch'
Conflicts:

	progs/util/extfuncs.h
2009-06-15 11:43:48 +02:00
Maciej Cencora
e0eafde746 r300: fix 3D textures 2009-06-15 01:07:19 +02:00
Jakob Bornecrantz
6530fabb93 Merge branch 'mesa_7_5_branch' 2009-06-14 06:32:47 +02:00
Jakob Bornecrantz
210ad58ee3 trace: Don't write state objects to file if dumping is not set 2009-06-14 06:07:50 +02:00
Keith Whitwell
0cce6d7e33 tgsi: correct handling of return value from util_vsnprintf
We were failing to deal with:
  - vsnprintf returns negative value on error.
  - vsnprintf returns the number of chars that *would* have been
    written on truncation.
2009-06-26 13:43:10 +01:00
Dave Airlie
0952645fe0 r200: make use of DMA buffers for Elts a lot better.
This allows us to return the unused portion of the dma buffer
to the allocator instead of wasting nearly 16k a pop.
2009-06-26 15:09:12 +10:00
Dave Airlie
db54579628 r200: only emit unitneeded textures 2009-06-26 15:09:11 +10:00
Joakim Sindholt
622858884f r300-gallium: organize fragment/vertex shaders
Appart from separating r3xx/r5xx fragment shaders, a more consistent
naming scheme has been applied. From now on:
r300 = all chips
r3xx = R300/R400 only
r5xx = R500 only
This way r300_fragment_shader is the master struct, and the structs
r3xx_fragment_shader and r5xx_fragment_shader inherits it.
2009-06-26 01:13:06 +02:00
Vinson Lee
450b20d1ef gallium: Add PIPE_OS_APPLE token. 2009-06-25 09:52:50 -06:00
Jakob Bornecrantz
e99d13bbc6 progs/tests: Add yet another mipmap test 2009-06-14 01:44:34 +02:00
Roland Scheidegger
43b3b745e4 radeon: fix hw texture limits
still always enable max, but the right values this time.
More work should probably be done for saner limits without mm, and/or
dri conf option allow_large_textures (which is ignored) removed.
3D limit on r100 is pretty arbitrary as still handled by swrast anyway.
Also fix r300 limits (except 3d I've no idea what the max is anyway so
keep using mesa default).
2009-06-25 15:57:33 +02:00
Dave Airlie
cdbcb051d9 radeon/r200: add some hw texture limits 2009-06-25 13:26:52 +10:00
Dave Airlie
69fd0cbaa2 radeon: fix stupidity in cs space check code.
This was already correct in the GEM code
2009-06-25 12:13:17 +10:00
Brian Paul
bc5c40d7d9 intel: fix additional merge conflicts missed in previous commit 2009-06-24 08:57:48 -06:00
Brian Paul
a04af335a4 Merge branch 'mesa_7_5_branch'
Conflicts:

	src/mesa/drivers/dri/i915/i915_tex_layout.c
	src/mesa/drivers/dri/i965/brw_wm_glsl.c
	src/mesa/drivers/dri/intel/intel_buffer_objects.c
	src/mesa/drivers/dri/intel/intel_pixel_bitmap.c
	src/mesa/drivers/dri/intel/intel_pixel_draw.c
	src/mesa/main/enums.c
	src/mesa/main/texstate.c
	src/mesa/vbo/vbo_exec_array.c
2009-06-24 08:54:37 -06:00
Jakob Bornecrantz
d60b2c6855 identity: Add new identity driver
This driver does no transformation of the gallium calls
	going to the real driver, like the identity matrix. It is
	intended to be the basis for transforming and/or debug
	drivers like trace and rbug.

	Authors of this patch are:
		Michal Krol, orignal heavy lifting.
		José Fonesca, object wrapping code stolen from trace.
		Jakob Bornecrantz, put it all toghether and renamed a stuff.
2009-06-24 13:04:56 +02:00
Eric Anholt
b8e638d489 i965: Disable texture tiling by default.
I haven't fixed all the regressions yet, and it'll be easy to re-enable when
the known problems are fixed.
2009-06-23 19:31:43 -07:00
Eric Anholt
b72dea5441 i965: Set the max index buffer address correctly according to the docs.
It's the last addressable byte, not the byte after the end of the buffer.
2009-06-23 19:31:13 -07:00
Eric Anholt
d43599afef i965: Don't set a reserved bit in MI_FLUSH.
I noticed this when this MI_FLUSH showed up in IPEHR for the ut2004 hang.
Not setting the reserved bit didn't help, though.
2009-06-23 19:31:13 -07:00
Eric Anholt
5ca800e100 dri2: Refresh the fake front contents after glXSwapBuffers().
Bug #19177.

Reviewed by: Ian Romanick <ian.d.romanick@intel.com>
2009-06-23 19:31:12 -07:00
Eric Anholt
9c0ba017c8 i965: Fix depth-texture Y-tiling detection for sized internal formats.
Fixes assertion failure on norsetto shadow mapping demo.
2009-06-23 19:31:12 -07:00
Eric Anholt
e0a4e25f93 i965: Fix packed depth/stencil textures to be Y-tiled as well.
Fixes shadowtex.c.  And an assert is added to catch this sooner next time.
2009-06-23 19:31:12 -07:00
Eric Anholt
1593a1bb34 intel: Bail on blits with non-tile-aligned offsets. 2009-06-23 19:31:12 -07:00
Eric Anholt
8f81a6468f intel: Avoid trying to do blits to Y tiled regions.
This is somewhat nasty, but we need to do Y-tiled depth for FBO support.
May help with corruption and hangs since enabling texture tiling, and
since switching depth textures to Y tiled.

Fixes piglit depthtex.c on 965.
2009-06-23 19:31:11 -07:00
Eric Anholt
246d59c29e intel: Fix some potential writes to zero-copy PBOs when used as regions.
I was in the midst of fixing some blitting-with-Y-tiled issues when I
noticed this.  Hopefully PBO usage will be a little more robust, as a
result.
2009-06-23 19:31:11 -07:00
Eric Anholt
6a49473ab5 intel: Remove long-unused intel_region_fill and intelEmitFillBlit. 2009-06-23 19:31:10 -07:00
Eric Anholt
a9b03aaebf intel: Refuse to do texture tiling if we don't have the kernel support. 2009-06-23 19:31:10 -07:00
Pauli Nieminen
4f1e141c11 Fix crash when debug output is enabled and sarea is notset in r200Clear 2009-06-23 16:43:00 +02:00
Ian Romanick
70e72070fc mesa: From float type modifier from values to large for singles
The values 2147483648.0 and 4294967294.0 are too larget to be stored in single
precision floats.  Forcing these to be singles causes bits to be lost, which
results in errors in some pixel transfer tests.

This fixes bug #22344.
2009-06-22 18:22:51 -07:00
Brian Paul
a31118c25a st/mesa: fix setup_edgeflags() regression
stobj is now non-null for the default/null buffer object.  Update the
test to check the buffer ID to see if it's a real buffer object.
2009-06-22 17:49:22 -06:00
Jakob Bornecrantz
7a879500ac gallium-intel: Improve Xorg Makefile a bit
The real solution is to create a Makefile.template for xorg
	drivers and use that here.
2009-06-22 23:45:02 +02:00
Jakob Bornecrantz
23170ab236 st/xorg: Convert to template makefile 2009-06-22 23:34:18 +02:00
Jakob Bornecrantz
5d0a1d4241 st/dri: Fix typo when checking for depth formats 2009-06-22 23:34:18 +02:00
Eric Anholt
c80ce5ac90 i965: Fix warnings in intel_pixel_read.c. 2009-06-22 08:52:52 -07:00
Michel Dänzer
2c36ed9067 intel: Fix glReadPixels regression since changing context init order.
Fixes regression in dd26899ca3 that also
affected some PBO operations.
2009-06-22 08:45:45 -07:00
Eric Anholt
df70d3049a intel: Also get the DRI2 front buffer when doing front buffer reading. 2009-06-19 22:18:16 -07:00
Eric Anholt
afc981ee46 intel: Update Mesa state before span setup in glReadPixels.
We could have mapped the wrong set of draw buffers.  Noticed while looking
into a DRI2 glean ReadPixels issue.
2009-06-19 22:17:46 -07:00
Eric Anholt
dcfe0d66bf intel: Move intel_pixel_read.c to shared for use with i965. 2009-06-19 22:16:16 -07:00
Eric Anholt
3b08a43f32 intel: Don't map regions with drm_intel_gem_bo_map_gtt() unless they're tiled.
This fixes a regression in region read performance that came in with the
texture tiling changes.  Ideally we'd have an access flag coming in so we
could also use bo_map_gtt for writing, like we do for buffer objects.

Bug #22190
2009-06-19 17:25:20 -07:00
Eric Anholt
405300bb19 intel: Fix other metaops versus GL_COMPILE_AND_EXECUTE dlists.
Fixes oglconform zbfunc.c and pxtrans-cidraw.c, at least.
2009-06-19 16:43:45 -07:00
Eric Anholt
64edde1004 intel: Fix glClear behavior versus display lists.
The CALL_DrawArrays was leaking the clear's primitives into the display
list with GL_COMPILE_AND_EXECUTE.  Use _mesa_DrawArrays instead, which
doesn't appear to leak.  Fixes piglit dlist-clear test.
2009-06-19 16:43:45 -07:00
Eric Anholt
396b4043f0 mesa: Make VBO dlist printing use the same path as other dlist printing.
I was rather confused when mesa_print_display_list didn't show any of
my glBegin()..glEnd().  Nothing but print_list appears to call
this function, so matching its behavior seems like a good idea.
2009-06-19 16:43:45 -07:00
Chia-I Wu
cca30245bd intel: Do not access pbo's buffer directly when attaching.
pbo might be system buffer based or attached to another region.  Call
intel_bufferobj_buffer to make sure pbo has a buffer of its own.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
Signed-off-by: Eric Anholt <eric@anholt.net>
2009-06-19 16:43:45 -07:00
Chia-I Wu
ed91389618 intel: Data are copied in the wrong direction when breaking COW tie.
Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
Signed-off-by: Eric Anholt <eric@anholt.net>
2009-06-19 16:43:45 -07:00
Chia-I Wu
1a7ec317ef intel: Fix migration from sys_buffer in intel_bufferobj_buffer.
intel_bufferobj_subdata is called to migrate data from sys_buffer, and
it expects only one of buffer or sys_buffer is non-NULL.

Signed-off-by: Chia-I Wu <olvaffe@gmail.com>
Signed-off-by: Eric Anholt <eric@anholt.net>
2009-06-19 16:43:45 -07:00
Roland Scheidegger
402df41c1c radeon: make cubemap mipmap generation work
need to pass target parameter to radeon_teximage/radeon_subteximage functions
otherwise mipmap generation for cube maps can't work (assert/segfault in
_mesa_generate_mipmap)
2009-06-20 00:28:39 +02:00
Roland Scheidegger
7a5c5b9af3 demos: make cubemap work without EXT_fbo support
use SGIS_generate_mipmap if EXT_fbo support (for manual mipmap generation)
is not available.
2009-06-20 00:28:38 +02:00
Brian Paul
18af7c384c i965: interpolate colors with perspective correction by default
...rather than with linear interpolation.  Modern hardware should use
perspective-corrected interpolation for colors (as for texcoords).
glHint(GL_PERSPECTIVE_CORRECTION_HINT, mode) can be used to get
linear interpolation if mode = GL_FASTEST.
2009-06-12 16:21:20 -06:00
Brian Paul
05f0d90962 mesa: use larger initial refcount for NullBufferObj
Refcounting of the null/default buffer object isn't perfect yet so be
extra safe.
2009-06-12 16:01:02 -06:00
Brian Paul
0854b7e972 mesa: use _mesa_reference_buffer_object() in a few places 2009-06-12 16:01:02 -06:00
Brian Paul
d7ea9ddf58 mesa: use _mesa_reference_buffer_object() in a few places 2009-06-12 16:01:02 -06:00
Brian Paul
193177b732 tests: added persp_hint.c test
Test the effect of GL_PERSPECTIVE_CORRECTION_HINT on color interpolation.
2009-06-12 15:59:53 -06:00
Dave Airlie
c4a5754a8c add some info to relnotes on radeon 2009-06-13 07:43:04 +10:00
Maciej Cencora
4109108739 r300: add support for EXT_texture_sRGB
Tested with glean/texture_srgb and wine/d3d9 tests on RV535
2009-06-12 19:08:44 +02:00
Brian Paul
d0b0df380a set/mesa: enable GL_NV_texture_env_combine4
This is handled entirely in core Mesa where the combiner state is converted
into a fragment program.
2009-06-12 10:18:15 -06:00
Alex Deucher
1036ef2bf4 Merge master and fix conflicts 2009-06-12 12:09:34 -04:00
Brian Paul
5379f35a15 tests: added arbgpuprog, for compile-testing ARB vertex/fragment programs 2009-06-12 08:16:18 -06:00
Brian Paul
509d9eb686 st/mesa: additional debug code (disabled) 2009-06-12 08:16:18 -06:00
Jakob Bornecrantz
1cd0afffc9 progs/rbug: Add binary to bmp converter program 2009-06-12 15:07:57 +01:00
Jakob Bornecrantz
3fff84a999 Merge branch 'mesa_7_5_branch' 2009-06-12 12:31:04 +01:00
Owen W. Taylor
279143c6e8 Disable SGI_swap_control extension for DRI2
We currently don't have support for SGI_swap_control for direct
contexts with DRI2, so disable reporting the extension. Reporting
the extension, and then having glXSwapIntervalSGI() "succeed"
but do nothing can confuse applications.

https://bugs.freedesktop.org/show_bug.cgi?id=22123
2009-06-12 11:41:37 +10:00
Dave Airlie
d0fab94842 radeon: fix size of mipmap texture array 2009-06-12 11:37:13 +10:00
Dave Airlie
a5d92d7ed2 radeon/r200/r300: fix max texture levels assert
use the actual value set in the context
2009-06-12 11:35:10 +10:00
Dave Airlie
7f223ff891 Merge remote branch 'main/radeon-rewrite' 2009-06-12 11:17:32 +10:00
Alex Deucher
917f8bc1a8 Add RV740 support 2009-06-11 18:24:41 -04:00
Maciej Cencora
67bbfb9c68 r300: fix VAP setup
If GL context had e.g. tex0, tex2 and fog the VAPOutputCntl1 returned 0x104 instead of 0x124 - that meaned we're sending only 8 texcoords (instead of 12) which ended up in GPU hang.
2009-06-11 23:25:54 +02:00
Maciej Cencora
234797564d r300: fix for SW TCL path
We shouldn't use i variable for SWTCL_OVM_TEX because textures doesn't have to be enabled in "packed" order.
We could have tex1,tex3 and fog which would receive 7,9,8 OVM locations instead of 6,7,8.
2009-06-11 23:25:54 +02:00
Maciej Cencora
8d728b8fe7 r300: don't send unused attributes for SW TCL path 2009-06-11 23:25:54 +02:00
Maciej Cencora
b5d49cb195 r300: send only RS_IP_* regs that we are going to use 2009-06-11 23:25:53 +02:00
Maciej Cencora
2b5f8d2b55 r300: fix RS setup when no colors and textures are sent to FP
RS_COL_FMT field is part of RS_IP_* reg not RS_INST_*
2009-06-11 23:25:53 +02:00
Maciej Cencora
34cb4b6be3 r300: r500 fragment program fixes
- when rewriting per component negate swizzle, first instruction should get not negated source
- KIL instruction ignores swizzles

TODO:
- tex instructions does not support saturation
- tex instructions cannot read from consant memory
2009-06-11 23:25:53 +02:00
Maciej Cencora
e21e82f425 radeon: increase max bo count 2009-06-11 23:25:53 +02:00
Maciej Cencora
9abc72d1fc r300: fix a GPU lock up
Sending from VAP more texture coordinates than RS expects results in GPU hang.

Fixes BumpSelfShadow from DirectX8 SDK.
2009-06-11 23:24:25 +02:00
Maciej Cencora
de19eb0b0d r300: fix vertex program bug
If the vertex program didn't write position attribute, the position invariant function would add necessary instructions, but the vertex position would be overwritten by artificial outputs insts added to satisfy fragment program requirements.

Fixes "whole screen is gray" problem for HW TCL path in sauerbraten when shaders are enabled, and whole slew of wine d3d9 tests.
2009-06-11 23:24:25 +02:00
Maciej Cencora
2611e92da5 r300: move some code for easier debugging 2009-06-11 23:24:25 +02:00
Maciej Cencora
52645c4647 r300: print vertex program when debugging is enabled 2009-06-11 23:24:25 +02:00
Maciej Cencora
28724b575d r300: fix output register allocation for vertex shaders
If the vertex program wrote secondary color without primary color, the secondary color output register index would be 0 which resulted in overwriting vertex position in some cases.
2009-06-11 23:24:25 +02:00
Maciej Cencora
b4ebd1c191 r300: hw doesn't support saturation for tex instructions 2009-06-11 23:24:25 +02:00
José Fonseca
877061141a Merge branch 'mesa_7_5_branch' 2009-06-11 19:03:54 +01:00
José Fonseca
bf89ecb6c9 Merge branch 'mesa_7_5_branch'
Conflicts:
	src/mesa/state_tracker/st_cb_fbo.c
	src/mesa/state_tracker/st_framebuffer.c
2009-06-11 16:34:56 +01:00
Jerome Glisse
b445e54868 r300: fix indexed primitive rendering when using memory manager 2009-06-11 11:06:14 +02:00
Alex Deucher
1d8d4cad6a Properly set aos_count
This is used by radeonReleaseArrays to free AOS.
2009-06-11 01:54:40 -04:00
Thomas Hellstrom
0d2ac7a10b dri st: Don't require the PIPE_TEXTURE_USAGE_RENDER_TARGET property for depth- and stencil renderbuffers.
Signed-off-by: Thomas Hellstrom <thellstrom-at-vmware-dot-com>
2009-06-11 00:56:03 +02:00
Michel Dänzer
550a2fe1b7 scons: Indent abbreviated command line strings, so command messages stand out.
Also add ASPPCOMSTR.
2009-06-11 12:15:50 +02:00
Michel Dänzer
3885b708fd intel: intel_texture_drawpixels() can't handle GL_DEPTH_STENCIL.
Fixes glean depthStencil test.
2009-06-11 12:09:10 +02:00
Alex Deucher
7ac2f655f8 move radeon_set_screen_flags() up so CHIP_FAMILY is set before using it
fixes last commit.
2009-06-10 18:02:20 -04:00
Alex Deucher
51507b0e94 Use correct scratch reg offset for r6xx/r7xx 2009-06-10 17:56:05 -04:00
Brian Paul
02659868e8 glsl: fix warnings, update comments, s/TRUE/GL_TRUE/
(cherry picked from master, commit 7fdd64ab29)
2009-06-10 12:26:12 -06:00
Brian Paul
457f4efab0 glsl: Handle continuation characters in preprocessor.
(cherry picked from master, commit cc22620e4b)
2009-06-10 12:25:35 -06:00
Brian Paul
0269eb5e3f glsl: Fix symbol replacement handling in preprocessor.
(cherry picked from master, commit d9617deb00)
2009-06-10 12:25:11 -06:00
Brian Paul
b7d9be69b2 glsl: Expand nested preprocessor macros.
(cherry picked from master, commit ef8caec29a)
2009-06-10 12:24:52 -06:00
Brian Paul
7b8b856c97 glsl: Fix preprocessor define argument parsing for dead sections.
(cherry picked from master, commit 19a54d9f10)
2009-06-10 12:24:32 -06:00
Brian Paul
24bffc4cc2 glsl: preprocessor debug code (disabled)
(cherry picked from master, commit 854151ba62)
2009-06-10 12:24:11 -06:00
Brian Paul
7fdd64ab29 glsl: fix warnings, update comments, s/TRUE/GL_TRUE/ 2009-06-10 12:16:15 -06:00
Michal Krol
cc22620e4b glsl: Handle continuation characters in preprocessor. 2009-06-10 20:00:15 +02:00
Brian Paul
aebc08b5cc gallium: updated PIPE_CAP_x comments 2009-06-10 08:12:19 -06:00
Jerome Glisse
316598b96f r300: make sure indexed rendering doesn't try to use more than the num of vertices
When with memory manager we need to make sure the GPU won't try to access
beyond vertex buffer size, do so by enforcing that the maximun index is the
last vertex of the buffer.
2009-06-10 14:59:33 +02:00
Brian Paul
ded8eb25ef st/mesa: enable EXT_provoking_vertex 2009-06-09 22:01:55 -06:00
Brian Paul
0195cc1c0d tests: prim.c demo, modified for GL_EXT_provoking_vertex 2009-06-09 22:00:22 -06:00
Brian Paul
39fd18014c tests: need tkmap.c for prim.c 2009-06-09 21:59:36 -06:00
Brian Paul
8b45c9ce6e draw: implement flatshade_first for drawing pipeline 2009-06-09 21:53:34 -06:00
Brian Paul
5aec03aaf4 softpipe: implement flatshade_first for triangles 2009-06-09 21:52:37 -06:00
Brian Paul
6f26f8c750 softpipe: implement flatshade_first for line setup 2009-06-09 21:51:29 -06:00
Alex Deucher
530e3e389d Pull in additional state setup from the DDX 2009-06-09 18:20:57 -04:00
Jakob Bornecrantz
ee98ae5a29 Merge branch 'mesa_7_5_branch'
Conflicts:

	Makefile
	src/mesa/main/version.h
	src/mesa/shader/slang/slang_preprocess.c
	src/mesa/state_tracker/st_cb_bufferobjects.c
2009-06-09 07:53:25 +02:00
Michal Krol
d9617deb00 glsl: Fix symbol replacement handling in preprocessor. 2009-06-10 12:15:13 +02:00
Michal Krol
03760a3903 winsys/gdi: Link to ws2_32 library. 2009-06-10 12:01:13 +02:00
Michal Krol
1b334587e9 trace: __func__ --> __FUNCTION__. 2009-06-10 11:56:38 +02:00
Eric Anholt
b30dc2c66a i915: Add an option for testing the effect of early Z in classic mode.
The early Z stuff is supposed to be unsafe without some more work in the
enable/disable path (in particular, how do we want to get it disabled on
the way out to the X Server?), but at the moment is 6% in OA.
2009-06-09 16:12:43 -07:00
Eric Anholt
38eddf04ed intel: Remove an unneeded hunk that slipped in with texture tiling.
intel_miptree_pitch_align does this later on.
2009-06-09 15:21:17 -07:00
Eric Anholt
1362484840 intel: Base tri clearing depth on Y tiling, not IS_I965().
Y tiling is why the 965 check was there, but I wanted to experiment with Y
on pre-965 as well.
2009-06-09 15:21:17 -07:00
Eric Anholt
2d57e96408 intel: Fix intel_region_unmap to do unmap, not map.
Thanks to Shuang He for catching this.
2009-06-09 15:21:16 -07:00
Brian Paul
a03b349153 i965: added intelFlush() call in intel_get_tex_image()
Fixes the render-to-texture test in progs/tests/getteximage.c
2009-06-09 15:07:39 -06:00
Brian Paul
29c79a03a4 tests: check for GL_EXT/ARB_framebuffer_object 2009-06-09 15:06:41 -06:00
Brian Paul
073c20befa tests: also test glGetTexImage with render to texture
Also, adjust texture dims for the original test.
And use GLEW.
2009-06-09 15:05:36 -06:00
Brian Paul
139f2ddde4 tests: quick and dirty glGetTexImage() test program 2009-06-09 14:05:17 -06:00
Brian Paul
b38dbc5179 intel: use GLboolean, not int, for compressed parameter 2009-06-09 14:05:17 -06:00
Brian Paul
89205a8760 intel: make a bunch of glTexImage-related functions static 2009-06-09 14:05:17 -06:00
Brian Paul
4eb9e58bbb intel: whitespace clean-ups 2009-06-09 14:05:17 -06:00
Brian Paul
c55f1a6c99 vbo: more glDrawElements debug code (disabled) 2009-06-09 14:05:17 -06:00
Brian Paul
4a7fd6323a mesa: added a simple bounds checker to glMap/UnmapBuffer() (disabled) 2009-06-09 14:05:17 -06:00
Jakob Bornecrantz
41482a6461 trace/rbug: Add support for draw block rule 2009-06-09 19:24:06 +01:00
Jakob Bornecrantz
f3cf3d2fc2 rbug: Change block protocol around a bit 2009-06-09 19:22:40 +01:00
Jakob Bornecrantz
b71a254f05 trace/rbug: Return textures currently bound to context 2009-06-09 16:00:40 +01:00
Jakob Bornecrantz
f0c21c0294 rbug: Extend context info and block ops 2009-06-09 16:00:39 +01:00
Brian Paul
42e9bde0fa intel: remove extra \n from warning string 2009-06-09 08:53:56 -06:00
Brian Paul
a81097c545 mesa: reorder fields, update comments for gl_buffer_object 2009-06-09 08:52:56 -06:00
Michal Krol
ef8caec29a glsl: Expand nested preprocessor macros. 2009-06-09 12:14:40 +02:00
Dave Airlie
18b3cbcede radeon: fix mipmap_limits crasher.
This gets the correct srclvl image map when uploading images to the new mipmap.
2009-06-09 13:52:58 +10:00
Corbin Simpson
c534604800 r300-gallium: HW TCL glxgears. (Read the rest of the log.)
Um. So, yeah. Two massive WTF moments here. The first one is that, somehow,
I never actually hooked up vertex shader emission, so the only time that the
VAP gets set up is during surface_copy/surface_fill. That's why acidgears
was happening.

The second one is that, somehow, once I actually hooked it up, glxgears just
magically worked. Without any actual, real testing, I somehow accidentally
made the shader compiler work. Go figure.
2009-06-08 20:23:34 -07:00
Corbin Simpson
cb3b91f2d6 r300-gallium: Make UCP and clip work again for SW TCL.
SW TCL: tri-clip works, tri-userclip works
HW TCL: tri-clip fails, tri-userclip works

That is a 200% improvement over the previous situation. Woot.
2009-06-08 20:01:57 -07:00
Corbin Simpson
ffa1972efb r300-gallium: Don't emit UCP planes for SW TCL. 2009-06-08 19:55:33 -07:00
Brian Paul
8d0f72e8f9 st/mesa: enable GL_ARB_map_buffer_range 2009-06-08 17:07:21 -06:00
Brian Paul
e297569d65 docs: new feature: GL_ARB_map_buffer_range 2009-06-08 17:06:13 -06:00
Brian Paul
e75b283b45 mesa: implement GL_ARB_map_buffer_range
Only enabled for software drivers at this point.

Note that the gl_buffer_object::Access enum field has been replaced by
a gl_buffer_object::AccessFlags bitfield.  The new field is a mask of
the GL_MAP_x_BIT flags which is a superset of the old GL_READ_ONLY,
GL_WRITE_ONLY and GL_READ_WRITE modes.  When we query GL_BUFFER_ACCESS_ARB
we translate the bitfield into the conventional enum values.
2009-06-08 17:02:36 -06:00
Brian Paul
75cb3c3b7a mesa: regenerated files for GL_ARB_map_buffer_range 2009-06-08 17:00:12 -06:00
Brian Paul
9c4ab6f4cc glapi: hook in ARB_map_buffer_range.xml 2009-06-08 16:59:53 -06:00
Brian Paul
b6bc5f37a5 glapi: spec/xml file for GL_ARB_map_buffer_range 2009-06-08 16:58:45 -06:00
Brian Paul
462a9525c7 mesa: reorder fields, update comments for gl_buffer_object 2009-06-08 15:27:10 -06:00
Michal Krol
19a54d9f10 glsl: Fix preprocessor define argument parsing for dead sections. 2009-06-08 20:52:47 +02:00
Brian Paul
854151ba62 glsl: preprocessor debug code (disabled) 2009-06-08 10:58:04 -06:00
Brian Paul
cc26e27746 docs: document MESA_EXTENSION_OVERRIDE env var 2009-06-08 10:56:51 -06:00
Brian Paul
f9c0ce0e07 softpipe: advertise PIPE_CAP_MAX_TEXTURE_ANISOTROPY as 16.0
Note that this doesn't have any real significance since
PIPE_CAP_ANISOTROPIC_FILTER still returns 0.
2009-06-08 10:55:34 -06:00
Brian Paul
a6f2663616 mesa: new MESA_EXTENSION_OVERRIDE env var
Can be used to enable/disable extensions as reported by
glGetString(GL_EXTENSIONS).

If a name is preceeded by '-' it's disabled.  Otherwise, the named
extension is enabled.

Intended for debug/test purposes.
2009-06-08 10:52:16 -06:00
Maciej Cencora
4adb190a16 mesa: EXT_vertex_array_bgra fixes
1) Pass the correct format when calling update_array in
   _mesa_VertexAttribPointerARB.
2) glVertexAttribPointerNV accepts GL_BGRA format too.
3) raise INVALID_VALUE error when format is BGRA and normalized is
   false in glVertexAttribPointerARB
2009-06-08 07:23:56 -06:00
Jakob Bornecrantz
8d2324d355 trace/rbug: Sleep on windows when blocked 2009-06-08 15:01:48 +02:00
Dave Airlie
8064a517b2 llvm: fix compile on gcc 4.4 2009-06-08 18:26:27 +10:00
Maciej Cencora
db63f63897 r300: fix regression caused by 056bc77547c304021a0faf204897ed238a5cf424
Fixes GPU hangs in software TCL path
2009-06-08 07:21:14 +10:00
Ben Skeggs
1a7739ae26 nouveau: forgotten makefile... 2009-06-07 19:29:29 +10:00
Dave Airlie
545e574cd9 Merge remote branch 'origin/master' into radeon-rewrite 2009-06-07 16:51:32 +10:00
Michel Dänzer
e2aedfa620 r300: Endianness fixes for recent vertex path changes.
Signed-off-by: Maciej Cencora <m.cencora@gmail.com>
2009-06-07 16:40:09 +10:00
Maciej Cencora
58982f8af1 r300: vertex array stride = 0 means that data are tightly packed in the array 2009-06-07 16:40:04 +10:00
Maciej Cencora
ca13937ef9 r300: GL_(U)SHORT and GL_(U)BYTE with < 4 components can also be HW accelerated
Also when index format is GL_UBYTE, convert it to GL_USHORT not GL_UINT.
Fix license header too.

Reported by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-06-07 16:39:58 +10:00
Maciej Cencora
a8c7c96be7 r300: remove unused code 2009-06-07 16:39:54 +10:00
Maciej Cencora
72c78b9992 r300: rewrite vertex setup for software T&L path using functions from software TCL path 2009-06-07 16:39:47 +10:00
Maciej Cencora
6cd0628f9f r300: prepare for some code duplication removal 2009-06-07 16:39:43 +10:00
Maciej Cencora
365799caea r300: enable EXT_vertex_array_bgra extensions 2009-06-07 16:39:39 +10:00
Maciej Cencora
fd80128e15 r300: add hw accelerated support for different vertex data formats 2009-06-07 16:39:33 +10:00
Maciej Cencora
e98082997c r300: prepare for different vertex data type support 2009-06-07 16:39:28 +10:00
Maciej Cencora
a27b689d08 r300: fixup vertex attributes ordering
Always allocate the vertex program input registers in the same order as the vertex attributes are passed in vertex arrays.
2009-06-07 16:39:23 +10:00
Maciej Cencora
ab60a44331 r300: always pass 4 color components to RS unit
Even if we don't pass all 4 color components to vertex shader unit, the vertex program can generate the missing components.
2009-06-07 16:39:16 +10:00
Ben Skeggs
f1edfa09ea nv50: fix multi-texturing 2009-06-06 16:24:09 +10:00
Ben Skeggs
6c1627a51c nv50: support non-normalized texture coords 2009-06-06 16:24:08 +10:00
Brian Paul
586341afd9 docs: document recent bug fixes for 7.4.x 2009-06-05 17:30:51 -06:00
Corbin Simpson
b7aa5b1d10 r300-gallium: Use VAP_CLIP_CNTL.
Makes tri-userclip work with HW TCL.
2009-06-05 13:46:59 -07:00
Corbin Simpson
1a359d9835 r300-gallium: Emit UCP. 2009-06-05 11:21:09 -07:00
Corbin Simpson
9e4590dff7 r300-gallium: Improve vs emit. 2009-06-05 10:18:20 -07:00
Michal Krol
4c034441a8 mesa: Fix wglext.h prototypes. 2009-06-05 15:01:08 +02:00
Ben Skeggs
d06e380e02 nv50: use larger tile sizes 2009-06-05 22:53:24 +10:00
Ben Skeggs
a471497345 nv50: use nouveau_bo for query buffers 2009-06-05 22:53:24 +10:00
Ben Skeggs
1a92c71a66 nv50: create textures with nouveau_bo, for flexibility with tiling later 2009-06-05 22:53:23 +10:00
Michal Krol
b04470b0bc util: Fix winsock include. 2009-06-05 14:32:31 +02:00
Corbin Simpson
90bfff0a29 r300-gallium: Mute some debug info.
Most of it is no longer interesting.
2009-06-05 00:12:26 -07:00
Corbin Simpson
4c66c5bf92 r300-gallium: vs: Fix negation calculation.
Still doesn't draw right, but at least it's the right numbers now.
Thanks to taiu in #dri-devel.
2009-06-04 23:56:32 -07:00
Corbin Simpson
571b36831b r300-gallium: Fix pasta.
Trivial but annoying.
2009-06-04 23:56:08 -07:00
Corbin Simpson
8652ad6899 r300-gallium: Improve vs debug more.
Still not showing me why my stuff's failing, but getting there.
2009-06-04 23:27:46 -07:00
Corbin Simpson
31609acbe9 r300-gallium: vs: Add negation, SUB.
Doesn't work. WTF.
2009-06-04 23:27:46 -07:00
Corbin Simpson
fb7d1fb0f0 r300: Moar vs debug. 2009-06-04 23:27:46 -07:00
Ben Skeggs
36705ee044 nouveau: plug in our map_buffer_range and friends 2009-06-05 14:48:45 +10:00
Ben Skeggs
40ed449918 nouveau: fix build with libdrm_nouveau 0.6 2009-06-05 14:37:04 +10:00
Ben Skeggs
6b3ca672eb nouveau: remove unneeded code from ws, use pipe_buffer_ instead of ws-> 2009-06-05 14:37:03 +10:00
Ben Skeggs
80e9e1ee81 nouveau: move channel creation into pipe drivers 2009-06-05 14:37:03 +10:00
Ben Skeggs
1b207d9bb8 nouveau: call notifier/grobj etc funcs directly
libdrm_nouveau is linked with the winsys, there's no good reason to do all
this through yet another layer.
2009-06-05 14:37:03 +10:00
Ben Skeggs
d4d584b16e nv04: remove u_simple_screen usage 2009-06-05 14:37:02 +10:00
Ben Skeggs
251c47117b nv10: remove u_simple_screen usage 2009-06-05 14:37:02 +10:00
Ben Skeggs
74c45add47 nv20: remove u_simple_screen usage 2009-06-05 14:37:01 +10:00
Ben Skeggs
901d7c3057 nv30: remove u_simple_screen usage 2009-06-05 14:37:01 +10:00
Ben Skeggs
74adb150d5 nv40: remove u_simple_screen usage 2009-06-05 14:37:01 +10:00
Ben Skeggs
bc466be695 nouveau: add pipe_buffer/fence code to pipe drivers, move nv50 over 2009-06-05 14:37:01 +10:00
Ben Skeggs
072fdc1fd3 nouveau: pass nouveau_bo instead of pipe_buffer to so_ calls 2009-06-05 14:37:00 +10:00
Ben Skeggs
04cef8a037 nouveau: call nouveau_pushbuf directly rather than going through nvws 2009-06-05 14:37:00 +10:00
Dan Nicholson
1e4334f623 osmesa: Link with -ldl for dlopen code
Now that the dlopen wrappers are built into libmesa.a, we need to link
standalone libOSMesa with libdl to resolve dlopen and friends on
platforms that need it.
(cherry picked from commit 4795dd5950)
2009-06-04 19:45:58 -07:00
Dan Nicholson
4795dd5950 osmesa: Link with -ldl for dlopen code
Now that the dlopen wrappers are built into libmesa.a, we need to link
standalone libOSMesa with libdl to resolve dlopen and friends on
platforms that need it.
2009-06-04 19:45:32 -07:00
Dan Nicholson
8861577fd1 osmesa: Allow building standalone in all three channel widths
autoconf had been designating the 8 bit libOSMesa as the default
standalone osmesa, but the Makefile expected it to be linked to libGL.
Fix up the osmesa Makefile so that it allows any of the combinations of
standalone and channel width to be built.

Fixes bug #21980.
(cherry picked from commit 7441dcd90b)
2009-06-04 19:05:48 -07:00
Dan Nicholson
7441dcd90b osmesa: Allow building standalone in all three channel widths
autoconf had been designating the 8 bit libOSMesa as the default
standalone osmesa, but the Makefile expected it to be linked to libGL.
Fix up the osmesa Makefile so that it allows any of the combinations of
standalone and channel width to be built.

Fixes bug #21980.
2009-06-04 19:04:36 -07:00
Jakob Bornecrantz
61ffba44fd trace/rbug: Use condvar on system that has it for blocking 2009-06-05 03:01:34 +01:00
Jakob Bornecrantz
d4c578ae41 gallium: Make pipe thread say if it has condvars or not 2009-06-05 02:57:19 +01:00
Alex Deucher
8c27d99eb8 re-arrange state structure
- split out renderbuffers
- split out shaders
- split our viewports

Only send the state needed.
2009-06-04 20:22:14 -04:00
Jakob Bornecrantz
76b3072e9b trace/rbug: Add new contexts functions to trace rbug 2009-06-04 23:45:29 +01:00
Jakob Bornecrantz
384bbe278d rbug: Update rbug protocol with new context calls 2009-06-04 23:45:29 +01:00
Alex Deucher
b591436230 Don't program VGT_OUT_DEALLOC_CNTL/VGT_VERTEX_REUSE_BLOCK_CNTL
These are chip specific and are programmed by the drm.
This should fix hangs on some chips.
2009-06-04 16:57:20 -04:00
Brian Paul
185fbcce36 mesa: call _mesa_ funcs, not gl funcs for debugging 2009-06-04 14:26:51 -06:00
Alex Deucher
4782bebe44 use the float interface for viewport updates 2009-06-04 15:30:37 -04:00
Brian Paul
9d58724c51 Merge branch 'mesa_7_5_branch'
Conflicts:

	src/mesa/main/context.c
2009-06-04 13:16:13 -06:00
Brian Paul
81a0ef3f20 mesa: update wglext.h to latest version 2009-06-04 10:30:25 -06:00
Brian Paul
d33c315d9e mesa: remove PFNGL typedefs that are in glext.h 2009-06-04 10:29:44 -06:00
Brian Paul
73a48a8af3 mesa: upgrade glext.h to version 52
A number of the PFNGL* function typedefs are now in glext.h and must be
omitted from the gl.h file.  gl.h will be pruned in the next commit.
2009-06-04 10:27:47 -06:00
Eric Anholt
1ba96651e1 intel: Add support for tiled textures.
This is about a 30% performance win in OA with high settings on my GM45,
and experiments with 915GM indicate that it'll be around a 20% win there.
Currently, 915-class hardware is seriously hurt by the fact that we use
fence regs to control the tiling even for 3D instructions that could live
without them, so we spend a bunch of time waiting on previous rendering in
order to pull fences off.  Thus, the texture_tiling driconf option defaults
off there for now.
2009-06-04 14:00:43 +00:00
Eric Anholt
165ae5e2fb i915: Don't rely on fence regs when we don't have to.
We're on the way to telling the kernel about when we need fence regs on our
objects or not, and this will cut the number of places needing them.
2009-06-04 10:34:52 +00:00
Eric Anholt
1b6f7fb7d5 i915: Remove some long-dead i830 code. 2009-06-04 10:34:52 +00:00
Brian Paul
091fcf3a27 Revert "softpipe: fix flat shading provoking vertex for PIPE_PRIM_POLYGON"
This reverts commit 5d75124db4.
2009-06-03 19:53:53 -06:00
Brian Paul
ab6508e399 mesa: fix parity error for tri strips with 1st provoking vertex 2009-06-03 19:52:32 -06:00
Brian Paul
8b875b732f tnl: fix first provoking vertex case for unfilled triangles 2009-06-03 19:03:27 -06:00
Brian Paul
086ecea179 softpipe: separate case for PIPE_PRIM_POLYGON in sp_vbuf_draw()
Because of flat shading, we can't use same code as PIPE_PRIM_TRIANGLE_FAN.
This is a follow-on to commit a59575d8fb.
2009-06-03 18:33:07 -06:00
Brian Paul
a64bbdaa3e softpipe: fix incorrect tri vertex order for PIPE_PRIM_POLYGON rendering
This fixes incorrect front/back-face orientation.
2009-06-03 18:31:55 -06:00
Brian Paul
1f1aa0c20c tnl: fix first provoking vertex bug for line loops 2009-06-03 17:28:31 -06:00
Brian Paul
f25e1007c2 swrast: always do span clipping in _swrast_write_rgba_span()
It's possible for mis-behaving vertex programs to produce vertex data
with very large/NaN values.  This doesn't get handled reliably by the
clipper code so we may try to rasterize triangles that extend beyond
the viewport/window.  Always clip spans to avoid invalid memory accesses
later.
2009-06-03 17:16:00 -06:00
Brian Paul
0b6a0b367f vbo: minor reformatting 2009-06-03 17:16:00 -06:00
Brian Paul
aa18e54ac9 vbo: move/refactor debug code 2009-06-03 17:16:00 -06:00
Brian Paul
13f6d07521 vbo: added debug code to check array data validity (disabled) 2009-06-03 17:16:00 -06:00
Brian Paul
e446ef50eb vbo: new debug/dump code (disabled) 2009-06-03 17:16:00 -06:00
Brian Paul
9200954370 mesa: added NaN checking code (disabled) 2009-06-03 17:16:00 -06:00
Brian Paul
035de6a82b mesa: check/prevent NaN for EX2/LG2 2009-06-03 17:16:00 -06:00
Brian Paul
87b2db988e tnl: updated clip debug code (disabled) 2009-06-03 17:16:00 -06:00
Brian Paul
e7927626c1 mesa: added buffer object debug code (disabled) 2009-06-03 17:16:00 -06:00
Brian Paul
4f4280b435 tnl: add some floating point sanity checks (disabled) 2009-06-03 17:16:00 -06:00
Brian Paul
ab4fd18584 vbo: tweak out-of-bounds VBO access error message
Subtract 1 from _MaxElement to be clearer.
2009-06-03 17:15:59 -06:00
Alex Deucher
e355f1d642 fill in r700ColorMask, cleanup 2009-06-03 15:52:09 -04:00
Alex Deucher
ac274b68d7 start to fill in ShadeModel() 2009-06-03 15:14:44 -04:00
Alex Deucher
ada26c4059 dump command buffer 2009-06-03 14:29:06 -04:00
Alex Deucher
f5d479d7f5 Clean up scissor and viewport code
Switch to common functions where applicable
2009-06-03 14:19:26 -04:00
Ian Romanick
1ad1576836 Thank you git for doing the right thing. 2009-06-03 17:55:42 +01:00
Ian Romanick
c428f467b6 Fix compiling indirect.c when GLX_DIRECT_RENDERING is not defined
DO NOT HAND-EDIT GLX PROTOCOL FILES.  Seriously.  How can you miss the giant
comment at the top of the file?
2009-06-03 17:53:40 +01:00
Ian Romanick
7f8000db8b Fast path when rebinding the same texture in single context environment
If there is no shared context, there is no purpose in rebinding the same
texture.  In some artificial tests this improves performance 10% - 30%.
2009-06-03 17:50:37 +01:00
Brian Paul
54576130a8 st/mesa: minor clean-ups, reformatting, etc 2009-06-02 21:46:17 -06:00
Brian Paul
5cd47e0361 docs: remove version info carried over from 7.5 2009-06-02 21:41:03 -06:00
Brian Paul
8086352fef docs: clarify GL_ARB_copy_buffer driver support 2009-06-02 21:35:11 -06:00
Brian Paul
dd174ea215 st/mesa: implement/enable GL_ARB_copy_buffer extension 2009-06-02 21:35:11 -06:00
Brian Paul
2813c08b35 mesa: fix error test mistake in _mesa_CopyBufferSubData() 2009-06-02 21:35:11 -06:00
Brian Paul
2e708fa909 docs: added GL_ARB_copy_buffer extension 2009-06-02 21:35:11 -06:00
Brian Paul
3a7399e2c4 mesa: enable GL_ARB_copy_buffer for software drivers 2009-06-02 21:35:11 -06:00
Brian Paul
08e43ebfb2 mesa: plug in new _mesa_CopyBufferSubData() functions 2009-06-02 21:35:11 -06:00
Brian Paul
dc0b71f00d mesa: _mesa_CopyBufferSubData() function, and driver fall-back 2009-06-02 21:35:11 -06:00
Brian Paul
96a30b06db mesa: new state for GL_ARB_copy_buffer 2009-06-02 21:35:10 -06:00
Brian Paul
76b438878e mesa: new CopyBufferSubData() driver hook 2009-06-02 21:35:10 -06:00
Brian Paul
751977075f glapi: regenerated files for GL_ARB_copy_buffer 2009-06-02 21:35:10 -06:00
Brian Paul
68892872ef glapi: include ARB_copy_buffer.xml 2009-06-02 21:35:09 -06:00
Brian Paul
4a1e4f9881 glapi: GL_ARB_copy_buffer xml info 2009-06-02 21:35:09 -06:00
Alex Deucher
116f40a1c4 Disable clear code for now 2009-06-02 19:23:16 -04:00
Alex Deucher
b55d0dd3ba fix an overflow in SPI_VS_OUT_CONFIG
VS must always export at least 1 param.
2009-06-02 19:20:24 -04:00
Joakim Sindholt
45b77830eb r300-gallium: strip swtcl to the bare minimum
This was originally taken from i915 and it shows.
Basically most the stuff in r300_render.c was never needed and
shouldn't have worked in the first place
2009-06-02 22:23:17 +02:00
Ian Romanick
129f311673 intel: Clip to window after calling Driver.TexImage2D
This prevents the width / height from being clipped to the window size before
the texture is allocated.  This matches intelCopyTexImage1D.

This should fix bug #21227

Signed-off-by: Ian Romanick <ian.romanick@intel.com>
2009-06-02 16:50:11 +01:00
Eric Anholt
a945e203d4 i915: Don't put VBOs in graphics memory unless required for an operation.
This saves doing swtnl from uncached memory, which is painful.  Improves
clutter test-text performance by 10% since it started using VBOs.
2009-06-02 06:55:10 -07:00
Eric Anholt
0ab8e2622e i965: Support OPCODE_TRUNC in the brw_wm_fp.c code.
This gets two more glean glsl1 tests using the non-GLSL path.
2009-06-02 06:21:54 -07:00
Brian Paul
2ecc2ece9c docs: implemented GL_EXT_provoking_vertex 2009-06-01 20:45:08 -06:00
Brian Paul
a444d245e5 mesa: enable GL_EXT_provoking_vertex for sw drivers 2009-06-01 20:43:57 -06:00
Brian Paul
82bc6e5ae3 tnl: implement GL_EXT_provoking_vertex 2009-06-01 20:43:09 -06:00
Brian Paul
cf997e0d2e mesa: fix loop over generic attribs in update_arrays()
(cherry picked from commit 1045481dd9)
2009-06-01 15:04:35 -06:00
Brian Paul
9f6ec50f8c Merge branch 'mesa_7_5_branch' 2009-06-01 15:01:33 -06:00
Timo Aaltonen
f3496a3cbd mesa-common-dev.install: Don't install glxew.h, conflicts with libglew. 2009-06-01 22:26:27 +03:00
Corbin Simpson
1fa023ae48 r300-gallium: Slightly hacky fix for glxgears-style TCL. 2009-06-01 12:04:29 -07:00
Nicolai Hähnle
c1ccc7d539 radeon: Provide a more detailled GL_RENDERER string.
Display the chip family and PCI ID. This can be parsed easily,
and essentially all information that the driver has about the chip can be
deduced from it.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-06-01 19:02:17 +02:00
Dan Nicholson
bc302b2a33 Use separate $(MINSTALL) for installing libraries
The special feature of bin/minstall to copy symlinks is only ever needed
when installing libraries which may have .so symlinks. All the headers
and directories can use a normal install program.

These two modes are separated as $(INSTALL) and $(MINSTALL) to allow the
user (or autoconf) to override installing normal files as they please.
An autoconf check for the install program has been added and will be
used in preference to minstall when available.

Fixes bug 16053.
2009-06-01 06:32:52 -07:00
Jakob Bornecrantz
85e0572756 progs/rbug: Add small remote debugging cli applications 2009-06-01 11:39:25 +01:00
Jakob Bornecrantz
01fa34cb98 trace/rbug: Add rbug integration for remote debugging 2009-06-01 11:19:56 +01:00
Jakob Bornecrantz
dfa4ebcbcc rbug: Add Gallium Remote Debugger Protocol code
This is the (de)marshalling and connection managment code
2009-06-01 11:19:39 +01:00
Jakob Bornecrantz
aee1a6f704 util: Add simple network functions 2009-06-01 02:18:15 -07:00
Julien Cristau
4bcb9cc14f Update patches
+ 02_use-ieee-fp-on-s390-and-m68k.patch moved from imports.h to compiler.h
+ 03_optional-progs-and-install.patch refreshed
+ 05_hurd-ftbfs.diff partly applied upstream
+ 06_kfreebsd-ftbfs.diff refreshed
2009-05-31 13:15:00 +02:00
Julien Cristau
537f3e7a1e Install dri.pc, which will be needed to build xorg-server 1.7. 2009-05-31 12:52:47 +02:00
Cooper Yuan
8e28d64e9c R6xx/r7xx: Fix blinn's lighting shader 2009-05-31 16:51:07 +08:00
Cooper Yuan
377d8b3673 R6xx/r7xx: Fix texture perspective gradients issue 2009-05-31 16:41:19 +08:00
Brian Paul
bedf7fa49f Merge branch 'mesa_7_5_branch' 2009-05-30 20:10:04 -06:00
Brian Paul
6c3cefdda6 Revert "softpipe: fix flat shading provoking vertex for PIPE_PRIM_POLYGON"
This reverts commit 5d75124db4.

This fixed unclipped polygons, but broke clipped polygons.
A better fix from the mesa 7.5 branch will be merged next...
2009-05-30 20:09:19 -06:00
Julien Cristau
2096234053 clarify changelog: this is only a release candidate 2009-05-30 21:08:54 +02:00
Alex Deucher
d8694cd3f6 get rid of chip_object struct 2009-05-29 15:37:04 -04:00
Alex Deucher
cb39377253 more cleanup 2009-05-29 15:04:44 -04:00
Alex Deucher
5a8b67f363 more cleanup 2009-05-29 14:55:12 -04:00
Alex Deucher
e6eb0ce6ef more cleanup 2009-05-29 14:45:07 -04:00
Alex Deucher
949c489f59 more cleanup 2009-05-29 14:23:04 -04:00
Alex Deucher
97ed5cffcb remove more old r300 bits 2009-05-29 13:56:58 -04:00
Alex Deucher
616692cac5 more cleanup 2009-05-29 13:53:57 -04:00
Alex Deucher
70a0301c5b Remove unused functions 2009-05-29 13:41:00 -04:00
Alex Deucher
37c3731819 Fix spelling in function name 2009-05-29 13:21:28 -04:00
Alex Deucher
9bcc421e68 R6xx/r7xx: remove old sw tcl bits 2009-05-29 13:16:23 -04:00
Alex Deucher
41a44ff891 R6xx/R7xx: switch to common clear with draw code 2009-05-29 13:07:05 -04:00
Alex Deucher
846b24ea82 r6xx/r7xx: switch to common dma functions for vecs 2009-05-29 12:49:45 -04:00
Brian Paul
fa0ca31586 softpipe: update comments for max texture size 2009-05-29 08:22:21 -06:00
Alex Deucher
9b10d19d4a Remove subpixel offset from viewport
remove subpixel offset inherited from r100 code.
based on 038f0bf591
2009-05-29 10:04:03 -04:00
Brian Paul
425c39058b softpipe: increase max 2D/cube texture size to 4K x 4K 2009-05-29 00:55:54 -06:00
Alex Deucher
7f022fb5cd Argh. fix last commit. clears are still broken 2009-05-28 17:18:17 -04:00
Alex Deucher
3f14745946 R6xx/r7xx: re-enable clears
flush cache and wait for idle after drawing.  Probably
just need the cache flush.  This gets redbook hello working
properly.
2009-05-28 17:09:19 -04:00
Cooper Yuan
5ff3368c1f R6xx, add edge rules for triangles 2009-05-28 16:51:49 -04:00
Brian Paul
b631d5fbf4 st: set pipe_rasterizer_state::flatshade_first according to provoking vertex state 2009-05-28 12:33:30 -06:00
Brian Paul
f2f89b01d2 mesa: glGet queries for GL_EXT_provoking_vertex 2009-05-28 12:31:56 -06:00
Brian Paul
fe86e50896 mesa: exec/dlist functions for glProvokingVertexEXT() 2009-05-28 12:31:18 -06:00
Brian Paul
89966cdb1b mesa: data structure updates for GL_EXT_provoking_vertex 2009-05-28 12:30:25 -06:00
Brian Paul
bd6c44458f mesa: regenerated enums for GL_EXT_provoking_vertex 2009-05-28 12:29:23 -06:00
Brian Paul
b9c245238c mesa: regenerated API files for GL_EXT_provoking_vertex 2009-05-28 12:28:18 -06:00
Brian Paul
8c12c9bf76 mesa: GL API changes for GL_EXT_provoking_vertex
This creates the new glProvokingVertexEXT() entrypoint.
2009-05-28 12:26:19 -06:00
Corbin Simpson
b70fcd620d r300-gallium, radeon-gallium: Make add_buffer indicate when a flush is needed.
On a side note, why is RADEON_MAX_BOS 24? Should ask airlied about that.
2009-05-28 07:46:34 -07:00
Jerome Glisse
5dcbcbfca4 r300: when using cs path emit scissor in the cmdbuffer 2009-05-28 13:48:38 +02:00
Jerome Glisse
2f9189d538 r300: rework texture offset emission. 2009-05-28 11:40:58 +02:00
Ben Skeggs
534f1e8f02 nv50: some mipmapping fixes 2009-05-28 16:06:25 +10:00
Christoph Bumiller
c11c107f7d nv50: negate sources directly where supported 2009-05-28 16:06:25 +10:00
Christoph Bumiller
87eea6e2b2 nv50: introduce emit_cvt and use it
This makes some code cleaner, and we can now easily
do CEIL and TRUNC.
2009-05-28 16:06:24 +10:00
Christoph Bumiller
3accd7ebe9 nv50: fix TXP
For TXP we need to divide texture coords by their w component, or
use the coords' 1/w in the perspective interpolation instruction.

This also tries to support 1D, 3D and CUBE textures, and lets the
instruction only load the components that are used.
2009-05-28 16:06:24 +10:00
Christoph Bumiller
94ba165dff nv50: use multiple constant buffers
Use different buffers for immds, FP params, and VP params.
One has to map constant buffer indices in shader code to buffers
defined via CB_DEF. In principle, we could use more buffers so
we'd have to change the shader code less frequently.
2009-05-28 16:06:24 +10:00
Christoph Bumiller
f9268ccd7f nv50: don't look for unfreed temps in free_nv50_pc
Since we stopped using alloc_temp to get hw indices for FP attrs
there shouldn't be any non-deallocated temps left.
2009-05-28 16:06:23 +10:00
Christoph Bumiller
7ab96f4f73 nv50: release hw TEMPs early
Since we know when we don't use a TEMP or FP ATTR register anymore,
we can release their hw resources early.
2009-05-28 16:06:23 +10:00
Christoph Bumiller
708c711f83 nv50: allow immediates for MOV, ADD and MUL
Immediates are inlined now where possible, so we need to set
pc->allow32 to FALSE in LIT where we have the conditional MOV,
since immediates swallow the predicate bits.
2009-05-28 16:06:22 +10:00
Christoph Bumiller
d015cba88f nv50: enable half insns for MOV and MUL 2009-05-28 16:06:22 +10:00
Christoph Bumiller
44b3bfaa75 nv50: make sure half-long insns are paired
I chose to just convert unpaired 32 bit length instructions
after parsing all instructions, although it might be possible
to determine beforehand whether there would be any lone ones,
and then even do some swapping to bring them together ...
2009-05-28 16:06:21 +10:00
Christoph Bumiller
de651a228f nv50: enable KIL in register 19a8 2009-05-28 16:06:21 +10:00
Christoph Bumiller
dac709d0cf nv50: don't overwrite sources before they're used
This would have happened in p.e. ADD TEMP[0], TEMP[0].xyxy, TEMP[1]
or RCP/RSQ TEMP[i], TEMP[i].
2009-05-28 16:06:21 +10:00
Christoph Bumiller
f579a99cc6 nv50: put FP outputs where they belong
Depth output in fragment programs should end up in the first
register after the color outputs.
2009-05-28 16:06:20 +10:00
Christoph Bumiller
dd9ded42b9 nv50: modified FP attribute loading
VP outputs that should be loadable in the FP are mapped to
interpolant indices by HPOS, COL0 etc.; of course HPOS is
always written, so the highest byte of 1988 is a bitmask that
selects which components of HPOS are used for interpolants,
i.e. the FP inputs in COL0 start at index POPCNT(1988[24:28]).
2009-05-28 16:06:19 +10:00
Christoph Bumiller
e88ec312df nv50: inspect decl semantic and interpolation mode
Record interpolation mode for attributes while parsing declarations,
and also remember the indices of FP color inputs and FP depth output,
which has to end up in the highest output register.
2009-05-28 16:06:19 +10:00
Christoph Bumiller
bcecb8ff66 nv50: record last access to temp and attr regs
We now inspect the TGSI instructions in tx_prep to determine where
temps and FP attrs are last accessed.
This will enable us to reclaim some temporaries early and we also
use it to omit pre-loading FP attributes that aren't used.
2009-05-28 16:06:18 +10:00
Christoph Bumiller
7e7d3a87ec nv50: save some space in immediate buffer
We could do even better (like just allocating 1 value in alloc_immd),
but that's fine for now I guess.
2009-05-28 16:06:18 +10:00
Christoph Bumiller
aad31d69ce nv50: fix SIGN_SET case in tgsi_src 2009-05-28 16:06:17 +10:00
Christoph Bumiller
4a7cf8f66f nv50: set dst.z,w to 0,1 in SCS and XPD
According to tgsi-instruction-set.txt, if they are written, z and w
should be set to 0 and 1 respectively in SCS, and w to 1.0 in XPD.
2009-05-28 16:06:17 +10:00
Christoph Bumiller
229992d281 nv50: make LRP instruction nicer 2009-05-28 16:06:17 +10:00
Christoph Bumiller
9417582f39 nv50: fix some memory leaks in shader assembler 2009-05-28 16:06:16 +10:00
Ben Skeggs
65e3fb7b46 nouveau: explicitly request mappable buffers for the moment 2009-05-28 16:06:16 +10:00
Mike Kaplinksiy
713b636a0e draw: Fix assertion failure at fetch_emit_prepare 2009-05-27 22:53:59 -07:00
Brian Paul
5be48307d5 demos: remove some old debug/test code 2009-05-27 19:37:32 -06:00
Brian Paul
b86067c610 softpipe: comments 2009-05-27 19:36:59 -06:00
Brian Paul
31deacb8d3 softpipe: include sp_winsys.h to silence warning (unprototyped function) 2009-05-27 19:30:07 -06:00
Brian Paul
5d75124db4 softpipe: fix flat shading provoking vertex for PIPE_PRIM_POLYGON
Use the first vertex, not the last.
2009-05-27 19:27:31 -06:00
Brian Paul
c13bd74885 st/mesa: init Format field of vertex arrays for feedback mode
Fixes segfault in glRasterPos()
2009-05-27 19:24:09 -06:00
Jerome Glisse
3a6dd3ebb3 radeon: emit scissor before emiting vertices 2009-05-27 21:50:03 +02:00
Jerome Glisse
6141c9ba71 radeon: emit scissor when using cs submission style. 2009-05-27 09:36:07 +02:00
Eric Anholt
8ec6e03679 i915: Fall back on NPOT textured metaops on 830-class. 2009-05-26 20:50:54 -07:00
Eric Anholt
0e83e8f51a i915: Restore the Viewport and DepthRange functions on 8xx.
Fixes failed viewport updates on glxgears (and other apps) resize since
e41780fedc.

Bug #20473.
2009-05-26 19:50:23 -07:00
Chris Wilson
9178b31546 intel: Override MaxRenderbufferSize with hardware constraints
Limit the maximum renderbuffer size to 8192 on i965 and to 2048 on
earlier hardware.
2009-05-26 15:51:33 -07:00
Alex Deucher
98bc311717 enable surface sync function
- needs to be more fine-grained
2009-05-26 14:30:26 -04:00
Alex Deucher
f3eaba017c r6xx: fix more r6xx specific cases 2009-05-26 12:21:54 -04:00
Alex Deucher
930b42693e R6xx: select proper shader format 2009-05-26 11:36:55 -04:00
Alex Deucher
17417fc8ee fix segfault when running glxinfo 2009-05-26 11:13:44 -04:00
Alex Deucher
4a28974cf5 add missing RS780 pci id 2009-05-26 10:44:44 -04:00
Alex Deucher
ced2f1b94c fix build when HAVE_LIBDRM_RADEON is defined 2009-05-26 10:33:23 -04:00
Jerome Glisse
9dee2f20a2 radeon: on update drawable don't firevertices as it might be call from GetLock
To avoid locking bug we shouldn't not call firevertices from this path
as it's call from radeon get lock.
2009-05-25 16:05:45 +02:00
Jerome Glisse
714f5e689f r200: emit scissor when dri2 is enabled
In DRI1 kernel emit scissor but in dri2 cs path we have to
explicitly program them.
2009-05-25 15:47:39 +02:00
Jerome Glisse
39ef33708c r200: fix multitexturing in dri2 path 2009-05-25 13:17:22 +02:00
Timo Aaltonen
99b4daf5e1 Disable EGL.
Update the changelog too.
2009-05-25 12:47:02 +03:00
Jerome Glisse
80f1ac87f2 r200: emit cliprect with indexed primitive 2009-05-25 11:29:32 +02:00
Jerome Glisse
9b1efcb87c radeon: realloc dma if needed after revalidate
Revalidate can trigger flushing and dma buffer deallocation,
so retry allocation on such case.
2009-05-24 16:24:53 +02:00
Nicolai Hähnle
7dd184dc4d radeon: Remove drawable & readable from radeon_dri_mirror
The duplication of state data caused a crash due to double-free on destruction
of context, because a variable wasn't correctly null'ed out.

Signed-off-by: Nicolai Hähnle <nhaehnle@gmail.com>
2009-05-24 15:41:53 +02:00
Brian Paul
2d30dafadd mesa: fix warning message in vbo_exec_DrawRangeElements() 2009-05-22 15:49:38 -06:00
Jerome Glisse
434f920042 radeon: reading back to scratch reg through status map doesn't work
For some unknown reasons the scratch reg value doesn't endup in the status
map at the scratch reg offset, this is a temporary work around until we
figure out why it doesn't work.
2009-05-22 23:44:44 +02:00
Brian Paul
68d412f31c mesa: add missing update_min() call in update_arrays() 2009-05-22 15:35:49 -06:00
Brian Paul
2ead49f98b mesa: reduce gl_array_object::VertexAttrib[] array from 32 to 16 elements
This array was mistakenly dimensioned with VERT_ATTRIB_MAX (32) but it
should really be MAX_VERTEX_GENERIC_ATTRIBS (16).

The generic vertex attributes are in addition to the conventional arrays
(except in NV vertex program mode- they alias/overlay in that case) so
the total of all conventional attributes plus generic attributes should
total 32 (not 48).
2009-05-22 14:57:51 -06:00
Brian Paul
8e3f6c0f96 mesa: use Elements() for loop limit 2009-05-22 14:42:26 -06:00
Brian Paul
842b4cd3cd mesa: use Elements() for loop limit 2009-05-22 14:32:45 -06:00
Brian Paul
ce7a049191 mesa: use Elements() for loop limit 2009-05-22 14:32:37 -06:00
Brian Paul
8091aa8633 mesa: use Elements() for loop limit 2009-05-22 14:28:24 -06:00
Brian Paul
2a3d118a8e mesa: use Elements() for loop limit 2009-05-22 14:27:42 -06:00
Brian Paul
180df4d328 mesa: simplify adjust_buffer_object_ref_counts() 2009-05-22 14:27:26 -06:00
Brian Paul
bf4dfd6563 mesa: minor code clean-up 2009-05-22 14:24:21 -06:00
Brian Paul
d30163ad42 mesa: use Elements() for loop limit 2009-05-22 14:23:02 -06:00
Brian Paul
b625fbaef2 vbo: s/32/VERT_ATTRIB_MAX/ 2009-05-22 14:22:40 -06:00
Brian Paul
ebb991ca0d mesa: use Elements() for loop bound 2009-05-22 14:16:00 -06:00
Brian Paul
a65f385b8d mesa: minor code simplification 2009-05-22 14:14:53 -06:00
Brian Paul
fac334e6d3 Merge branch 'mesa_7_5_branch' 2009-05-22 14:09:35 -06:00
Brian Paul
4b55e36952 vbo: asst. reformatting, clean-ups 2009-05-22 13:44:59 -06:00
Brian Paul
9be72f54ac Merge branch 'mesa_7_5_branch' 2009-05-22 13:21:23 -06:00
Brian Paul
506d340363 demos: fix multitex.c VertCoord attribute mapping
If the multitex.vert shader uses the VertCoord generic vertex attribute
instead of the pre-defined gl_Vertex attribute, we need to make sure that
VertCoord gets bound to generic vertex attribute zero.

That's because we need to call glVertexAttrib2fv(0, xy) after all the other
vertex attributes have been set since setting generic attribute 0 triggers
vertex submission.  Before, we wound up issuing the vertex attributes in
the order 0, 1, 2 which caused the first vertex to be submitted before all
the attributes were set.  Now, the attributes are set in 1, 2, 0 order.

(cherry picked from commit 58fadc6242)
2009-05-22 13:20:48 -06:00
Brian Paul
9dbe32f5eb vbo: fix crash in vbo_exec_bind_arrays()
When a vertex shader uses generic vertex attribute 0, but not gl_Vertex,
we need to set attribute[16] to point to attribute[0].  We were setting the
attribute size, but not the pointer.

Fixes crash in glsl/multitex.c when using the VertCoord attribute instead
of gl_Vertex.

(cherry picked from commit c3538969e1)
2009-05-22 13:19:42 -06:00
Brian Paul
891a2bdd7d demos: extend glsl/multitex.c to use a vertex buffer object 2009-05-22 13:12:28 -06:00
Brian Paul
96370113f1 demos/util: add funcs for GL_ARB_buffer_object 2009-05-22 13:12:01 -06:00
Brian Paul
1b3f5df1e0 Merge branch 'mesa_7_5_branch' 2009-05-22 09:40:50 -06:00
Brian Paul
9adca8814d mesa: allow GL_BITMAP type in _mesa_image_image_stride()
It's possible to hand a GL_COLOR_INDEX/GL_BITMAP image to glTexImage3D()
which gets converted to RGBA via the glPixelMap tables.

This fixes a failure with piglit/fdo10370 with Gallium.

(cherry picked from commit 995456f930)
2009-05-22 09:38:18 -06:00
Brian Paul
a545f1ab6d mesa: added some assertions 2009-05-22 07:51:35 -06:00
Brian Paul
42ae2a8648 mesa: use Elements() macro to limit loops instead of constants 2009-05-22 07:51:13 -06:00
Brian Paul
882cd6c839 mesa: remove MAX_VERTEX_PROGRAM_ATTRIBS
Use MAX_VERTEX_GENERIC_ATTRIBS instead.  No need for two #defines for
the same quantity.
2009-05-22 07:30:05 -06:00
Brian Paul
4a95185c9f mesa: rename MAX_VERTEX_ATTRIBS to MAX_VERTEX_GENERIC_ATTRIBS
Be clearer that this is the number of generic vertex program/shader
attributes, not counting the legacy attributes (pos, normal, color, etc).
2009-05-22 07:26:08 -06:00
Brian Paul
4dc426c016 mesa: s/MAX_VERTEX_PROGRAM_ATTRIBS/MAX_NV_VERTEX_PROGRAM_INPUTS/ in NV funcs 2009-05-22 07:19:27 -06:00
Brian Paul
8125c5ce92 docs: updates for version 7.4.3 2009-05-22 07:13:47 -06:00
Brian Paul
ba3f8dc0aa mesa: bump version to 7.4.3 2009-05-22 07:13:34 -06:00
Brian Paul
85cf1675d4 mesa: bump version to 7.4.3 2009-05-22 07:13:30 -06:00
Brian Paul
3aeace2928 vbo: fix incorrect loop limit in bind_array_obj()
The generic_array[] is 16 elements in size, but the loop was doing 32
iterations.  The out of bounds array write was clobbering the following
inputs[] array but as luck would have it, that didn't matter.

(cherry picked from commit 8da09e6924)
2009-05-22 07:10:47 -06:00
Brian Paul
0edb61afef docs: add glGet case for GL_VERTEX_ARRAY_BINDING_APPLE 2009-05-22 07:08:38 -06:00
Brian Paul
accffe2b73 mesa: add missing glGet*() case for GL_VERTEX_ARRAY_BINDING_APPLE
(cherry picked from commit 70c4b81e88)
2009-05-22 07:07:38 -06:00
Brian Paul
8b91778f46 vbo: fix build breakage...oops 2009-05-21 17:07:33 -06:00
Brian Paul
3bfe312d01 vbo: comments, whitespace clean-ups 2009-05-21 17:03:52 -06:00
Brian Paul
d2a74d76c9 mesa: s/MAX_VERTEX_PROGRAM_ATTRIBS/MAX_NV_VERTEX_PROGRAM_INPUTS 2009-05-21 17:03:21 -06:00
Brian Paul
7e2fb12981 Merge branch 'mesa_7_5_branch' 2009-05-21 16:57:28 -06:00
Brian Paul
54a5ffbfa1 mesa: freshen comments for update_array() 2009-05-21 16:10:45 -06:00
Brian Paul
667a4037fa mesa: minor code simplification in _mesa_GetVertexAttrib*NV() 2009-05-21 16:10:45 -06:00
Brian Paul
024de60348 mesa: comment for _mesa_GetVertexAttribfvARB() 2009-05-21 16:10:45 -06:00
Brian Paul
254845fad0 mesa: minor code simplification in _mesa_GetVertexAttribfvARB() 2009-05-21 16:10:45 -06:00
Brian Paul
6a2211f000 mesa: remove const qualifier 2009-05-21 16:10:45 -06:00
Brian Paul
a554d7c4d8 mesa: VertexAttribPointer comments 2009-05-21 16:10:45 -06:00
Brian Paul
8fe3134622 mesa: call _mesa_update_array_object_max_element() before printing array info 2009-05-21 16:10:45 -06:00
Brian Paul
8fa0cb2b42 mesa: added gl_array_object::Weight array field
We don't really implement vertex weights but in the VBO code this
fixes and odd case for the legacy_array[] setup.  Before, the
vbo->draw_prims() call was always indicating that the vertex weight
array was present/enabled when it really wasn't.
2009-05-21 16:10:45 -06:00
Brian Paul
1889890c88 mesa: check FEATURE_point_size_array for PointSize array 2009-05-21 16:10:45 -06:00
Brian Paul
aac19609bf mesa: fix some potential state-restore issues in pop_texture_group()
Call the _mesa_set_enable() functions instead of driver functions, etc.

Also, add missing code for 1D/2D texture arrays.
2009-05-21 16:10:45 -06:00
Brian Paul
de1cfc5e8a mesa: new _mesa_update_array_object_max_element() function
This will replace the code in state.c
2009-05-21 16:10:45 -06:00
Brian Paul
dda82137d2 vbo: return VP_NONE from get_program_mode() if running fixed-func vertex program
If we're running a vertex program to emulated fixed-function, we still need
to treat vertex arrays/attributes as if we're in fixed-function mode.

This should probably be back-ported to Mesa 7.5 after a bit more testing.
2009-05-21 16:10:45 -06:00
Brian Paul
a1f6f82e82 vbo: move vp_mode enum to vbo_exec.h, use enum instead of GLuint 2009-05-21 16:10:45 -06:00
Alex Deucher
b52cdb81e2 r6xx/r7xx: fix segfault in vertex shader setup 2009-05-21 17:40:27 -04:00
Alex Deucher
1b84d228d5 r6xx: fix count on START_3D packet 2009-05-21 17:38:14 -04:00
Eric Anholt
bd0861e274 i965: fix whitespace in brw_tex_layout.c
The broken indentation was driving me crazy, so fix other stuff while
I'm here.
2009-05-21 10:41:49 -07:00
Eric Anholt
3a521d84ec i956: Make state dependency of SF on drawbuffer bounds match Mesa's.
Noticed while debugging a weird 1D FBO testcase that left its existing
viewport and projection matrix in place when switching drawbuffers.  Didn't
fix the testcase, though.
2009-05-21 10:41:39 -07:00
Eric Anholt
e78a6aa2b9 intel: Fall back on any rendering to texture with no miptree.
Fixes segfault on an fbo.c negative test for FBO with texture width/height
of 0.  Previously we just tested for border != 0 to work around this
segfault.
2009-05-21 10:40:11 -07:00
Eric Anholt
8bba183b9e intel: Mark the FBO as incomplete if there's no intel_renderbuffer for it.
This happens to rendering with textures with a border, which had resulted
in a segfault on dereferencing the irb.
2009-05-21 10:40:11 -07:00
Eric Anholt
467f18f7a5 intel: Don't segfault on glGenerateMipmaps of a cube map with one face defined.
This presumably applies to SGIS_generate_mipmaps as well.
2009-05-21 10:40:11 -07:00
Eric Anholt
4da58bbab0 intel: Use _mesa_CheckFramebufferStatusEXT insteaad of glCheck...
Fixes a segfault in our oglconform fbo test.
2009-05-21 10:40:11 -07:00
Brian Paul
02f73c43b4 mesa: added debug functions for dumping color/depth/stencil buffers 2009-05-21 09:17:09 -06:00
Brian Paul
840c09fc71 i965: rename var: s/tmp/vs_inputs/ 2009-05-21 09:17:09 -06:00
Brian Paul
f7ca97f85e mesa: remove pointless null ptr check, improved some error messages 2009-05-21 09:17:09 -06:00
Brian Paul
39d7524f7b mesa: added _mesa_print_arrays() for debugging 2009-05-21 09:17:09 -06:00
Brian Paul
15f21bf357 mesa: updated comment for _MaxElement field
It's the largest array index, plus one.
2009-05-21 09:17:09 -06:00
Brian Paul
a185bcbdec mesa: move gl_array_attrib::_MaxElement to gl_array_object::_MaxElement
This value is per array object.
2009-05-21 09:17:08 -06:00
Brian Paul
899c524a49 vbo: s/8/MAX_TEXTURE_COORD_UNITS/ 2009-05-21 09:17:08 -06:00
Jonathan Adamczewski
2c007517b5 cell: perform triangle cull a little earlier
In spu_tri.c:setup_sort_vertices() triangles are culled after the
vertices are sorted.  This patch moves the check a little earlier
and performs the actual check a little faster through intrinsics and
a little trickery.

Reduced code size and less work is done before a triangle is deemed
OK to skip.
2009-05-21 08:19:00 -06:00
Jonathan Adamczewski
b4824520ec cell: unroll inner loop of spu_render.c:cmd_render()
It was taking approximately 50 cycles to extract the vertex indices,
calculate the vertex_header pointers and call tri_draw() for each
three vertices - .

Unrolled, it takes less than 100 cycles to extract, unpack,
calculate pointers and call tri_draw() eight times.  It does have a
nasty jump-tabled switch.  I'm sure that there's a better way...

Code size of spu_render.o gets larger due to the extra constants and
work in the inner loop, there are extra stack saves and loads
because there are more registers in use, and an assert.  spu_tri.o
gets a little smaller.
2009-05-21 08:18:03 -06:00
Brian Paul
5b27b4ad37 st: add support for GL_EXT_vertex_array_bgra 2009-05-21 08:15:54 -06:00
Jerome Glisse
d7cc0eb479 radeon: maxbuffer size is in bytes 2009-05-21 13:49:15 +02:00
Corbin Simpson
3af0952bc9 r300-gallium: r500-fs: POW.
I feel so unclean.
2009-05-20 23:22:16 -07:00
Corbin Simpson
cfd241e8a6 r300-gallium: r500-fs: LRP.
Goddammit. This cannot be the "easy way." :C
2009-05-20 21:52:11 -07:00
Corbin Simpson
f1f0893eba r300-gallium: r500-fs: Combine function. 2009-05-20 16:53:45 -07:00
Corbin Simpson
d67fb5ea1d r300-gallium: Prevent assert when fogcoords are present.
Seems like this file is the source of all bad logic. (Pun intended.)
2009-05-20 16:05:11 -07:00
Corbin Simpson
d04c85d01b r300-gallium: Another constantbuf shader recompile test.
Less briefly... Shaders need to be recompiled if their constantbuf
offsets have changed. However, since we only change them from shaders if
immediates need to be emitted, we shouldn't bother if the shader doesn't
use immediates.
2009-05-20 14:55:03 -07:00
Corbin Simpson
4151c0ea91 r300-gallium: Raise constantbuf limits.
Still not correct, but really I don't care.
2009-05-20 14:38:22 -07:00
Corbin Simpson
364a4a8293 r300-gallium: fs: Remove cruft from way back when. 2009-05-20 14:17:27 -07:00
Corbin Simpson
0ba7f76233 radeon-gallium: Add surface_buffer_create callback. 2009-05-20 13:21:17 -07:00
Jerome Glisse
a13e96359b r200: fix vbo array rendering 2009-05-20 22:19:40 +02:00
Corbin Simpson
9e8de1b911 r300-gallium: Make surface_copy actually load the texture in shader. 2009-05-20 12:22:24 -07:00
Corbin Simpson
b22b6f0743 r300-gallium: Add missing R481 PCI ID.
Per 74cb2aba on xf86-video-ati.
2009-05-20 12:08:00 -07:00
Corbin Simpson
65946ef081 r300-gallium: Make surface_copy work, and refactor buffer validation. 2009-05-20 11:46:26 -07:00
Michel Dänzer
01daeadf8c radeon: Increase reference count of current renderbuffers.
Fixes

glxinfo: main/renderbuffer.c:2159: _mesa_reference_renderbuffer: Assertion
`oldRb->Magic == 0xaabbccdd' failed.
2009-05-20 17:00:57 +02:00
Michel Dänzer
b9bd1abf26 Merge branch 'master' into radeon-rewrite
Conflicts:
	src/mesa/drivers/dri/r300/r300_context.c
	src/mesa/drivers/dri/r300/r300_texstate.c
2009-05-20 17:00:48 +02:00
Jerome Glisse
c696dd0f62 radeon: set max texture size
This still need some work to actually report somethings reasonable
if no memory manager is available.
2009-05-20 16:34:06 +02:00
Corbin Simpson
4550423211 radeon-gallium: Don't permit reading and writing a BO in one CS.
This fixes some silent problems in current libdrm_radeon.

surface_copy still locks up hard.
2009-05-20 07:18:08 -07:00
Brian Paul
35f5222ae0 mesa: remove texUnit->_Current = NULL assignment
A follow-on to commit 46a2aad2cf which
fixes a texture object memory leak.

See bug 21756.
2009-05-20 08:14:45 -06:00
root
c28e0e7d97 Add missing file from local. 2009-05-20 09:16:21 -04:00
Jerome Glisse
8308bf9ee1 r200: fix indexed draw color order and cs missmatch 2009-05-20 13:21:24 +02:00
Brian Paul
0c75cb5afe st: reformatting, comments, var renaming 2009-05-19 20:05:28 -06:00
root
3149b87ac4 Makeup checkin for radeon code change paired with r6/7 code. 2009-05-19 16:47:39 -04:00
Brian Paul
d0eccc4187 Merge branch 'mesa_7_5_branch' 2009-05-19 10:07:45 -06:00
Brian Paul
1096a6c579 docs: 7.4.3 relnotes edits 2009-05-19 10:06:58 -06:00
Brian Paul
1eb59f49a4 docs: start 7.4.3 release notes 2009-05-19 10:06:09 -06:00
Brian Paul
63d1e89138 mesa: allow depth/stencil textures to be attached to GL_STENCIL_ATTACHMENT
See sourceforge bug #2793846.

(cherry picked from commit 042d9a5132)
2009-05-19 10:04:17 -06:00
Brian Paul
3ed7e9bfcc mesa: assign trb->Base.StencilBits in update_wrapper().
When we render to a depth/stencil texture there are stencil bits.

(cherry picked from commit c99a60c40d)
2009-05-19 10:02:55 -06:00
Brian Paul
43d8ace88d mesa: print more info when valid_texture_object() fails 2009-05-19 09:21:39 -06:00
Brian Paul
46a2aad2cf mesa: fix texture object reference counting in texture_override()
Fixes bug 21756: r200: Mesa-7.4.2 release regression: "Quit on exit".
2009-05-19 09:03:19 -06:00
Richard Li
465588cd0e Fix nop insertion bug. redbook hello can run. 2009-05-19 10:28:40 -04:00
Jakob Bornecrantz
bd59dd69ba trace: Improve shader wrapping 2009-05-18 20:54:09 +01:00
Jakob Bornecrantz
7d11a392d7 st/dri: Only create new textures if drawable has changed 2009-05-18 20:54:09 +01:00
Corbin Simpson
d0639d067e r300-gallium: Fix (another) wrong value in MSPOS.
Again, thanks to agd5f.
2009-05-18 09:51:10 -07:00
Corbin Simpson
026f4c97dc radeon-gallium: Remove BO validation debug.
It appears that that area of code "just works" much like classic Mesa's
version, so might as well not waste scrollback on it.
2009-05-18 09:51:10 -07:00
Corbin Simpson
5236ea3900 r300-gallium: Cleanup viewport state setup. 2009-05-18 09:51:09 -07:00
Corbin Simpson
301d238c1a r300-gallium: Always do VTE, never software viewport.
This makes glxgears draw properly with SW TCL.
2009-05-18 09:51:09 -07:00
Brian Paul
edfbf7dccb Merge branch 'mesa_7_5_branch'
Conflicts:

	Makefile
	src/mesa/main/version.h
2009-05-18 10:36:50 -06:00
Timo Aaltonen
73670d56e8 Merge branch 'debian-experimental' into test
Conflicts:
	Makefile
	configs/default
	docs/download.html
	docs/news.html
	docs/relnotes-7.4.2.html
	doxygen/.gitignore
	include/GL/internal/dri_interface.h
	include/GLES/egl.h
	progs/demos/Windows/all.dsp
	progs/demos/Windows/bounce.dsp
	progs/demos/Windows/clearspd.dsp
	progs/demos/Windows/cubemap.dsp
	progs/demos/Windows/demos.dsw
	progs/demos/Windows/drawpix.dsp
	progs/demos/Windows/fire.dsp
	progs/demos/Windows/gears.dsp
	progs/demos/Windows/geartrain.dsp
	progs/demos/Windows/glinfo.dsp
	progs/demos/Windows/gloss.dsp
	progs/demos/Windows/gltestperf.dsp
	progs/demos/Windows/glutfx.dsp
	progs/demos/Windows/ipers.dsp
	progs/demos/Windows/isosurf.dsp
	progs/demos/Windows/loadbias.dsp
	progs/demos/Windows/morph3d.dsp
	progs/demos/Windows/multiarb.dsp
	progs/demos/Windows/occlude.dsp
	progs/demos/Windows/osdemo.dsp
	progs/demos/Windows/paltex.dsp
	progs/demos/Windows/pixeltex.dsp
	progs/demos/Windows/pointblast.dsp
	progs/demos/Windows/rain.dsp
	progs/demos/Windows/ray.dsp
	progs/demos/Windows/readpix.dsp
	progs/demos/Windows/reflect.dsp
	progs/demos/Windows/renormal.dsp
	progs/demos/Windows/shadowtex.dsp
	progs/demos/Windows/spectex.dsp
	progs/demos/Windows/spriteblast.dsp
	progs/demos/Windows/stex3d.dsp
	progs/demos/Windows/teapot.dsp
	progs/demos/Windows/terrain.dsp
	progs/demos/Windows/tessdemo.dsp
	progs/demos/Windows/texcyl.dsp
	progs/demos/Windows/texdown.dsp
	progs/demos/Windows/texenv.dsp
	progs/demos/Windows/texobj.dsp
	progs/demos/Windows/trispd.dsp
	progs/demos/Windows/tunnel.dsp
	progs/demos/Windows/tunnel2.dsp
	progs/demos/Windows/winpos.dsp
	progs/demos/dinoshade.c
	progs/demos/projtex.c
	progs/egl/Makefile
	progs/egl/demo1.c
	progs/egl/demo2.c
	progs/egl/demo3.c
	progs/egl/eglgears.c
	progs/egl/eglinfo.c
	progs/fp/.gitignore
	progs/fp/Makefile
	progs/miniglx/Makefile
	progs/redbook/Windows/redbook.dsw
	progs/redbook/Windows/teapots.dsp
	progs/slang/windows/vc60/cltest.dsp
	progs/slang/windows/vc60/framework.dsp
	progs/slang/windows/vc60/slang.dsw
	progs/slang/windows/vc60/sotest.dsp
	progs/slang/windows/vc60/vstest.dsp
	progs/tests/.gitignore
	progs/tests/Makefile
	progs/tests/afsmultiarb.c
	progs/tests/antialias.c
	progs/tests/api_speed.c
	progs/tests/arbfpspec.c
	progs/tests/arbfptest1.c
	progs/tests/arbfptexture.c
	progs/tests/arbfptrig.c
	progs/tests/arbnpot-mipmap.c
	progs/tests/arbnpot.c
	progs/tests/arbvptest1.c
	progs/tests/arbvptest3.c
	progs/tests/arbvptorus.c
	progs/tests/arbvpwarpmesh.c
	progs/tests/arraytexture.c
	progs/tests/blendminmax.c
	progs/tests/blendsquare.c
	progs/tests/blendxor.c
	progs/tests/bufferobj.c
	progs/tests/bug_3050.c
	progs/tests/bug_3101.c
	progs/tests/bug_3195.c
	progs/tests/copypixrate.c
	progs/tests/crossbar.c
	progs/tests/cva.c
	progs/tests/debugger.c
	progs/tests/drawbuffers.c
	progs/tests/exactrast.c
	progs/tests/ext422square.c
	progs/tests/fbotest1.c
	progs/tests/fbotest2.c
	progs/tests/floattex.c
	progs/tests/fog.c
	progs/tests/fogcoord.c
	progs/tests/fptest1.c
	progs/tests/fptexture.c
	progs/tests/interleave.c
	progs/tests/invert.c
	progs/tests/jkrahntest.c
	progs/tests/lineclip.c
	progs/tests/manytex.c
	progs/tests/minmag.c
	progs/tests/mipmap_limits.c
	progs/tests/multipal.c
	progs/tests/multitexarray.c
	progs/tests/multiwindow.c
	progs/tests/no_s3tc.c
	progs/tests/packedpixels.c
	progs/tests/pbo.c
	progs/tests/prog_parameter.c
	progs/tests/random.c
	progs/tests/readrate.c
	progs/tests/rubberband.c
	progs/tests/seccolor.c
	progs/tests/shader_api.c
	progs/tests/stencil_twoside.c
	progs/tests/stencil_wrap.c
	progs/tests/stencilwrap.c
	progs/tests/subtexrate.c
	progs/tests/tex1d.c
	progs/tests/texcmp.c
	progs/tests/texcompress2.c
	progs/tests/texfilt.c
	progs/tests/texgenmix.c
	progs/tests/texline.c
	progs/tests/texrect.c
	progs/tests/texwrap.c
	progs/tests/unfilledclip.c
	progs/tests/vao-01.c
	progs/tests/vao-02.c
	progs/tests/vparray.c
	progs/tests/vpeval.c
	progs/tests/vptest1.c
	progs/tests/vptest2.c
	progs/tests/vptest3.c
	progs/tests/vptorus.c
	progs/tests/vpwarpmesh.c
	progs/tests/yuvrect.c
	progs/tests/yuvsquare.c
	progs/tests/zreaddraw.c
	progs/trivial/.gitignore
	progs/trivial/Makefile
	progs/trivial/clear.c
	progs/trivial/dlist-dangling.c
	progs/trivial/dlist-edgeflag-dangling.c
	progs/trivial/dlist-edgeflag.c
	progs/trivial/drawarrays.c
	progs/trivial/drawelements.c
	progs/trivial/drawrange.c
	progs/trivial/line-clip.c
	progs/trivial/line-cull.c
	progs/trivial/line-userclip-clip.c
	progs/trivial/line-userclip-nop-clip.c
	progs/trivial/line-userclip-nop.c
	progs/trivial/line-userclip.c
	progs/trivial/line.c
	progs/trivial/lineloop-clip.c
	progs/trivial/lineloop.c
	progs/trivial/point-clip.c
	progs/trivial/point-param.c
	progs/trivial/point-wide.c
	progs/trivial/point.c
	progs/trivial/poly-flat.c
	progs/trivial/poly-unfilled.c
	progs/trivial/poly.c
	progs/trivial/quad-clip-all-vertices.c
	progs/trivial/quad-clip-nearplane.c
	progs/trivial/quad-clip.c
	progs/trivial/quad-degenerate.c
	progs/trivial/quad-flat.c
	progs/trivial/quad-offset-factor.c
	progs/trivial/quad-offset-unfilled.c
	progs/trivial/quad-offset-units.c
	progs/trivial/quad-tex-2d.c
	progs/trivial/quad-tex-3d.c
	progs/trivial/quad-tex-pbo.c
	progs/trivial/quad-unfilled.c
	progs/trivial/quad.c
	progs/trivial/quads.c
	progs/trivial/quadstrip-flat.c
	progs/trivial/quadstrip.c
	progs/trivial/tri-blend.c
	progs/trivial/tri-clip.c
	progs/trivial/tri-cull.c
	progs/trivial/tri-dlist.c
	progs/trivial/tri-edgeflag.c
	progs/trivial/tri-flat-clip.c
	progs/trivial/tri-flat.c
	progs/trivial/tri-tex-3d.c
	progs/trivial/tri-unfilled-clip.c
	progs/trivial/tri-unfilled-smooth.c
	progs/trivial/tri-unfilled-userclip.c
	progs/trivial/tri-unfilled.c
	progs/trivial/tri-userclip.c
	progs/trivial/tri.c
	progs/trivial/tristrip-clip.c
	progs/trivial/tristrip.c
	progs/trivial/vbo-drawarrays.c
	progs/trivial/vbo-drawelements.c
	progs/trivial/vbo-drawrange.c
	progs/trivial/vp-array.c
	progs/trivial/vp-clip.c
	progs/trivial/vp-line-clip.c
	progs/trivial/vp-tri.c
	progs/trivial/vp-unfilled.c
	progs/vp/Makefile
	progs/vp/vp-tris.c
	src/egl/Makefile
	src/egl/drivers/demo/Makefile
	src/egl/drivers/demo/demo.c
	src/egl/drivers/dri/Makefile
	src/egl/drivers/dri/egldri.c
	src/egl/drivers/dri/egldri.h
	src/egl/main/Makefile
	src/egl/main/eglapi.c
	src/egl/main/eglapi.h
	src/egl/main/eglconfig.c
	src/egl/main/eglconfig.h
	src/egl/main/eglcontext.c
	src/egl/main/eglcontext.h
	src/egl/main/egldisplay.c
	src/egl/main/egldisplay.h
	src/egl/main/egldriver.c
	src/egl/main/egldriver.h
	src/egl/main/eglglobals.c
	src/egl/main/eglglobals.h
	src/egl/main/egllog.c
	src/egl/main/eglmode.h
	src/egl/main/eglsurface.c
	src/egl/main/eglsurface.h
	src/egl/main/egltypedefs.h
	src/glx/mini/Makefile
	src/glx/x11/dri2_glx.c
	src/mesa/drivers/allegro/amesa.c
	src/mesa/drivers/dri/intel/intel_buffers.c
	src/mesa/drivers/dri/intel/intel_clear.c
	src/mesa/drivers/dri/intel/intel_context.c
	src/mesa/drivers/dri/intel/intel_pixel.c
	src/mesa/drivers/dri/r300/r300_texstate.c
	src/mesa/drivers/dri/radeon/radeon_screen.c
	src/mesa/drivers/windows/gldirect/dx7/gld_wgl_dx7.c
	src/mesa/drivers/windows/gldirect/dx8/gld_wgl_dx8.c
	src/mesa/drivers/windows/gldirect/dx9/gld_wgl_dx9.c
	src/mesa/main/glheader.h
	src/mesa/main/light.c
	src/mesa/main/teximage.c
	src/mesa/main/texparam.c
	src/mesa/main/version.h
	src/mesa/swrast/s_texfilter.c
2009-05-18 14:05:53 +03:00
Aidan Thornton
b5eafa2d51 Initialize psp->waitX/waitGL for swrast_dri.so.
Fixes http://bugs.freedesktop.org/show_bug.cgi?id=21053 .
(cherry picked from commit f2445dfd85)
2009-05-18 12:51:12 +02:00
Timo Aaltonen
ac00f6a47a Merge commit 'mesa_7_4' into test 2009-05-18 13:21:01 +03:00
Jerome Glisse
d039cf4574 radeon: fix DRI1 cmd stream 2009-05-18 10:13:57 +02:00
Corbin Simpson
27206add27 r300-gallium: Enable GLSL for r500.
Before you get all excited, this is *not* to be construed as actual support
for GLSL shaders. The GL version is still 1.3, and stuff still sucks. Just
flicking it on so that it can be tested and developed a bit easier.
2009-05-17 21:41:25 -07:00
Corbin Simpson
9569221563 r300-gallium: r500-fs: DDX and DDY support.
Oh, look, GLSL instructions. I wonder what I'll do next.
2009-05-17 21:40:16 -07:00
Corbin Simpson
0036f2ccba dri-gallium: Add GLSL support.
Oh, look, it's more features. :3
2009-05-17 21:39:11 -07:00
Corbin Simpson
06a7b798f2 r300-gallium: Add half-right COS and SIN.
HW trig does a premultiply by 2pi, where Mesa does another premultiply by pi.
This is a problem.
2009-05-17 21:10:07 -07:00
Corbin Simpson
572d7d1358 r300-gallium: Size mismatch. 2009-05-17 20:49:39 -07:00
Corbin Simpson
6a40d1e9d9 r300-gallium, radeon-gallium: Nuke gb_pipes from orbit.
See the previous commit for an explanation. This is just all the support code
for GB_TILE_CONFIG.
2009-05-17 17:03:15 -07:00
Corbin Simpson
d6e085bd76 r300-gallium: Don't set GB_TILE_CONFIG (in userspace.)
This accompanies kernel patches that make GB_TILE_CONFIG's various members
completely controlled in DRM.

GB_TILE_CONFIG has the following controls:
 - The number of GB (pixel) pipes enabled
 - The size and style of tiling
 - Subpixel precision (either 1/12 or 1/16)

Per airlied and glisse, userspace and kernel will now agree (always) on
a subpixel precision of 1/12, and tiling will always be kernel-controlled.
2009-05-17 16:44:39 -07:00
Corbin Simpson
60665ae627 r300-gallium: Clean up more invariant state.
GA_ENHANCE is now the kernel's problem.
2009-05-17 13:23:39 -07:00
Corbin Simpson
e5f5390f4b r300-gallium: Update XXX.
Lops work fine as long as HW TCL is off. (I think I know why.)
2009-05-17 12:51:18 -07:00
Corbin Simpson
fbcfcd9f5c r300-gallium: Correct default MSPOS.
Per agd5f.
2009-05-17 11:58:53 -07:00
Corbin Simpson
45435abcb9 r300-gallium: vs: Fix vert shader init.
Makes the last three commits suck much less. :3
2009-05-17 10:34:41 -07:00
Corbin Simpson
8dae8f28e5 r300-gallium: r500-fs: Enable depth writes, kinda.
Should work, but doesn't. Hm.
2009-05-17 10:30:59 -07:00
Corbin Simpson
7e97219ff8 r300-gallium: Comment out useless debugging code.
Those parts are nearly solid compared to the shaders.
2009-05-17 09:44:14 -07:00
Corbin Simpson
764bf9501a r300-gallium: vs: Dupe tokens, better debug, count spurious insts. 2009-05-17 09:39:06 -07:00
Corbin Simpson
08ec7e0d32 r300-gallium: Die on bad texture formats.
Odds are good that we'll die later anyway, so we might as well do it before
we start dancing on random memory.
2009-05-16 11:17:05 -07:00
Corbin Simpson
17b395638b r300-gallium: Update floating-point params too.
Even though we *can* render 10,000-pixel-wide lines, let's not advertise it.
2009-05-16 10:56:17 -07:00
Corbin Simpson
13f8e7bc9c r300-gallium: Update screen caps.
Anisotropic filtering should work, and OQ is broken.
2009-05-16 10:46:55 -07:00
Corbin Simpson
0e8c6e56e4 intel-gallium: Fix trace_drm integration.
Compile-tested only, sorry.
2009-05-16 10:07:58 -07:00
Corbin Simpson
5e39a8c450 Create common trace_drm code, add to radeon_winsys. 2009-05-16 10:07:58 -07:00
Corbin Simpson
13131adbf1 r300-gallium: Various cleanups leftover from before.
BEGIN/END_CS pair, a few asserts, and a slightly more correct VTE setup.
2009-05-16 10:07:58 -07:00
Keith Whitwell
57fd202375 gallium: remove occlusion_count flag from depth-stencil state
Drivers can just keep track of whether they are within a query
by monitoring the begin/end query callbacks.  The flag adds no
information beyond that.

Only softpipe was examining this flag -- it has been fixed up
and retested with demos/arbocclude.
2009-05-16 17:26:39 +01:00
Maciej Cencora
73d2a4a047 r300: cleanup vertex program related functions
- move vertex program related functions to r300_vertprog.c
- use _mesa_bitcount instead of self-made bit_count function
- remove duplicated field in r300_vertex_shader_fragment.body union
- rename r300_vertex_shader_fragment to r300_vertex_shader_hw_code
- rename r300_vertex_program field native to error
- remove unnecessary r300_vertex_shader_state structure
- remove unused r300_vertex_program and r300_vertex_program_cont fields
- remove disabled code
2009-05-16 11:42:03 -04:00
Maciej Cencora
1b49f1ca7f r300: minor code movement 2009-05-16 11:42:03 -04:00
Maciej Cencora
f8c30793d1 r300: more cleanup
- remove unnecessary r300TranslateFragmentShader call from r300UpdateShaderStates (it is already called in r300UpdateShaders)
- remove unnecessary null ptr checks
2009-05-16 11:42:03 -04:00
Maciej Cencora
1961caeda8 r300: move some code to common path 2009-05-16 11:42:03 -04:00
Maciej Cencora
12ed56f1dd r300: rename functions
Be consistent with function naming: use Setup/Emit names for functions that modify hardware state
2009-05-16 11:42:03 -04:00
Maciej Cencora
6f1a86ca1e r300: move forward declarations to where they belong 2009-05-16 11:42:02 -04:00
Maciej Cencora
2240c0d333 r300: software fallbacking handling rewrite
Until now falling back to software rasterizer worked only for TCL enabled cards.
For non TCL cards we used to plug our rendering functions in r300InitSwtcl, and we had never restored original functions for software rasterizer.
2009-05-16 11:42:02 -04:00
Maciej Cencora
621f65ab86 r300: r300EmitArrays should never fail 2009-05-16 11:42:02 -04:00
Maciej Cencora
d6da805c4e r300: remove unnecessary switch cases 2009-05-16 11:42:02 -04:00
Maciej Cencora
42f16aa4e0 r300: further cleanup
- move extensions init into seperate function
- move options handling into seperate function
- create new structure to hold options values
- use context->options.hw_tcl_enabled field instead of global hw_tcl_on and future_hw_tcl_on variables
2009-05-16 11:42:02 -04:00
Jakob Bornecrantz
3259f52a92 gallium-intel: Enable trace driver 2009-05-16 01:51:30 +01:00
Jakob Bornecrantz
f04c38fa1f trace: Export enabled status 2009-05-16 01:50:53 +01:00
Jakob Bornecrantz
ee05658798 trace: Unwrap buffer in texture_blanket 2009-05-16 01:50:53 +01:00
Jakob Bornecrantz
ab95f389a5 trace: If either shader is disabled don't draw 2009-05-16 01:50:53 +01:00
Jakob Bornecrantz
3b4da4e9da trace: Put shaders on a list in the context 2009-05-16 01:50:53 +01:00
Jakob Bornecrantz
c30f661189 trace: Move state dump functions to tr_dump_state.[c|h] 2009-05-16 01:50:53 +01:00
Eric Anholt
22690482e6 intel: Don't complain on falling back from PBO fastpaths.
Instead, stash the debug info under the handy debug flag.

Bug #20053
2009-05-15 17:32:21 -07:00
Richard Li
2a7a2c6b77 Fix r6 code bugs. 2009-05-15 19:49:17 -04:00
Eric Anholt
0307e609aa mesa: Mark FBOs with compressed color attachments as FBO-incomplete.
Both EXT_fbo and ARB_fbo agree on this.  Fixes a segfault in the metaops
mipmap generation in Intel for SGIS_generate_mipmap of S3TC textures in
Regnum Online.

Bug #21654.
2009-05-15 16:47:37 -07:00
Jakob Bornecrantz
97ccdee68a gallium-intel: Build with scons 2009-05-15 22:54:07 +01:00
Jakob Bornecrantz
c4538e326a st/egl: Use proper Makefile 2009-05-15 22:52:30 +01:00
Steinar H. Gunderson
b197a8ade3 i915: Fix 945 cube map layout for the small mipmaps along the bottom.
Bug #21691.
2009-05-15 12:50:11 -07:00
Eric Anholt
4c6f829899 i915: Use Stencil.Enabled instead of Stencil._Enabled in DrawBuffers.
The _Enabled field isn't updated at the point that DrawBuffers is called,
and the Driver.Enable() function does the testing for stencil buffer
presence anyway.

bug #21608 for Radeon
2009-05-15 12:45:33 -07:00
Eric Anholt
5c5a468848 i915: Only use the new 945 cube layout for compressed textures.
The docs actually explain this, but not in a terribly clear manner.
This nearly fixes the piglit cubemap testcase, except that something's
going wrong with the nearest filtering at 2x2 sizes in the testcase.
Looks good by visual inspection, though.

Bug #21692
2009-05-15 11:43:39 -07:00
Brian Paul
d1fcb4a263 docs 7.4.2 tarball md5 sums 2009-05-15 06:32:24 -06:00
Brian Paul
da709f163f docs: set 7.4.2 release date 2009-05-15 06:21:56 -06:00
Brian Paul
3a1bcbe579 mesa: bump version to 7.4.2 2009-05-14 13:20:13 -06:00
Eric Anholt
dc657f3929 i965: Fix varying payload reg assignment for the non-GLSL-instructions path.
I don't have a testcase for this, but it seems clearly wrong.
2009-05-14 11:41:04 -07:00
Eric Anholt
0f5113deed i965: Fix register allocation of GLSL fp inputs.
Before, if the VP output something that is in the attributes coming into
the WM but which isn't used by the WM, then WM would end up reading subsequent
varyings from the wrong places.  This was visible with a GLSL demo
using gl_PointSize in the VS and a varying in the WM, as point size is in
the VUE but not used by the WM.  There is now a regression test in piglit,
glsl-unused-varying.
2009-05-14 11:41:04 -07:00
Eric Anholt
64980125c7 intel: Use FRONT_AND_BACK for StencilOp as well. 2009-05-14 11:41:04 -07:00
Eric Anholt
d866abeffc intel: Use GL_FRONT_AND_BACK for stencil clearing.
This comes from a radeon-rewrite fallback fix, but may also fix stencil
clear failure when the polygon winding mode is flipped.
2009-05-14 11:41:03 -07:00
Corbin Simpson
96922d1b71 r300-gallium: Correct VTE setup for surface_fill, make surface_copy emit right. 2009-05-14 09:47:07 -07:00
Robert Ellison
ab6c4fa582 i965: fix 1D texture borders with GL_CLAMP_TO_BORDER
With 1D textures, GL_TEXTURE_WRAP_T should be ignored (only
GL_TEXTURE_WRAP_S should be respected).  But the i965 hardware
seems to follow the value of GL_TEXTURE_WRAP_T even when sampling
1D textures.

This fix forces GL_TEXTURE_WRAP_T to be GL_REPEAT whenever 1D
textures are used; this allows the texture to be sampled
correctly, avoiding "imaginary" border elements in the T direction.

This bug was demonstrated in the Piglit tex1d-2dborder test.
With this fix, that test passes.
2009-05-14 10:36:33 -06:00
Robert Ellison
bc3270e99f i965: send all warnings through _mesa_warning()
One warning message:
   drm_i915_getparam: -22

was still being sent to fprintf().  This causes all Piglit tests to fail,
even with MESA_DEBUG=0.

Using _mesa_warning() to emit the message allows the general Mesa controls
for messages like this to be applied.
2009-05-14 10:36:33 -06:00
Jerome Glisse
76a64958a4 r300: don't send now forbidden register to kernel when with memory manager 2009-05-14 17:25:24 +02:00
Corbin Simpson
d3912e301f r300-gallium: Clean up outdated comments. 2009-05-13 17:24:47 -07:00
Corbin Simpson
15601e9702 r300-gallium: Space accounting for textures. 2009-05-13 17:01:03 -07:00
Alex Deucher
7cd57e35b6 R1xx/r2xx: Don't use an alpha texture format for GLX_TEXTURE_FORMAT_RGB_EXT
In r*00SetTexBuffer2(), if the passed in text glx_texture_format
is GLX_TEXTURE_FORMAT_RGB_EXT, then we should use an RGB-only
texture format, even if the DRI buffer has four channels.

https://bugs.freedesktop.org/show_bug.cgi?id=21609
2009-05-13 19:43:04 -04:00
Owen W. Taylor
ca792be42b radeon: Don't crash generating mipmaps when pixels=NULL
When a NULL value of pixels is passed to TexImage2D and
SGIS_generate_mipmap is enabled, don't try to generate the
mipmap tree: we don't have data yet for the texture and will
crash.

https://bugs.freedesktop.org/show_bug.cgi?id=21648
2009-05-13 19:06:24 -04:00
Owen W. Taylor
ea6a74abbe Don't use an alpha texture format for GLX_TEXTURE_FORMAT_RGB_EXT
In r300SetTexBuffer2(), if the passed in text glx_texture_format
is GLX_TEXTURE_FORMAT_RGB_EXT, then we should use an RGB-only
texture format, even if the DRI buffer has four channels.

https://bugs.freedesktop.org/show_bug.cgi?id=21609
2009-05-13 19:04:18 -04:00
Owen W. Taylor
34eab5dd9c Call _mesa_update_stencil() before accessing ctx->Stencil._Enabled
ctx->Stencil._Enabled is derived state and not immediately updated
when the stencil parameters are changed; we need to make sure that
it is up-to-date before accessing it.

https://bugs.freedesktop.org/show_bug.cgi?id=21608
2009-05-13 19:02:51 -04:00
Owen W. Taylor
038f0bf591 Remove subpixel offset from viewport
Remove an eigth-pixel offset of the viewport inherited from
R100 code. This seems not to be necessary and causes blurring
when sampling textures 1:1.

https://bugs.freedesktop.org/show_bug.cgi?id=20340
2009-05-13 18:57:47 -04:00
Brian Paul
ec863602f2 i965: fix render to FBO/texture orientation bugs
Anytime we're not rendering to the default/window FBO, need to invert
rendering, not just when rendering to a texture.  Otherwise, if a FBO
consists of a mix of textures and renderbuffers the up/down orientation
was inconsistant.

Fixes shadowtex.c bad rendering.
(cherry picked from commit ba367f68cc)
2009-05-13 14:13:46 -07:00
Brian Paul
ca327b1688 Merge branch 'mesa_7_5_branch' 2009-05-13 11:33:52 -06:00
Brian Paul
ac5bf63f74 docs: GL_APPLE_vertex_array_object for Gallium drivers and Intel DRI drivers 2009-05-13 11:24:11 -06:00
Brian Paul
a566b6d8ff intel: enable GL_APPLE_vertex_array_object
No special driver changes are needed for this extension.
2009-05-13 11:19:33 -06:00
Brian Paul
a892acef98 st/mesa: enable GL_APPLE_vertex_array_object for gallium drivers 2009-05-13 11:22:21 -06:00
Brian Paul
3039acfc5d Merge branch 'mesa_7_5_branch'
Conflicts:

	src/mesa/main/arrayobj.c
	src/mesa/main/arrayobj.h
	src/mesa/main/context.c
2009-05-13 10:33:21 -06:00
Brian Paul
10c4a10b97 i965: enable additional code in emit_fb_write()
Not 100% sure this is right, but the invalid assertion is fixed...
2009-05-12 15:14:34 -06:00
Brian Paul
5590798f6d i965: increase BRW_EU_MAX_INSN 2009-05-12 15:14:34 -06:00
Brian Paul
4d244fb899 i965: comment 2009-05-12 15:14:34 -06:00
Joakim Sindholt
167a6b0804 r300-gallium: add missing semicolon
Yeah, that was stupid
2009-05-12 22:01:59 +02:00
Joakim Sindholt
62c0c7d81a r300-gallium: duplicate tokens in create_fs_state
This was all phoenix64's idea. Credit goes to him
2009-05-12 21:41:48 +02:00
Joakim Sindholt
723bc9452f progs/trivial: update .gitignore with new binaries 2009-05-12 21:00:39 +02:00
Eric Anholt
d4a42b0ce6 intel: Skip the DRI2 renderbuffer update when doing Viewport on an FBO. 2009-05-12 10:21:00 -07:00
Eric Anholt
aa422b2625 intel: Map write-only buffer objects through the GTT when possible.
This looks to be a win of a few percent in cairogears with new vbo code,
thanks to not polluting caches.
2009-05-12 10:08:19 -07:00
Eric Anholt
0fc5fa85bf i915: Fix driver after HW glGenerateMipmap commit. 2009-05-12 10:08:19 -07:00
Brian Paul
6d63dec41f swrast: update/restore the opt_sample_rgb/rgba_2d() functions 2009-05-12 09:05:31 -06:00
Jerome Glisse
c514c1f994 radeon: glReadBuffer set _NEW_BUFFERS, not _NEW_PIXEL
This was broken with last merge see 62043b2757
for explanations
2009-05-12 13:05:57 +02:00
Jerome Glisse
05c19ec7f0 r300/r500: make sure we detect constant buffer changes
This was broken with last merge see f48473e425
for explanations.
2009-05-12 13:04:32 +02:00
Tormod Volden
0bfa8dfaaf radeon: avoid segfault in radeon_update_renderbuffers() if using DRI1
Basically the same as 43d9020ff1 for intel. Bug 21688.

Signed-off-by: Tormod Volden <debian.tormod@gmail.com>
2009-05-12 12:43:08 +02:00
Brian Paul
e7cb125b2d Merge branch 'mesa_7_5_branch'
Conflicts:

	Makefile
	src/mesa/main/version.h
2009-05-11 16:27:50 -06:00
Joakim Sindholt
783e43064b r300-gallium: unbreak build 2009-05-11 21:44:49 +02:00
Corbin Simpson
64f60bc046 r300-gallium: Setup surface in r300_surface_copy.
I haven't tested, but this may unbreak surface copies.
2009-05-11 10:09:59 -07:00
Corbin Simpson
b315ec43ee r300-gallium: Cleanup some compile warnings. 2009-05-11 10:07:40 -07:00
Corbin Simpson
e9f8b7f1b9 r300-gallium: Cleanup PSC for HW TCL.
Still dies in assert, but at least it's not my assert anymore. :3
2009-05-11 09:57:57 -07:00
Corbin Simpson
f38a02212f radeon-gallium: Forgot a typedef. 2009-05-11 09:55:28 -07:00
Corbin Simpson
2e22bd8460 radeon-gallium: Support new info ioctls in addition to classic getparams.
This makes non-hybrid kernels like newttm from drm-next-radeon work
while avoiding breakage with Fedora/Ubuntu/etc.
2009-05-11 09:05:33 -07:00
Brian Paul
7c3d7353d7 mesa: updated comments for _mesa_generate_mipmap() 2009-05-11 10:02:27 -06:00
Brian Paul
2ff47b80f5 docs: updated bug fix list for 7.4.2 2009-05-11 09:49:46 -06:00
Brian Paul
6697311b21 i965: handle extended swizzle terms (0,1) in get_src_reg()
Fixes failed assertion in progs/glsl/twoside.c (but still wrong rendering).
2009-05-11 09:47:32 -06:00
Brian Paul
7c2fe42ded mesa: better handling/printing of driver-specific opcodes, register files
Drivers such as i965 define extra instruction opcodes and register files.
Improve the program printing code to handle those opcodes/files better.
2009-05-11 09:47:32 -06:00
Brian Paul
63cde0ea0e mesa: Fixed a texture memory leak
The current texture for any particular texture unit is given an additional
reference in update_texture_state(); but if the context is closed before
that texture can be released (which is quite frequent in normal use, unless
a program unbinds and deletes the texture and renders without it to force
a call to update_texture_state(), the memory is lost.

This affects general Mesa; but the i965 is particularly affected because
it allocates a considerable amount of additional memory for each allocated
texture.

(cherry picked from master, commit c230767d69)
2009-05-11 09:47:17 -06:00
Joel Bosveld
98bb5c610d radeon: add support for new dri2 interfaces & fix single buffer rendering 2009-05-10 18:26:40 +02:00
Jerome Glisse
221b30d595 Merge commit 'origin/master' into radeon-rewrite
Conflicts:
	src/mesa/drivers/dri/r200/r200_state.c
	src/mesa/drivers/dri/r300/r300_context.h
	src/mesa/drivers/dri/r300/r300_fragprog.c
	src/mesa/drivers/dri/r300/r300_state.c
	src/mesa/drivers/dri/r300/r300_texmem.c
	src/mesa/drivers/dri/r300/r300_texstate.c
	src/mesa/drivers/dri/r300/r500_fragprog.c
	src/mesa/drivers/dri/radeon/radeon_screen.c
	src/mesa/drivers/dri/radeon/radeon_state.c
2009-05-10 16:57:22 +02:00
Brice Goglin
ab885d7088 Enable motif in GLw 2009-05-09 20:49:15 +02:00
Jerome Glisse
13e0ff0df1 radeon: don't include cs uncondionaly 2009-05-09 12:56:27 +02:00
Corbin Simpson
53c2cc8fef radeon-gallium: Clean up some of the BO counting logic. 2009-05-09 00:45:48 -07:00
Corbin Simpson
a738d2b4c2 r300-gallium: vs: Make imms work, cleanup some of the switches. 2009-05-09 00:45:48 -07:00
Corbin Simpson
c4c5bf31a7 r300-gallium: Start VS dumper. 2009-05-09 00:45:48 -07:00
Corbin Simpson
7e347a0f49 r300-gallium: vs: Add SLT, clean up MAX.
This should be all the opcodes for basic TCL.
2009-05-09 00:45:48 -07:00
Corbin Simpson
9b10777148 r300-gallium: vs: Add MAX. 2009-05-09 00:45:48 -07:00
Corbin Simpson
e669ce01d4 r300-gallium: vs: Add scalar setup, RSQ.
Icky icky icky icky. Icky icky, icky icky. Icky.
2009-05-09 00:45:48 -07:00
Corbin Simpson
c6d2b4a495 r300-gallium: vs: Add writemasks. 2009-05-09 00:45:47 -07:00
Corbin Simpson
ce758a21b9 r300-gallium: Fix bad cast. Space accounting completely works now.
Boy, is my face red. :C
2009-05-08 22:05:18 -07:00
Corbin Simpson
1b26c2bbae r300-gallium, radeon: BO handling fixes, some useful asserts. 2009-05-08 19:41:08 -07:00
Corbin Simpson
bed917641c radeon-gallium: Shut up Valgrind. 2009-05-08 19:41:08 -07:00
Corbin Simpson
cd59933d9f r300-gallium, radeon: A couple cleanups.
Trying to track down goddamn bugs. :C
2009-05-08 19:41:08 -07:00
Corbin Simpson
4816764777 r300-gallium: Finish space accounting.
Still broken...
2009-05-08 19:41:08 -07:00
Richard Li
e2dcebd2e6 R6xx/R7xx: WIP r6xx-rewrite code 2009-05-08 19:23:45 -04:00
Robert Ellison
1d11220771 i965: improve debug logging
Looking for memory leaks that were causing crashes in my environment
in a situation where valgrind would not work, I ended up improving
the i965 debug traces so I could better see where the memory was
being allocated and where it was going, in the regions and miptrees
code, and in the state caches.  These traces were specific enough
that external scripts could determine what elements were not being
released, and where the memory leaks were.

I also ended up creating my own backtrace code in intel_regions.c,
to determine exactly where regions were being allocated and for what,
since valgrind wasn't working.  Because it was useful, I left it in,
but disabled and compiled out.  It can be activated by changing a flag
at the top of the file.
2009-05-08 16:57:08 -06:00
Robert Ellison
fc6d89145d i965: fix memory leak in context/renderbuffer region management
A temporary change to the intelMakeCurrent() function to make
it work with frame buffer objects causes the static regions
associated with the context (the front_region, back_region,
and depth_region) to take on an additional reference, with
no corresponding release.  This causes a memory leak if a
program repeatedly creates and destroys contexts.

The fix is the corresponding hack, to unreference these
regions when the context is deleted, but only if the
framebuffer objects are still present and the same
regions are still referenced within.

Both sets of code have comment blocks referring to each
other.
2009-05-08 16:47:59 -06:00
Robert Ellison
44a4abfd4f i965: fix segfault on low memory conditions
When out of memory (in at least one case, triggered by a longrunning
memory leak), this code will segfault and crash.  By checking for the
out-of-memory condition, the system can continue, and will report
the out-of-memory error later, a much preferable outcome.
2009-05-08 16:32:29 -06:00
Robert Ellison
c230767d69 mesa: Fixed a texture memory leak
The current texture for any particular texture unit is given an additional
reference in update_texture_state(); but if the context is closed before
that texture can be released (which is quite frequent in normal use, unless
a program unbinds and deletes the texture and renders without it to force
a call to update_texture_state(), the memory is lost.

This affects general Mesa; but the i965 is particularly affected because
it allocates a considerable amount of additional memory for each allocated
texture.
2009-05-08 16:32:28 -06:00
Eric Anholt
1d663ae292 intel: Add a metaops version of glGenerateMipmapEXT/SGIS_generate_mipmaps.
In addition to being HW accelerated, it avoids the incorrect
(black) rendering of the mipmaps that SW was doing in fbo-generatemipmap.
Improves the performance of the mipmap generation and drawing in
fbo-generatemipmap by 30%.
2009-05-08 14:18:04 -07:00
Eric Anholt
b6e94f71c2 intel: Put the constant texcoords used in metaops into a vbo.
Make this be its own function for setup/teardown of the binding of these
texcoords.  No performance difference in the engine demo (I just felt dirty
not using a VBO for this), and I think it should be more resilient to
interference from current GL state.
2009-05-08 14:18:04 -07:00
Brian Paul
f09e5a5b63 i965: const qualifiers 2009-05-08 14:34:27 -06:00
Brian Paul
4e762395ef mesa: raise MAX_VARYING (number of shader varying vars) to 16
16 is the limit for now because of various 32-bit bitfields.
2009-05-08 14:35:48 -06:00
Brian Paul
17a354a119 mesa: assertions to check for too many vertex outputs or fragment inputs 2009-05-08 14:35:48 -06:00
Brian Paul
cc58fbcf2c glsl: check number of varying variables against the limit
Link fails if too many varying vars.
2009-05-08 14:35:48 -06:00
Brian Paul
87fbc9a14e mesa: issue warning for out of bounds array indexes 2009-05-08 12:45:08 -06:00
Brian Paul
e2cf522de0 i965: don't use GRF regs 126,127 for WM programs
They seem to be used for something else and using them for shader temps
seems to lead to GPU lock-ups.
Call _mesa_warning() when we run out of temps.
Also, clean up some debug code.
2009-05-08 12:45:08 -06:00
Brian Paul
40cba5489d glsl: set vertex/fragment program Ids to aid with debugging 2009-05-08 12:45:08 -06:00
Brian Paul
ccaa6463a7 mesa: more shader debug code (disabled) 2009-05-08 12:45:08 -06:00
Jerome Glisse
a67c29a268 radeon: IRQ always enabled in DRI2 path no need to query kernel for it 2009-05-08 16:40:21 +02:00
Keith Whitwell
d5c2ad8514 mesa/st: keep surface_copy arguments positive
The src/dest x,y, and w,h arguments of the pipe->surface_copy
function are unsigned and the drivers aren't expecting negative
(or extremly-large unsigned) values as inputs.  Trim the requests
at the state-tracker level before passing down.
2009-05-08 10:04:14 +01:00
Keith Whitwell
6826bad6a7 mesa/st: remove redundant call to st_finish in CopyTexSubImage
Rendering should already have been flushed, any synchronization will
be done by the driver or memory manager.
2009-05-08 10:04:14 +01:00
José Fonseca
626b6f37ea wgl: Export pixelformats with accumulation bits. 2009-05-08 10:04:14 +01:00
Keith Whitwell
01280cff53 mesa/st: cope with non-ibo index data in st_draw_feedback.c
Previously only non-indexed or indicies-in-a-vbo cases were handled in
this code.  This change adds the missing regular indices-in-memory
case.
2009-05-08 10:04:14 +01:00
Keith Whitwell
4a333c64fa util/upload: catch failures to map_range and return error
Caller may be able to do something about this - eg flush and retry.
2009-05-08 10:04:14 +01:00
Keith Whitwell
5f5181021e scons: mingw is broken with -O1 and higher 2009-05-08 10:04:13 +01:00
Keith Whitwell
48c7aa2648 stw: fix potential uninitialized use of curctx 2009-05-08 10:04:13 +01:00
José Fonseca
26ffd44586 wgl: Enforce a minimum 1x1 framebuffer size. 2009-05-08 10:04:13 +01:00
José Fonseca
3a43ea4946 wgl: Add assertion for missing function. 2009-05-08 10:04:13 +01:00
José Fonseca
082a086e9d wgl: Remove unused variable. 2009-05-08 10:04:13 +01:00
José Fonseca
b25168c34c mesa: Make _mesa_share_state thread safe. 2009-05-08 10:04:13 +01:00
José Fonseca
25a4156a8b wgl: Implement ShareLists. 2009-05-08 10:04:13 +01:00
Maciej Cencora
a7bb95bf14 r300: add missing texture format
Fixes piglit/texdepth
2009-05-07 20:15:45 -04:00
Maciej Cencora
dc8c717759 r300: moar cleanup
- remove unused r300UpdateClipPlanes function
- move reg definition to r300_reg.h
- remove incorrect forward definition of tnl_UpdateFixedFunctionProgram and add proper #include
- remove unreachable code
2009-05-07 20:15:40 -04:00
Maciej Cencora
14365aa0ef r300: fix compiler warnings 2009-05-07 20:15:34 -04:00
Ben Skeggs
71b1c92405 nouveau: respect GALLIUM_STATE_TRACKERS_DIRS 2009-05-08 09:33:02 +10:00
Ben Skeggs
9e02fa4532 nouveau: remove dri1 code now we're using the dri state tracker 2009-05-08 09:33:02 +10:00
Ben Skeggs
b7f2b7e936 nouveau: use dri state tracker for dri1 2009-05-08 09:32:56 +10:00
Brian Paul
fa95ecb467 mesa: make the array object save/remove functions static 2009-05-07 14:34:09 -06:00
Brian Paul
32b851c807 mesa: clean-up vertex array object VBO unbinding and delete/refcounting
Don't really delete vertex array objects until the refcount hits zero.
At that time, unbind any pointers to VBOs.
2009-05-07 14:34:09 -06:00
Brian Paul
56cfa4de91 demos: delete vertex array objects upon exit 2009-05-07 14:34:09 -06:00
Brian Paul
1030bf0ded mesa: reference counting for gl_array_object
Every kind of object that can be shared by multiple contexts should be
refcounted.
2009-05-07 14:34:09 -06:00
Brian Paul
9bb6684799 mesa: array object comments 2009-05-07 14:34:09 -06:00
Brian Paul
4f6b704f97 mesa: move the NullBufferObj from GLcontext to gl_shared_state
Since shared array objects may point to the null/default buffer object,
the null/default buffer object should be part of the shared state.
2009-05-07 14:34:09 -06:00
Brian Paul
105c8529e7 mesa: fix comments, s/texture/buffer/ 2009-05-07 14:34:09 -06:00
Brian Paul
f37cccde3c vbo: in glDraw[Range]Element() code, check for out of bounds indexes
No-op the bad drawing command rather than go out of bounds and render
garbage.  Print a warning to alert the developer to the bad drawing call.
2009-05-07 11:01:02 -06:00
Brian Paul
6359ecebec mesa: remove unused gl_buffer_object::OnCard field 2009-05-07 10:12:33 -06:00
Brian Paul
dcca97a3e3 mesa: added gl_buffer_object::Written flag (for debug purposes)
The flag is set when we data has been written into the buffer object.
2009-05-07 10:12:33 -06:00
Brian Paul
b9d0f947f2 mesa: Compute gl_client_array->_MaxElement during array validation
Used to be done in the glVertex/Normal/Color/etc/Pointer() calls but
if the VBO was reallocated the size could change.
New _NEW_BUFFER_OBJECT state flag.
2009-05-07 10:12:33 -06:00
Brian Paul
800b14cd37 mesa: GLvector4f:: flags is a GLbitfield, update comments too. 2009-05-07 10:12:33 -06:00
Brian Paul
1f75c2daea mesa: add storage_count field to GLvector4f. Useful for debugging. 2009-05-07 10:12:33 -06:00
Brian Paul
828aa76f36 mesa: use array->BufferObj instead of ctx->Array.ArrayBufferObj
No difference, but a little more understandable.
2009-05-07 10:12:33 -06:00
Brian Paul
0077c879b5 mesa: added _ElementSize field to gl_client_array
Will be handy for bounds checking later...
2009-05-07 10:12:33 -06:00
Brian Paul
a6c8e900af mesa: use local var to make code a bit more concise 2009-05-07 10:12:33 -06:00
Brian Paul
b102c1d8f9 mesa: fix/add comments 2009-05-07 10:12:33 -06:00
Brian Paul
7e3bd457e8 mesa: use _mesa_sizeof_type() in vbo split code 2009-05-07 10:12:33 -06:00
Brian Paul
3acdab82cb mesa: vbo code reformatting, clean-up, comments 2009-05-07 10:12:33 -06:00
Brian Paul
87ba2285fe mesa: add GL_DOUBLE case in _mesa_sizeof_type() 2009-05-07 10:12:32 -06:00
Brian Paul
2369f14245 mesa: in vbo split code, map buffers read-only, not write-only
And use GL_ELEMENT_ARRAY_BUFFER where appropriate.
2009-05-07 10:12:32 -06:00
Brian Paul
74bec42b45 mesa: limit number of error raised by invalid GL_TEXTURE_MAX_ANISOTROPY_EXT 2009-05-07 10:12:32 -06:00
Brian Paul
ad32489987 tnl: added some clip debug/print code (disabled) 2009-05-07 10:12:32 -06:00
Brian Paul
424507953c mesa: reformatting, updated comments, const-correctness 2009-05-07 10:12:32 -06:00
Brian Paul
134ac52dec tnl: replace 0x3f with CILP_FRUSTUM_BITS 2009-05-07 10:12:32 -06:00
Brian Paul
f56893ea17 i965: relAddr local var (to make debug/test a little easier) 2009-05-07 09:59:13 -06:00
Brian Paul
9a4890dac7 Merge branch 'mesa_7_5_branch' 2009-05-07 09:46:53 -06:00
Eric Anholt
3d048e5750 i965: Remove bad constant buffer constant-reg-already-loaded optimization.
Thanks to branching, the state of c->current_const[i].index at the point
of emitting constant loads for this instruction may not match the actual
constant currently loaded in the reg at runtime.  Fixes a regression in my
GLSL program for idr's class since b58b3a786a.
2009-05-06 21:44:13 -07:00
Eric Anholt
156a79f5bd intel: Unmap buffers if needed at DeleteBuffer time.
This fixes a crash in glean's pbo test, which tripped over the assert when a
context was destroyed while a buffer was still mapped (Mesa doesn't call
UnmapBuffer in that case).  Regression in
c6bde8873f
2009-05-06 20:44:34 -07:00
Owen W. Taylor
cfc3ac8d6e When clearing the stencil buffer, don't use a two-sided stencil
In radeon_clear_tris(), when clearing the stencil buffer,
pass GL_FRONT_AND_BACK to _mesa_StencilFuncSeparate(), to avoid
triggering a software fallback on r300 and below.

https://bugs.freedesktop.org/show_bug.cgi?id=21601
2009-05-06 17:10:06 -04:00
Brian Paul
58544a28ad mesa: remove unnecessary buffer size check 2009-05-06 12:38:35 -06:00
Brian Paul
bb1fb2a544 mesa: code consolidation in glDraw[Range]Elements() validation 2009-05-06 12:38:35 -06:00
Brian Paul
88af3f8783 mesa: new comments, minor reformatting 2009-05-06 12:38:35 -06:00
Brian Paul
a13df193c2 mesa: use elementBuf local var instead of ctx->Array.ElementArrayBufferObj
Makes no real difference, but more consistant.
2009-05-06 12:38:35 -06:00
Eric Anholt
f831d2d41b i965: Remove the forced lack of caching for renderbuffer surface state.
This snuck in with the multi-draw-buffers commit, and is a major penalty
to performance.  It doesn't appear to be required, as the only dependency
the surface BO has is on the state key (and if there's some other dependency,
it should just be in the key).

This brings openarena performance up to almost 2% faster than Mesa 7.4.
2009-05-06 10:54:32 -07:00
Eric Anholt
4cb87840ff i965: Remove _NEW_PROGRAM from brw_wm_surfaces setup dependencies.
This was a leftover from the brw_wm_constant_buffer change.
2009-05-06 10:54:32 -07:00
Brian Paul
9b678af796 mesa: be smarter about allocating vert/frag program constants
Try to re-use constants/literals more often to make best use of the
constant buffer space.

See bug 21354.
2009-05-06 08:53:41 -06:00
Eric Anholt
71fb9d62ec i965: Split WM constant buffer update from other WM surfaces.
This can avoid re-uploading constant data when it isn't necessary, and is
a step towards not updating other surfaces just because constants change.
It also brings the upload of the constant buffer next to the creation.

This brings openarena performance up another 4%, to 91% of the Mesa 7.4 branch.
2009-05-06 06:44:14 -07:00
Eric Anholt
9490d86808 i965: Disentangle VS constant surface state from WM surface state.
Also, only create VS surface state if there's a VS constant buffer to be
uploaded, and set the contents of the buffer at the same time as creation.
2009-05-06 06:44:14 -07:00
Eric Anholt
d277547dc6 i965: Don't create constant buffers if they won't be used.
Really, the creation and upload of constants should be in the same place,
since they should only happen together, and a state flag should be
triggered by them so that we don't thrash state around so much for just
updating constants.  But this still recovers openarena performance by
another 19%, leaving us 16% behind Mesa 7.4 branch.
2009-05-06 06:44:13 -07:00
Dave Airlie
7f65fea95e radeon: hopefully fixup radeon cube state emission for kms 2009-05-06 14:43:07 +10:00
Dave Airlie
d7f62e5405 r100/r200: try and allocate miptree correct for hw.
This doesn't make things worse but according to sroland it
is how the GPU hw expects things on the r100/r200
2009-05-06 14:06:13 +10:00
Dave Airlie
acf086ebfa r200: fix cubic emission.
Still doesn't fix cubemaps, I really missed the whole drmsupports
thing when testing this all originally
2009-05-06 13:34:34 +10:00
Brian Paul
51325f44d1 mesa: only use fallback texture when using shaders, not fixed-function (take two)
The semantics are a little different for shaders vs. fixed-function when
trying to use an incomplete texture.  The fallback texture returning
(0,0,0,1) should only be used with shaders.  For fixed function, the texture
unit is truly disabled/ignored.

Fixes glean fbo test regression.
2009-05-05 16:31:44 -06:00
Brian Paul
823815a485 Revert "mesa: only use fallback texture when using shaders, not fixed-function"
This reverts commit a0edbfb28f.

This patch didn't completely fix the problem.  The next patch will.
2009-05-05 16:30:30 -06:00
Brian Paul
a0edbfb28f mesa: only use fallback texture when using shaders, not fixed-function
The semantics are a little different for shaders vs. fixed-function when
trying to use an incomplete texture.  The fallback texture returning
(0,0,0,1) should only be used with shaders.

Fixes glean fbo test regression.
2009-05-05 16:29:04 -06:00
Brian Paul
01e16befd4 mesa: only use fallback texture when using shaders, not fixed-function
The semantics are a little different for shaders vs. fixed-function when
trying to use an incomplete texture.  The fallback texture returning
(0,0,0,1) should only be used with shaders.

Fixes glean fbo test regression.
2009-05-05 16:21:20 -06:00
Brian Paul
c0d3761c16 mesa: minor simplification in enable_texture(), updated comments 2009-05-05 16:17:55 -06:00
Eric Anholt
c521d4629b Flag GLSL programs as depending on constant state when they use uniforms.
This is not a cherry-pick, as it got fixed in master with the
_NEW_PROGRAM_CONSTANTS change.  Fixes bad rendering with various GLSL programs
idr and I have been writing.
2009-05-05 12:14:29 -07:00
Roland Scheidegger
5f8381724e r200: fix some cube map issues
remove the r100-ism of swapping cube faces which doesn't apply to r200,
and also use precalculated offsets.
Note that cube textures will still not work on r100 and r200 since mipmap
layout is level-first order (for r300) whereas r100/r200 require
face-first (and possibly also 2k alignment for face at least with tiling).
2009-05-05 21:01:36 +02:00
Roland Scheidegger
3503af07c4 r200: fix another section size mismatch 2009-05-05 20:17:37 +02:00
Brian Paul
b3fc832ac7 Merge branch 'mesa_7_5_branch' 2009-05-05 10:13:13 -06:00
Brian Paul
95b7771ea7 gallium: remove redundant cube face #defines 2009-05-05 10:13:11 -06:00
Roland Scheidegger
b2577937b6 r200: fix CS section size mismatch (bug 21565) 2009-05-05 17:45:50 +02:00
Keith Whitwell
077c904b76 progs/trivial: add test for vertex program invarient transform 2009-05-05 13:14:54 +01:00
Keith Whitwell
113403ef51 mesa: more complete fix for transform_invarient glitches
Add a new flag mvp_with_dp4 in the context, and use that to switch
both ffvertex.c and programopt.c vertex transformation code to
either DP4 or MUL/MAD implementations.
2009-05-05 13:14:53 +01:00
Keith Whitwell
22b417b75c mesa/main: set PREFER_DP4 to match position_invarient code
This is a quick fix for z fighting in quake4 caused by the mismatch
between vertex transformation here and in the position_invarient code.
Full fix would be to make this driver-tunable and adjust both
position_invarient and ffvertex_prog.c code to respect driver
preferences.
2009-05-05 13:14:52 +01:00
José Fonseca
c6bfb4c559 wgl: Implemente SwapLayerBuffers. 2009-05-05 13:14:51 +01:00
José Fonseca
e9fb90ab88 scons: Don't use deprecated Options. 2009-05-05 13:14:51 +01:00
José Fonseca
3537c3420d util: Limit the stack walk to avoid referencing undefined memory. 2009-05-05 13:14:50 +01:00
Keith Whitwell
b865501bda gallium/tgsi: hack around linker/archiver breakage
Add a dummy function which exists only so that tgsi_text_translate()
doesn't get magic-ed out of the libtgsi.a archive by the build system.
Don't remove unless you know this has been fixed - check on
mingw/scons builds as well.
2009-05-05 13:14:49 +01:00
Keith Whitwell
5f2569a1b9 progs/trivial: add vbo-noninterleaved test 2009-05-05 13:14:48 +01:00
José Fonseca
6b89c35c9f wgl: Include alpha bits in pixel format's cColorBits field. 2009-05-05 13:14:47 +01:00
Keith Whitwell
c6b3c2f34b gallium/draw: cope with unused vertex_elements 2009-05-05 13:14:46 +01:00
Keith Whitwell
4d548bd069 trivial: add line-flat.c 2009-05-05 13:14:45 +01:00
José Fonseca
ccec9f76d5 wgl: UINT_PTR null value is an integral type, so return 0 instead of NULL. 2009-05-05 13:14:44 +01:00
José Fonseca
a47f15ba1d pb: Save the stack backtrace when creating/mapping a debug buffer. 2009-05-05 13:14:42 +01:00
José Fonseca
4fd6f296f8 pb: Dump the fenced buffer sizes. 2009-05-05 13:14:38 +01:00
Stephane Marchesin
8edb50ff1e nv04: small fix again 2009-05-05 12:03:38 +02:00
Stephane Marchesin
39ebeead56 Fix an nv04 bug (thanks Mhopf). 2009-05-05 11:29:58 +02:00
Dave Airlie
f616995e5e radeon/r200: enable all the optional drm support bits 2009-05-05 10:51:44 +10:00
Brian Paul
f95c0c06c0 mesa: also print program params/constants when dumping shaders to disk 2009-05-04 11:14:35 -06:00
Brian Paul
27dbdb1684 mesa: remove some unfinished/devel code 2009-05-04 11:13:35 -06:00
Maciej Cencora
0b22615c2c r300: set proper texture row alignment for IGP chips
Looks like r400 based IGP chips require 64 byte alignment
2009-05-04 12:09:36 -04:00
Brian Paul
e9d5569bf3 glx: replace Xmalloc() calls with Xcalloc()
Fixes a bug where psp->WaitX was uninitialized.  Reported by Chris Clayton.

(cherry picked from commit dd4c142e90)
2009-05-04 08:34:20 -06:00
Julien Cristau
84ae506072 Don't build hardware dri drivers on s390. 2009-05-03 19:30:02 +02:00
Julien Cristau
4842cde28f Prepare changelog for upload 2009-05-03 16:05:30 +02:00
Julien Cristau
b651c02dca Fix Architecture field for libgl1-mesa-dri-dbg 2009-05-03 16:04:39 +02:00
Julien Cristau
ec44d955bb Move -dbg packages to new 'debug' section. 2009-05-03 16:03:58 +02:00
Julien Cristau
914edc46fa Update changelog 2009-05-03 14:31:05 +02:00
Julien Cristau
64cb29deca Merge branch 'mesa_7_4_branch' of git.freedesktop.org:/git/mesa/mesa into debian-unstable 2009-05-03 14:26:30 +02:00
Brian Paul
6337525497 mesa: fix state validation bug for glCopyTex[Sub]Image()
We need to make sure the framebuffer state is up to date to make sure we
read pixels from the right buffer when doing a texture image copy.

(cherry-picked from master, commit 63f0130980)
2009-05-01 20:24:39 -06:00
Brian Paul
986d4a9ec6 draw: added some inf/nan debug code (disabled) 2009-05-01 18:35:59 -06:00
Brian Paul
08bc3d1750 gallium/glx: say we're direct rendering 2009-05-01 18:35:59 -06:00
Brian Paul
62043b2757 mesa: in glReadBufer() set _NEW_BUFFERS, not _NEW_PIXEL
Since GL_READ_BUFFER is historically part of the gl_pixel_attrib group
it made sense to signal changes with _NEW_PIXEL.  But now with FBOs it's
also part of the framebuffer state.

Now _NEW_PIXEL strictly indicates pixels transfer state changes.

This change avoids framebuffer state validation when any random bit of
pixel-transfer state is set.

DRI drivers updated too:  don't check _NEW_COLOR when updating framebuffer
state.  I think that was just copied from the Xlib driver because we care
about dither enable/disable state there.
2009-05-01 18:31:04 -06:00
Brian Paul
a7ef5b76d6 Merge branch 'mesa_7_5_branch' 2009-05-01 18:21:02 -06:00
Zack Rusin
54324d9e0c vg: remove a silly demo and add a bit better one 2009-05-01 19:08:32 -04:00
Brian Paul
602833b107 st: if st_swapbuffers() is called for single-buffered visual don't crash
Furthermore, return pointer(s) to the front color buffer(s).
2009-05-01 16:44:04 -06:00
Brian Paul
b57b6c2d2c xlib winsys: use new st_swapbuffers() function
The front/back buffer pointers are truly swapped (when there is an actual
front buffer).

This fixes some issues seen with apps/tests that draw to both the front
and back color buffers.  The true swap allows us to avoid the (potentially)
slow surface_copy() call in update_framebuffer_state() and is cleaner
overall.
2009-05-01 12:54:20 -06:00
Brian Paul
3f52a853f7 st: when creating an on-demand front color buffer, init to back buffer image
When we create a new front color buffer (user called glDrawBuffer(GL_FRONT))
initialize it to the contents of the back buffer.  Any previous call to
SwapBuffers() would have done that in effect, so make it reality.
2009-05-01 12:54:16 -06:00
Brian Paul
b85b315ebb st: added st_renderbuffer::defined flag
Indicates whether there's defined image contents, or garbage/don't care.
This is set when we draw into a renderbuffer and cleared when we resize/
reallocate a renderbuffer or do a buffer swap (back buffer becomes undefined).

We use this to determine whether the front color buffer has been drawn to,
and whether to display its contents upon glFlush/Finish(), when the new
st_swapbuffers() function is used.
2009-05-01 12:25:42 -06:00
Brian Paul
30b3d80091 mesa: fix comment 2009-05-01 12:12:43 -06:00
Brian Paul
06cd826fcb Merge branch 'mesa_7_5_branch' 2009-05-01 11:57:00 -06:00
Brian Paul
d6318ba8a8 docs: asst updates to openvg.html 2009-05-01 11:37:09 -06:00
Brian Paul
3534539557 set: new st_swapbuffers() which does a true front/back buffer swap
The pointers to the front/back renderbuffers are exchanged.
This new function isn't actually used yet...
2009-05-01 11:24:08 -06:00
Zack Rusin
544dd4b11f OpenVG 1.0 State Tracker
Import of the OpenVG 1.0 state tracker for Gallium.
2009-05-01 12:51:59 -04:00
Zack Rusin
fbceedd2de actually add debug to the debug config 2009-05-01 12:51:01 -04:00
José Fonseca
293f576db7 egl_xlib: Pass RTLD_LAZY to dlopen.
dlopen manpage mandates that either RTLD_LAZY or RTLD_NOW flags must be
passed. Not doing so was causing a NULL return on debian unstable x86-64.
2009-05-01 12:51:01 -04:00
Ian Romanick
2085cf2462 Test either GL_FRONT_LEFT or GL_FRONT for front-buffer rendering
For non-stereo visuals, which is all we support, we treat
GL_FRONT_LEFT as GL_FRONT.  However, they are technically different,
and they have different enum values.  Test for either one to determine
if we're in front-buffer rendering mode.

This fix was suggested by Pierre Willenbrock.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2009-05-01 09:49:06 -07:00
Brian Paul
cd6734288d st: when double buffered, only create front color buffer on demand
Before we always created the front color buffer, even if was never used.
This can save some memory.
2009-05-01 10:19:00 -06:00
Brian Paul
b9196c1fa3 Merge branch 'const-buffer-changes'
Conflicts:

	src/mesa/drivers/dri/i965/brw_curbe.c
	src/mesa/drivers/dri/i965/brw_vs_emit.c
	src/mesa/drivers/dri/i965/brw_wm_glsl.c
2009-05-01 09:37:14 -06:00
Brian Paul
3f25219c7b mesa: create/use a fallback texture when bound texture is incomplete
When a GLSL sampler reads from an incomplete texture it should
return (0,0,0,1).  Instead of jumping through hoops in all the drivers
to make this happen, just create/install a fallback texture with those
texel values.

Fixes piglit/fp-incomplete-tex on i965 and more importantly, fixes some
GPU lockups when trying to sample from missing surfaces.  If a binding
table entry is NULL, it seems that sampling sometimes works, but not
always (lockup).

Todo: create a fallback texture for each type of texture target?
2009-05-01 09:30:32 -06:00
Brian Paul
7ca0427338 docs: initial 7.6 release notes page 2009-05-01 09:24:19 -06:00
Brian Paul
666e5bf4a6 mesa: bump version to 7.6 (devel) 2009-05-01 09:22:20 -06:00
Brian Paul
7541c3806a docs: fix typos 2009-04-30 17:08:37 -06:00
Michel Dänzer
a1ce4efefb r300: Increase reference count of texture objects referenced by current state.
Fixes a use-after-free reported in
http://bugs.freedesktop.org/show_bug.cgi?id=20539, so this possibly fixes that
bug. It has been confirmed to fix
http://bugs.freedesktop.org/show_bug.cgi?id=17895 .
(cherry picked from commit c28707b507)
2009-04-30 13:50:36 +02:00
Brian Paul
dca190e943 mesa: added _mesa_check_soa_dependencies() function
This function will check an instruction to see if there's data dependencies
between the dst and src registers if executed in an SOA manner.
2009-04-29 13:04:42 -06:00
Brian Paul
656cd707db mesa: Fix buffer overflow when parsing generic vertex attributes.
(cherry picked from master, commit fa92756400)
2009-04-28 10:58:13 -06:00
Alex Deucher
55db6ce537 R300: add quadpipe overrides
RV410 SE chips only have 1 quadpipe.
Also, handle other R300 chip with quadpipe override.
2009-04-28 12:50:38 -04:00
Alex Deucher
ce7f78694d R300: add quadpipe overrides
RV410 SE chips only have 1 quadpipe.
Also, handle other R300 chip with quadpipe override
2009-04-28 12:40:04 -04:00
Brian Paul
fd95e8ee33 docs: fix swrast texrect bug 21461 2009-04-28 09:11:05 -06:00
Brian Paul
d2b8c41b7a swrast: add missing break in clamp_rect_coord_linear()
See bug 21461.

(cherry picked from master, commit dcf571aff9)
2009-04-28 09:09:41 -06:00
Dave Airlie
5ca4f3c5da radeno: cleanup the startup path further 2009-04-28 15:44:10 +10:00
Dave Airlie
a9d64873d7 radeon: further cleanup dri1 screen init 2009-04-28 15:35:52 +10:00
Dave Airlie
7731d93165 r300: remove unused debugging in set tex buffer paths 2009-04-28 15:27:31 +10:00
Dave Airlie
4e7d603fae radeon: remove kernel mm, dri2 path takes care of it 2009-04-28 15:26:24 +10:00
Maciej Cencora
ce0d10dd6c r300: fix fragment program limits 2009-04-27 14:33:24 -04:00
Maciej Cencora
3c6bffa761 r300: fallback only if stencil test is enabled 2009-04-27 14:33:24 -04:00
Maciej Cencora
e33e28f52a r300: do front/back color selection in HW for software TCL path 2009-04-27 14:33:23 -04:00
Maciej Cencora
3d83a709b9 r300: fix valgrind warnings 2009-04-27 14:33:23 -04:00
Maciej Cencora
78c0e6aefc r300: fix point size clamping when point is not attenuated 2009-04-27 14:33:23 -04:00
Brian Paul
dd4802176f i965: #include prog_print.h to silence warning 2009-04-27 10:46:30 -06:00
Brian Paul
777b9ff43e i965: only upload constant buffer data when we actually need the const buffer
Make the use_const_buffer field per-program and only call the code which
updates the constant buffer's data if the flag is set.

This should undo the perf regression from 20f3497e4b

(cherry picked from master, commit dc9705d12d)
2009-04-27 10:45:41 -06:00
Maciej Cencora
033d1365e6 r300: fix performance regression
This performance regression on non TCL hw was introduced by ed4c6cbe01.
This patch depends on "r300: always route 4 texcoord components to RS" and "r300: add point attenuation stage for TCL fallbacks".
2009-04-27 19:08:41 +10:00
Maciej Cencora
7f6b13be86 r300: add point attenuation stage for TCL fallbacks 2009-04-27 19:08:12 +10:00
Maciej Cencora
d014d7d1bb r300: always route 4 texcoord components to RS
Routing <4 components may lead to lock up.

Thanks to Alex Deucher for suggestion.
2009-04-27 19:07:50 +10:00
Maciej Cencora
22c0652c38 r300: flush stdout to get consistent debugging info 2009-04-27 19:07:16 +10:00
Maciej Cencora
7ff2dcbbdc r300: add atom print function for kernel mm path 2009-04-27 19:06:38 +10:00
Maciej Cencora
25dd867c58 r300: handle texcoords properly
add 1D texture case and setup default Q value to 1.0
2009-04-27 19:06:00 +10:00
Maciej Cencora
199710914a r300: remove unnecessary function calls
ae_create_context is called by vbo_CreateContext
ae_invalidate_state is called by vbo_InvalidateState
2009-04-27 19:05:37 +10:00
Maciej Cencora
607c6cf188 r300: rename state
According to r300_reg.h from radeon drm module 0x4f30 is ZB_ZMASK_OFFSET.
Also cleanup as trailing whitespaces.
2009-04-27 19:04:52 +10:00
Maciej Cencora
931c89f6f6 r300: remove unnecessary function calls
r300SetEarlyZState is called during r300UpdateShaderStates which is called for every rendering operation.
2009-04-27 19:04:21 +10:00
Brian Paul
b58b3a786a i965: rework GLSL/WM register allocation
Use a bitvector of used/free flags.

If we run out of temps, examine the live intervals of the temp regs in
the program and free those which are no longer alive.

Also, enable the new WM const buffer code.
2009-04-24 16:33:46 -06:00
Brian Paul
7da3f9403b mesa: refactor code and make _mesa_find_temp_intervals() public 2009-04-24 16:28:36 -06:00
Jerome Glisse
32d185eb60 r300: fix cliprect values 2009-04-24 19:54:01 +02:00
Alan Hourihane
bfd6bb31a6 demos: ensure display lists are destroyed for next generation 2009-04-24 17:22:52 +01:00
Brian Paul
027ed1b505 mesa: signal _NEW_PROGRAM_CONSTANTS instead of _NEW_PROGRAM
Use _NEW_PROGRAM_CONSTANTS when changing constant/uniform buffer values.
Binding a new program/shader sets both _NEW_PROGRAM and _NEW_PROGRAM_CONSTANTS.
2009-04-24 09:43:44 -06:00
Jerome Glisse
5dec94696e r300: emit cliprect when in dri2 mode 2009-04-24 15:03:23 +02:00
Eric Anholt
c3e7fc394f i965: Support drawing to FBO cube faces other than positive X.
Also fixes drawing to 3D texture depth levels.
(cherry picked from commit 8374379572)
2009-04-23 14:05:58 -07:00
Eric Anholt
dd56897b27 intel: Fix commented-out glViewport in intel_meta_set_passthrough_transform.
Too much commit -a while debugging.
(cherry picked from commit 8910da5b7a)
2009-04-23 14:00:56 -07:00
Brian Paul
ebfbd8c4fe i965: disable debug printf 2009-04-22 13:46:58 -06:00
Brian Paul
ac22178eb0 i965: enable VS constant buffers
In the VS constants can now be handled in two different ways:
1. If there's room in the GRF, put constants there.  They're preloaded from
   the CURBE prior to VS execution.  This is the historical approach.  The
   problem is the GRF may not have room for all the shader's constants and
   temps and misc registers.  Hence...
2. Use a separate constant buffer which is read from using a READ message.
   This allows a very large number of constants and frees up GRF regs for
   shader temporaries.  This is the new approach.  May be a little slower
   than 1.

1 vs. 2 is chosen according to how many constants and temps the shader needs.
2009-04-22 11:52:16 -06:00
Brian Paul
5c8fb6acc1 i965: define BRW_MAX_GRF 2009-04-22 11:47:59 -06:00
Brian Paul
21a422d97e i965: remove old code to init surface-related cache IDs
These types are only found in the new surface state cache now.
2009-04-22 11:29:49 -06:00
Brian Paul
c0c58cf5cf i965: comments, reformatting 2009-04-22 11:28:24 -06:00
Brian Paul
4843e54fc6 i965: actually use the new, second surface state cache 2009-04-22 11:12:07 -06:00
Brian Paul
f9af97c7a5 i965: checkpoint commit: use two state caches instead of one
The new, second cache will only be used for surface-related items.
Since we can create many surfaces the original, single cache could get
filled quickly.  When we cleared it, we had to regenerate shaders, etc.
With two caches, we can avoid doing that.
2009-04-22 11:08:46 -06:00
Brian Paul
a071a8d2e7 i965: remove unused state atom entries 2009-04-22 10:44:36 -06:00
Brian Paul
f428255bde i965: the brw_constant_buffer state atom is no longer dynamic
No more dynamic atoms so we can simplify the state validation code a little.
2009-04-22 09:23:15 -06:00
Brian Paul
e5681fc176 i965: add _NEW_PROGRAM_CONSTANTS to mesa_bits[] list 2009-04-22 09:16:21 -06:00
Brian Paul
a36dd5d54e i915: check the new _NEW_PROGRAM_CONSTANT flag 2009-04-22 09:14:53 -06:00
Brian Paul
1dbab84e21 i965: use _NEW_PROGRAM_CONSTANTS and always create new const buffers
When program constants change we create a new VS constant buffer
instead of re-using the old one.  This allows us to have several
const buffers in flight with vertex rendering.
2009-04-22 09:14:16 -06:00
Brian Paul
6b6a23c0f7 i965: updates to some debug code 2009-04-22 09:07:46 -06:00
Brian Paul
817dcdd280 i965: use new _NEW_PROGRAM_CONSTANTS flag instead of dynamic flags 2009-04-22 09:07:02 -06:00
Brian Paul
f48473e425 r200/r300/r500: add _NEW_PROGRAM_CONSTANTS flag
Make sure we detect constant buffer changes indicated by the new flag.
Should be able to remove _NEW_PROGRAM (and _NEW_MODELVIEW, _NEW_LIGHT, etc)
from several places (someday.
2009-04-22 08:59:47 -06:00
Dave Airlie
466c78c935 Merge remote branch 'origin/master' into radeon-rewrite 2009-04-22 21:41:57 +10:00
Richard Li
604dd37f66 R6xx/R7xx: remove unused files 2009-04-21 15:04:54 -04:00
Richard Li
581093d27c R6xx/R7xx: add updated reg file 2009-04-21 14:30:52 -04:00
Richard Li
27c07b6b28 Initial pull of code from r6xx-r7xx-support branch
Not functional yet.
2009-04-21 12:54:20 -04:00
Brian Paul
e8807a14a6 fixed intel front-buffer rendering segfault 2009-04-20 16:13:04 -06:00
Brian Paul
c38397866d intel: added null screen->dri2.loader pointer check
Fixes front-buffer rendering with DRI1.
2009-04-20 16:12:16 -06:00
Brice Goglin
d7b9a6c9ef Add patch by Aurelien Jarno to fix FTBPS on kfreebsd-i386 2009-04-20 12:36:44 +02:00
Maciej Cencora
65fe0c86ff r300: fix missing function declaration 2009-04-19 15:04:54 -04:00
Maciej Cencora
bcef4b63eb r300: revert part of cb4bef7ae0
Some debugging code got there by accident
2009-04-19 15:04:44 -04:00
Maciej Cencora
78878a13fe r300: cleanup includes 2009-04-19 22:15:05 +10:00
Maciej Cencora
a2d49eeaeb r300: move common fp functions to seperate file 2009-04-19 22:15:01 +10:00
Maciej Cencora
300661d12a r300: more r300/r500 unification
reuse insert_WPOS_trailer function
2009-04-19 22:14:56 +10:00
Maciej Cencora
155cc1647f r300: more prepare for merge 2009-04-19 22:14:53 +10:00
Maciej Cencora
97104c2559 r300: further r300/r500 merge preparation 2009-04-19 22:14:50 +10:00
Maciej Cencora
33af54af0d r300: merge r300/r500 fragment program compiler structure 2009-04-19 22:14:46 +10:00
Maciej Cencora
aa04e7d475 r300: merge r300/r500 fragment program structures 2009-04-19 22:14:42 +10:00
Maciej Cencora
27d4546f60 r300: r300/r500 fp shader merge WIP 2009-04-19 22:14:39 +10:00
Maciej Cencora
cb4bef7ae0 r300: general cleanup
- remove unused fields
- remove unused defines and macros
- flatten one structure
2009-04-19 22:14:36 +10:00
Maciej Cencora
b552446b95 r300: remove unnecessary forward function declaration 2009-04-19 22:13:06 +10:00
Maciej Cencora
3fd0084154 r300: context creation cleanup
- move constant values initialization to seperate function
- remove obvious comments
2009-04-19 22:12:31 +10:00
Dave Airlie
3230cb5f53 radeon: update clear state with latest intel code 2009-04-19 22:04:42 +10:00
Julien Cristau
4f2bc058f3 Add patch by Samuel Thibault to fix FTBFS on hurd-i386. 2009-04-19 00:46:32 +02:00
Julien Cristau
909afc5304 Adjust libgl1-mesa-glx and libgl1-mesa-dri package relationships
Drop the dependency on libgl1-mesa-glx from -dri, and make -glx
recommend -dri instead.  The dri drivers are also loaded by the X
server, which doesn't need libGL.  On the other hand, libGL needs one of
the dri drivers for direct rendering (either software or hardware).
Mark libgl1-mesa-dri as breaking old xserver-xorg-core and
libgl1-mesa-glx, to avoid incompatibilities.
2009-04-18 22:28:35 +02:00
Julien Cristau
4deb679b42 Make libgl1-mesa-dri 'Architecture: any'
swrast_dri.so should get built everywhere.
2009-04-18 22:27:51 +02:00
Brian Paul
dce84002c2 docs: create 7.4.2 release notes page 2009-04-18 11:12:41 -06:00
Brian Paul
c490349825 docs: remove unused sections 2009-04-18 11:12:33 -06:00
Brian Paul
f62d45fd0d docs: MD5 sums for 7.4.1 release 2009-04-18 11:03:25 -06:00
Brian Paul
b2dfc29a82 intel: update driver date, remove RC3 designation 2009-04-18 10:51:41 -06:00
Brian Paul
7c1e61f41c mesa: bump version to 7.4.1 2009-04-18 10:49:35 -06:00
Brian Paul
5654197d12 docs: prep for 7.4.1 release 2009-04-18 10:49:08 -06:00
Brian Paul
87cb55e9c6 mesa: bump version to 7.4.1 2009-04-18 10:48:57 -06:00
Brian Paul
e7d499f935 mesa: add switch case for GL_VERTEX_STATE_PROGRAM_NV in _mesa_new_program()
Fixes bug seen in progs/tests/vptest1.c

(cherry picked from master, commit c5af2ed60f)
2009-04-18 10:21:00 -06:00
Michel Dänzer
51e7600d77 intel: Handle ARB_vertex_buffer_object state in intel_clear_tris().
Fixes gearsvbo app by Michael Clark.
(cherry picked from commit 54fb6f0053)
2009-04-18 15:53:08 +02:00
Brian Paul
69b17abd6b intel: make sure polygon mode is set properly in intel_clear_tris()
Fixes progs/glsl/skinning.c demo.

(cherry picked from master, commit 794d488e6d)
2009-04-17 16:14:39 -06:00
Maciej Cencora
9028335371 r300: we always want non NDC coords format for swtcl 2009-04-17 11:27:36 +10:00
Maciej Cencora
d7d5c97a21 r300: cleanup frag prog setup a little
Use proper fields for marking if fp is translated, and if is translated succesfully.
Now if fp gets translated (even unsuccesfully) fp->translated is true. If the translation failed (i.e. because we exceeded limit of
maximum texture indirections) the fp->error is set. With a little updated fallback function it prevents non native fragment programs
from beeing translated with every frame (the translation would fail anyway so there's no point to try again).

Also implement IsProgramNative function for GL_FRAGMENT_PROGRAM_ARB (it should give some performance boost in apps that checks if
program is native and falls back to simpler shader to meet hw limits if necessary) and cleanup indentation (remove whitespaces on empty
lines).
2009-04-17 11:27:31 +10:00
Maciej Cencora
a92bc56e24 r300: update r500 path for reordered WPOS and FOG fp attributes
Report and regression testing by Fabio Pedretti.
2009-04-17 11:27:27 +10:00
Brian Paul
a975da7aca docs: fixed user clip plane restore bug in glPopAttrib() 2009-04-16 10:16:38 -06:00
Brian Paul
ecf47b5046 mesa: fix bad mask bit in clip plane restore code for glPopAttrib()
(cherry picked from master commit d82876e850)
2009-04-16 10:16:26 -06:00
Brian Paul
fed8dc53ad mesa: add distclean target to top-level Makefile
(cherry picked from master, commit 666702baec)
2009-04-16 09:34:06 -06:00
Brian Paul
1f462e26c0 demos: use larger buffer for snprintf() call, see bug 21220
(cherry picked from master, commit 0d0028e6df)
2009-04-16 09:26:54 -06:00
Dave Airlie
3264352c57 dri: attempt to actually refcount the __DRIDrawable
valgrind was showing a race between the drawable getting destroyed
by the X resource freeing code, and the context getting destroyed
later and freeing the drawable.

However I've no idea if some other combination of things could cause
this code to leak.
2009-04-16 13:06:24 +10:00
Dave Airlie
143b416af6 radeon: take a bo reference when adding to validate list 2009-04-16 13:06:08 +10:00
Ian Romanick
85396d8ef4 intel: Bump driver date 2009-04-15 15:12:48 -07:00
Ian Romanick
f11b84998d docs: more bug fixes for Mesa 7.4.1 2009-04-15 15:10:33 -07:00
Julien Cristau
5d4659e7c7 Install pkgconfig files for libGLU, libOSMesa and libGLw. 2009-04-15 21:31:24 +02:00
Julien Cristau
c422347bee Make libgl1-mesa-dev and mesa-common-dev 'Architecture: any'.
This gets rid of uninstallability when a new upstream version
isn't built on all architectures, and allows us to ship potentially
arch-specific .pc files.
2009-04-15 21:25:17 +02:00
Brian Paul
d2f6791062 glx: added null pointer check in glXGetFBConfigs()
Fixes segfault seen with glxinfo with NVIDIA OpenGL.

(cherry picked from master, commit 05471828dc)
2009-04-15 08:02:38 -06:00
Jerome Glisse
1fd76ae930 r200: fix texture level for compiz case 2009-04-12 15:51:31 +02:00
Jerome Glisse
02b130fd4b r200: validate vertex buffer 2009-04-12 14:25:36 +02:00
Jerome Glisse
8181f8fbf9 radeon: emit scissor when using cs path 2009-04-12 13:11:06 +02:00
Ian Romanick
49e0c74ddd DRI2: Don't fault on NULL DrawBuffer
It is possible for ctx->DrawBuffer to be NULL, so don't fault when
that happens.  This change is not being committed to master because it
doesn't appear to be necessary there.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2009-04-11 20:24:15 -07:00
Alex Deucher
9b162cdda7 Fix build errors from merge 2009-04-10 17:36:31 -04:00
Alex Deucher
04f335fd16 Merge branch 'radeon-rewrite' of git+ssh://agd5f@git.freedesktop.org/git/mesa/mesa into r6xx-rewrite 2009-04-10 17:16:08 -04:00
Alex Deucher
c0419f190c Remove r500 stuff 2009-04-10 16:36:18 -04:00
Eric Anholt
83e14773c5 dri2: Don't crash if the server returns more buffers than expected.
(cherry picked from commit f967e8b507)
2009-04-09 15:15:33 -07:00
Ian Romanick
4605937843 intel / DRI2: Accept fake front-buffer from loader
Handle the loader returning a fake front-buffer.  Since the driver
never specifically requests a fake front-buffer, the driver assumes
that it will never receive both a fake and a real front-buffer.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Kristian Høgsberg <krh@redhat.com>
(cherry picked from commit 6a6e478e55)
2009-04-09 14:44:53 -07:00
Ian Romanick
b8ef30c45c DRI2: Assume that there is always a front buffer
Assume that the front-buffer exists even if the server didn't tell the
client that it exists.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Kristian Høgsberg <krh@redhat.com>
(cherry picked from commit e6386e0d9a)
2009-04-09 14:44:44 -07:00
Ian Romanick
4f17040cb1 intel / DRI2: Track and flush front-buffer rendering
Track two flags:  whether or not front-buffer rendering is currently
enabled and whether or not front-buffer rendering has been enabled
since the last glFlush.  If the second flag is set, the front-buffer
is flushed via a loader call back.  If the first flag is cleared, the
second flag is cleared at this time.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Kristian Høgsberg <krh@redhat.com>
(cherry picked from commit 43cf0d1eeb)
2009-04-09 14:44:34 -07:00
Ian Romanick
98c2c9ef8c DRI2: Provide an interface for drivers to flush front-buffer rendering
Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
Reviewed-by: Kristian Høgsberg <krh@redhat.com>
(cherry picked from commit 82634ee8df)
2009-04-09 14:44:17 -07:00
Alex Deucher
69edb8a156 R600/r700: add new cmdbuf macros 2009-04-09 16:05:50 -04:00
Brian Paul
d805c82068 mesa: fix potential recursive locking deadlock in _mesa_HashWalk()
If the walk callback called _mesa_HashRemove() we'd deadlock.

(cherry picked from master, commit deff099215)
2009-04-09 10:55:06 -06:00
Alex Deucher
e24e4ae2e8 R6xx/R7xx: r300 -> r600 symbols 2009-04-09 10:55:41 -04:00
Dave Airlie
5e361c47ab r300: fix color tiling 2009-04-09 10:51:10 +10:00
Maciej Cencora
1ec0efa7d3 r300: reorder fog coordinate and WPOS fp attributes
HW TCL path currently assumed fog, WPOS order. The order was inverted for SW TCL path.

This hopefully fixes rest of fog and WPOS related bugs.
Additionally fix some indentation, don't route unnecessary components of fog coordinates for performance reasons and simplify vertex
attribute emitting for SW TCL path.
2009-04-09 10:31:51 +10:00
Maciej Cencora
3b1d544001 r300: fix regression from swtcl rewrite
Fix wrong attribute emit and revert to previous behaviour of calculating VAP_OUT_VTX_FMT_1 register value.

We can't use r300VAPOutputCntl1 function because it assumes that all texture coords have 4 components and that is the case for HW TCL
path, but not for SW TCL.
2009-04-09 10:31:36 +10:00
Dave Airlie
d1a9b1f513 Merge remote branch 'origin/master' into radeon-rewrite
Conflicts:
	src/mesa/drivers/dri/r200/r200_tex.c
	src/mesa/drivers/dri/r300/r300_cmdbuf.c
	src/mesa/drivers/dri/r300/r300_context.h
	src/mesa/drivers/dri/r300/r300_swtcl.c
	src/mesa/drivers/dri/r300/r300_tex.c
	src/mesa/drivers/dri/r300/r300_texmem.c
	src/mesa/drivers/dri/r300/r300_texstate.c
	src/mesa/drivers/dri/radeon/radeon_tex.c
2009-04-09 10:31:08 +10:00
Julien Cristau
3d81e934e5 Upload to unstable. 2009-04-08 23:53:54 +01:00
Alex Deucher
4138bdb3b1 R600: initial copy of r300 code 2009-04-08 15:16:35 -04:00
Brian Paul
6c3bec4387 swrast: fix point rendering function selection
Need to clamp default point size to min/max range before checking if it's one.
Fixes glean pointAtten test.

(cherry picked from master, commit 228f20e324)
2009-04-07 13:44:50 -06:00
Alex Deucher
90ffce4973 radeon: fix compiler warning 2009-04-07 12:37:10 -04:00
Brian Paul
7d3561c871 docs: more bug fixes for Mesa 7.4.1 2009-04-07 08:37:22 -06:00
Brian Paul
5c47d53924 mesa: in mesa_add_named_constant(), avoid adding duplicate constants
(cherry picked from master, commit 80197a0c1b)
2009-04-07 08:35:01 -06:00
Brian Paul
a18216308a mesa: fix parameter counting in ARB vertex/fragment program parsing
Duplicated unnamed constants were getting counted more than once.

(cherry picked from master, commit 866bdd0509)
2009-04-07 08:34:32 -06:00
Brian Paul
14f13fbcfa mesa: replace >= with > when testing if we've exceeded max local params
Now a program that uses 256 locals works as it should.

(cherry picked from master, commit a4173956eb)
2009-04-07 08:34:04 -06:00
Brian Paul
ca24095c1e mesa: only clear matrix MAT_DIRTY_INVERSE flag when we actually compute the inverse
If _math_matrix_analyse() got called before we allocated the inverse
matrix array we could lose the flag indicating that we needed to compute
the inverse.  This could happen with certain vertex shader cases.

(cherry picked from master, commit ce461ffc5a)
2009-04-07 08:33:43 -06:00
Brian Paul
d5e0e03d43 mesa: for OPCODE_LIT, use _mesa_pow() instead of exp() and log()
Also, s/pow/_mesa_pow/

(cherry picked from master, commit b8a200ac9d)
2009-04-07 08:32:42 -06:00
Maciej Cencora
e2ce1d80d1 r300: swtcl rewrite and cleanup
- remove unused variables
- silence compiler warnings
- fix twosided lighting
- fix point attenuation
- unify indentation
2009-04-07 21:08:40 +10:00
Dave Airlie
86556f8bda radeon/r200/r300: fix missing dma buffer validation
this make gnome shell run
2009-04-07 15:08:56 +10:00
Dave Airlie
23478f1c03 radeon: fix bocs wrapper 2009-04-07 15:08:56 +10:00
Jerome Glisse
741aaaa288 radeon: add support for new ttm 2009-04-06 11:58:08 +02:00
Michel Dänzer
775ca8e3fa radeon: Expose a 32 bit RGBA fbconfig even when the screen depth is 16.
Otherwise current xserver / libGL no longer expose a 32 bit RGBA GLX visual,
and compiz fails.

Fixes http://bugs.freedesktop.org/show_bug.cgi?id=20479 .

(Cherry picked from commit e798bf8053)
2009-04-06 09:27:17 +02:00
Brian Paul
39345a4928 mesa: don't normalize spot light direction until validation time
In glLight() we're only supposed to transform the direction by the modelview
matrix, not normalized it too.

(cherry picked from commit 650d147289)
2009-04-03 10:16:31 -06:00
Roland Scheidegger
7be149cfd1 mesa: fix TexParameter functions
premature return in TexParameterf caused mesa to never call Driver.TexParameter
breaking drivers relying on this (fix bug #20966).
While here, also fix using ctx->ErrorValue when deciding to call
Driver.TexParameter. Errors are sticky and uncleared errors thus would cause
this to no longer get called. Since we thus need return value of
set_tex_parameter[if] can also optimize this to only call when value changed.
2009-04-03 00:00:40 +02:00
Brian Paul
8c9d7b2474 docs: fix TXB texture unit bias error 2009-04-02 13:11:56 -06:00
Brian Paul
6ef0951b17 mesa: don't call ctx->Driver.ReadPixels() if width or height is zero
(cherry picked from commit master, 7b9bf39543)
2009-04-02 13:11:33 -06:00
Brian Paul
2b33b77337 mesa: don't call ctx->Driver.Draw/CopyPixels() if width or height is zero
(cherry picked from master, commit f6a3f1f52a)
2009-04-02 13:10:41 -06:00
Brian Paul
0590edeea0 mesa: use correct tex unit lod bias for TXB instruction
(cherry picked from master, commit 1ab225017e)
2009-04-02 13:09:32 -06:00
Brian Paul
7511d76bd7 swrast: fix glDrawBuffer(GL_FRONT_AND_BACK)
We weren't putting the right colors into the back buffer in this mode.

(cherry picked from master, commit 9cc79fc2dc)
2009-04-02 13:07:53 -06:00
Dave Airlie
05304d41f2 radeon/r200/r300: fix up the whole buffer space checking.
This fixes up the buffer validation scheme, so that we keep a list
of buffers to validate so cmdbuf flushes during a pipeline get
all the buffers revalidated on the next emit.

This also fixes radeonFlush to not flush unless we have something
useful to send to the GPU, like a DMA buffer or something not state
2009-04-02 18:58:49 +10:00
Dave Airlie
4170216009 radeon/common: use glCtx not ctx 2009-04-02 14:47:51 +10:00
Dave Airlie
e00ef43d79 radeon/r200/r300: collapse context destruction down to a common path.
Context destruction was nearly the same over all the drivers,
so collapse it down.
2009-04-02 14:44:29 +10:00
Dave Airlie
104d542205 radeon: tiling support 2009-04-02 14:44:08 +10:00
Dave Airlie
617c5262c6 r300: fix qtdemo qt4 startup 2009-04-02 11:30:03 +11:00
Julien Cristau
99f159339e Prepare changelog for upload 2009-04-01 20:25:25 +02:00
Brian Paul
7f30aba920 docs: fix bug 20986 2009-04-01 07:39:43 -06:00
Brian Paul
4fa700260e glsl: fix texgen state variable tokens in emit_statevars()
This fixes broken variable indexing into the gl_Eye/ObjectPlaneS/T/R/Q arrays.
See bug 20986.

(cherry picked from master, commit f8dd6594bf)
2009-04-01 07:39:26 -06:00
Dave Airlie
f9d272fa41 radeon: go back and repick texture formats.
This might trip up some serious FBO users, will have to see, but
it avoids the slow paths for all the demos I have.
2009-04-01 16:13:30 +10:00
Dave Airlie
6e30fe4873 radeon: fixup render buffer cleanups
this fixes qtdemo-qt4 starting and a leak in glxgears exit
2009-04-01 15:41:58 +10:00
Brian Paul
781fb79c59 docs: first 7.4.1 bug fixes 2009-03-31 16:29:23 -06:00
Brian Paul
5b7e9f2f3a mesa: fix bug in GPU codegen for fixed-function two-sided lighting
The 'dots' register wasn't getting properly un-negated and un-swizzled
after emitting the code for back-face lighting.  So, if more than one
light source was enabled, the specular exponent for the next light source
was wrong.

During execution we were evaluating pow(x, y) where y was negative instead
of positive.  This led to the outcome being zero or NaN.

This fixes the occasional black triangles seen in isosurf when hacked to
enable two-sided lighting.

(cherry picked from master, commit 919f57078b)
2009-03-31 16:28:17 -06:00
Brian Paul
d4d4b63d7f docs: prep for Mesa 7.4.1 release notes 2009-03-31 16:26:24 -06:00
Jeremy Huddleston
9e9fe51acd Updated CPU_TO_LE32 to work on darwin 2009-03-31 14:59:28 -07:00
Jeremy Huddleston
b65bc1b6cb Fix compiling indirect.c when GLX_DIRECT_RENDERING is not defined 2009-03-31 14:48:19 -07:00
Jeremy Huddleston
6cb796f6fc Updated darwin config for when X11 is not in the same location as we're installing to
(cherry picked from commit 7817fea0b6)
2009-03-31 14:37:27 -07:00
Dave Airlie
d81a48757a radeon/dri2: if the depth buffer is 16-bit force cpp == 2
This is because the DDX always allocates using the drawable sizes.
which gives me twice the depth buffer I asked for, dumb.
2009-03-31 15:50:19 +10:00
Dave Airlie
2f3be8ab14 radeon: fix pixel readback for RGB8 tests 2009-03-31 14:43:14 +10:00
Dave Airlie
5ad32cfd21 r200: fix glean pixelFormats regression 2009-03-31 13:39:57 +10:00
Dave Airlie
5c7fc1cb8e r300: fix stencil clears 2009-03-31 20:10:48 +10:00
Dave Airlie
226c876a52 r200: only set all dirty on kernel clears 2009-03-31 10:46:27 +10:00
Dave Airlie
e1d1657493 radeon/r200: fix glean failures on readPixSanity since EXT_DEPTH_STENCIL support 2009-03-31 10:36:06 +10:00
Dave Airlie
1570bde279 r200: fix veclinear emission 2009-03-31 10:35:16 +10:00
Timo Aaltonen
4830fab603 update the changelog. 2009-03-30 10:41:39 +03:00
Timo Aaltonen
1e142bf63d Merge commit 'mesa_7_4' into debian-experimental 2009-03-30 10:38:45 +03:00
Dave Airlie
3b09f6544a radeon: fix readback problem for piglit tests 2009-03-30 12:28:55 +10:00
Brian Paul
de197cf991 docs: 7.4 release md5 sums 2009-03-27 19:12:16 -06:00
Brian Paul
bf1e6581a5 docs: set 7.4 release date 2009-03-27 18:57:39 -06:00
Brian Paul
80ec7843bc mesa: set VERSION=7.4 2009-03-27 18:57:23 -06:00
Brian Paul
366d6e8cd1 mesa: set version to 7.4 2009-03-27 18:57:07 -06:00
Ian Romanick
63ed288396 intel: Add extra, stronger flushes around CopyTexSubImage blits 2009-03-27 15:22:27 -07:00
Eric Anholt
88ce34f400 swrast: Add support for x8r8g8b8 fbconfig.
This lets swrast produce an fbconfig suitable for the root visual now that
the server's not allowing mismatched fbconfigs.
(cherry picked from commit 529d1d720e)
2009-03-27 15:20:09 -07:00
Ian Romanick
f535de8721 Mark current bits as 2009Q1-RC2 for Intel driver. 2009-03-26 15:32:29 -07:00
Eric Anholt
1db913f687 i965: Fix glFrontFacing in twoside GLSL demo.
This also cuts instructions by just using the existing bit in the payload
rather than computing it from the determinant in the SF unit and passing it
as a varying down to the WM.  Something still goes wrong with getting the
backface color right, but a simpler shader appears to get the right result.
(cherry picked from commit 699db6d842)
2009-03-26 15:15:51 -07:00
Eric Anholt
0e5d1f43af i965: Fix fog coordinate g,b,a values when glFrontFacing isn't used.
Previously, we would sample (f,glFrontFacing,undef,undef) instead of the
(f,0,0,1) that fragment.fogcoord is supposed to return.  Due to
glFrontFacing's presence in FOGC.y, we'll still give bad results there when
glFrontFacing is used.

Bug #19122, piglit testcase fp-fog.
(cherry picked from commit 411d913cce)
2009-03-26 15:15:27 -07:00
Eric Anholt
09c587ae55 i965: Clean up a bit of mess with unneeded variables in emit_interp.
(cherry picked from commit b013f945d8)
2009-03-26 15:15:14 -07:00
Brian Paul
775d8431e9 i965: separate emit_op() and emit_tex_op() functions
(cherry picked from commit a79186e29e)
2009-03-26 15:14:56 -07:00
Brian Paul
3217ea8a1d i965: minor clean-up, comments, etc.
(cherry picked from commit 9e7903e492)
2009-03-26 15:14:22 -07:00
Dave Airlie
8ed405cd37 radeon/r200/r300: set correct row stride for rbs 2009-03-26 13:24:21 +10:00
Dave Airlie
e757bf964f r300: check buffer sizes in non-tcl case + set correct VRAM limits 2009-03-26 13:24:21 +10:00
Dave Airlie
258686a973 radeon: fixup map/unmap texture to work with override BOs
if you hit this you've already failed but we shouldn't crash
2009-03-26 13:24:21 +10:00
Brian Paul
00aea5853d docs: mention Solaris updates in release notes 2009-03-25 21:08:21 -06:00
Brian Paul
20d34b50b5 mesa: bump version to 7.4 rc2 2009-03-25 21:06:41 -06:00
Dave Airlie
4d36a19c90 r200: add fbo files to the compile 2009-03-26 11:15:07 +10:00
Alan Coopersmith
9cff0acb36 define __builtin_expect for non-gcc compilers in two more glx files
Signed-off-by: Alan Coopersmith <alan.coopersmith@sun.com>
2009-03-25 16:26:03 -07:00
Alan Coopersmith
791b59493f mklib improvements for Solaris
Move flags for linking standard C/C++ libraries from configure.ac to mklib
Use -norunpath flag when linking with Sun C++ compiler
Convert mklib -exports list into a linker mapfile
Set FINAL_LIBS correctly when -noprefix is used

Signed-off-by: Alan Coopersmith <alan.coopersmith@sun.com>
2009-03-25 16:26:02 -07:00
Michel Dänzer
7dff7029fa Revert "dri2: Avoid round-tripping on DRI2GetBuffers for the same set of buffers."
This scheme breaks when the display connection doesn't receive ConfigureNotify
events. This caused reporoducible problems (cropped / misplaced output) when
starting a 3D application in a guest operating system in VMware Workstation.

This reverts commit dd1c68f151.

Conflicts:

	src/glx/x11/dri2_glx.c
(cherry picked from commit 11da7e02aa)
2009-03-25 15:55:20 +01:00
Brian Paul
f8fd9bc46b docs: update glext.h to version 48 2009-03-25 08:35:15 -06:00
Brian Paul
53f0e141c0 gl: update include/GL/glext.h to version 48 2009-03-25 08:35:02 -06:00
Julien Cristau
af3c568475 Prepare changelog for upload 2009-03-25 11:34:58 +01:00
Julien Cristau
7d01429512 Build-depend on linux-libc-dev >= 2.6.29 on linux archs.
The 2.6.28 kernel headers miss some compat defines.
2009-03-25 01:51:02 +01:00
Brian Paul
14a794300e demos: add LDFLAGS for corender target, bug 20844
(cherry picked from commit c4c4358e08)
2009-03-24 16:09:23 -06:00
Dave Airlie
f577c8e462 radeon/r200/r300: fix warnings 2009-03-24 18:32:46 +10:00
Dave Airlie
5021b47dd3 r300: remove lock.h link 2009-03-24 15:21:49 +10:00
Dave Airlie
20981c0a0b radeon: fixup some issue with fbos and sw fallbacks 2009-03-24 15:06:19 +10:00
Dave Airlie
0a725db10c radeon/r200/r300: set the texture depth correctly for DRI2 2009-03-24 11:19:09 +10:00
Dave Airlie
ccd18f462c radeon: actual format is rgba8 2009-03-24 09:45:26 +10:00
Dave Airlie
2aa097f963 radeon: fix typo 2009-03-24 09:45:18 +10:00
Dave Airlie
28e082197d radeon: setup pipes for r300 2009-03-24 09:28:52 +10:00
Dave Airlie
9f11b3311e radeon: stupid mesa extension fail 2009-03-24 09:26:31 +10:00
Eric Anholt
912ec292c1 i965: Fix occlusion query when no other WM state updates occur.
Turns out that XXX comment was important.  We weren't flagging the WM to
re-update with the statistics enable, so we got zeroes out of our query.

Bug #20740, fixes piglit occlusion_query test.

Signed-off-by: Eric Anholt <eric@anholt.net>
(cherry picked from commit c0d6e07909)
2009-03-23 12:49:31 -07:00
Tom Fogal
e814b5ae2f mesa: fix _glxapi_get_proc_address() for mangled names
(cherry picked from commit 7399d56ec6)
2009-03-23 12:49:13 -07:00
Brian Paul
0fea05915a glapi: update find_entry() for mangled names
(cherry picked from commit 4447fddc82)
2009-03-23 12:49:05 -07:00
Brian Paul
dfa44f0ff9 mesa: regenerated gl_mange.h file
(cherry picked from commit fe0ccf323d)
2009-03-23 12:48:56 -07:00
Julien Cristau
8d088cd34f update changelog 2009-03-23 17:25:04 +01:00
Julien Cristau
094d627885 Merge tag 'mesa_7_4_rc1' into debian-experimental 2009-03-23 17:21:26 +01:00
Brian Paul
f850ff2bcc mesa: remove unused 'out' label 2009-03-23 08:27:00 -06:00
Brian Paul
66f972ab55 Add Solaris to OS'es using PROT_EXEC mmap() to get executable heap space
Signed-off-by: Alan Coopersmith <alan.coopersmith@sun.com>

(cherry picked from master, commit a06dd4de87)
2009-03-23 08:18:48 -06:00
Dave Airlie
f9d3de06bd radeon: fixup wrapper bo name 2009-03-23 19:32:10 +10:00
Dave Airlie
cb68588c93 Merge branch 'radeon-fbo-hacking' into radeon-rewrite 2009-03-23 18:56:34 +10:00
Dave Airlie
8c7e30fb95 raedon/r200/r300: mega-FBO commits.
Re work depth issues.
Do a lot more FBO abstactions
fixup depth/stencil buffer interactions
2009-03-23 18:54:06 +10:00
Dave Airlie
c607a664dd radeon fbo: add draw offset calcs 2009-03-22 19:11:46 +10:00
Dave Airlie
4a2cb696cc radeon/r200/r300: add support for new tfp interface
also fixup old interface, gets rid of white boxes in compiz
2009-03-22 12:03:24 +10:00
Dave Airlie
2d26d4ac66 Merge remote branch 'origin/master' into HEAD 2009-03-22 12:01:21 +10:00
Dave Airlie
06cb6f7aa7 radeon: use mipmap fns in FBO code 2009-03-22 11:57:03 +10:00
Dave Airlie
0968512f8f radeon: add miptree offset functions 2009-03-22 11:56:41 +10:00
Dave Airlie
c73f4fdb65 r200: fix for sure 2009-03-21 22:41:42 +10:00
Dave Airlie
4bd5ee2d97 radeon/r200: oops make correct fbo init calls 2009-03-21 22:35:01 +10:00
Dave Airlie
9f7a03d945 radeon: add xRGB span functions
same as ARGB need to add a parameter to get ptr32
2009-03-21 21:42:54 +10:00
Dave Airlie
218083c542 radeon: dri2 is hooked up elsewhere now 2009-03-21 22:38:28 +11:00
Dave Airlie
98f1b1e6f9 radeon/r200: add fbo init 2009-03-21 22:38:11 +11:00
Dave Airlie
6c48c93a53 radeon/r200: add fbo state changes 2009-03-21 22:36:18 +11:00
Dave Airlie
712478cfdd r300: fix viewport inversion for FBOs 2009-03-21 22:27:01 +11:00
Dave Airlie
8ab7c77dc2 radeon: align FBO pitch 2009-03-21 18:16:21 +10:00
Dave Airlie
56c5df33de radeon: fixup last missing x_off/y_off 2009-03-21 18:16:02 +10:00
Dave Airlie
8a60083676 radeon: add cpp/pitch to rrb 2009-03-21 18:07:33 +10:00
Dave Airlie
e795bd3c90 radeon/fbo: add x_off and y_off in correct places 2009-03-21 18:05:54 +10:00
Dave Airlie
86dcbb5457 radeon: dPriv handling is now in cliprects code 2009-03-21 16:51:46 +10:00
Dave Airlie
9368dcb426 radeon: fixup span code for FBOs 2009-03-21 16:08:20 +10:00
Dave Airlie
fbda2ad445 r300: hw clear buffer 0 hopefully 2009-03-21 15:05:34 +10:00
Dave Airlie
ffde891a03 radeon: fix up span function setting 2009-03-21 14:31:14 +10:00
Brian Paul
17db2db9dc docs: prep for 7.4 release 2009-03-20 17:34:54 -06:00
Brian Paul
dba79af9bc mesa: prep for 7.4-rc1 release 2009-03-20 17:26:04 -06:00
Brian Paul
b009a32bf4 r300: don't crash on sw tcl hw if point size vertex attrib is sent
(cherry picked from master, commit 005ad1a71d)
2009-03-20 08:49:39 -06:00
Dave Airlie
22443d5cc0 r300: init fbos 2009-03-20 22:34:30 +10:00
Dave Airlie
ba890ad35b more fbo fillin 2009-03-20 22:29:15 +10:00
Dave Airlie
e3faf5b51d r300: enable FBO for a test 2009-03-20 22:15:22 +10:00
Dave Airlie
230abc06f8 radeon: some more fbo work 2009-03-20 22:07:05 +10:00
Dave Airlie
fabce837f9 radeon: initial couch code copy from radeon 2009-03-20 18:23:38 +10:00
Dave Airlie
407e8ae5b1 Merge remote branch 'main/master' into radeon-rewrite
Conflicts:
	src/mesa/drivers/dri/r300/r300_cmdbuf.c
	src/mesa/drivers/dri/r300/r300_state.c
	src/mesa/drivers/dri/r300/r300_swtcl.c
	src/mesa/drivers/dri/r300/radeon_ioctl.c
	src/mesa/drivers/dri/radeon/radeon_screen.c
2009-03-20 10:52:17 +10:00
Dave Airlie
bdaa0341ca radeon/r200/r300: cleanup some of the renderbuffer code 2009-03-19 15:31:03 +10:00
Dave Airlie
c0c06803fe radeon: fix up locking like the intel driver for pageflip/swaps 2009-03-19 14:46:52 +10:00
Brian Paul
7122490982 mesa: avoid setting texObj->_Complete = GL_FALSE when there's no state change
Avoid a little bit of unneeded state validation and fixes a bug where the
texture complete flags was set to false, but we didn't signal _NEW_TEXTURE.

Fixes piglit tex1d-2dborder failure.
(cherry picked from commit aad3f546a0)
2009-03-18 14:47:47 -07:00
Brian Paul
6ada1d47d9 mesa: add no-change testing for a few more texture parameters
(cherry picked from commit 37c768b36a)
2009-03-18 10:54:09 -07:00
Robert Ellison
55865335f4 i965: fix polygon stipple when rendering to FBO
The polygon stipple pattern, like the viewport and the
polygon face orientation, must be inverted on the i965
when rendering to a FBO (which itself has an inverted pixel
coordinate system compared to raw Mesa).

In addition, the polygon stipple offset, which orients
the stipple to the window system, disappears when rendering
to an FBO (because the window system offset doesn't apply,
and there's no associated FBO offset).

With these fixes, the conform triangle and polygon stipple
tests pass when rendering to texture.
(cherry picked from commit 29309b45b0)
2009-03-18 10:47:24 -07:00
Robert Ellison
918e5221ef i965: fix polygon face orientation when rendering to FBO
In the i965, the FBO coordinate system is inverted from the standard
OpenGL/Mesa coordinate system; that means that the viewport and the
polygon face orientation have to be inverted if rendering to a FBO.

The viewport was already being handled correctly; but polygon face
was not.  This caused a conform failure when rendering to texture with
two-sided lighting enabled.

This fixes the problem in the i965 driver, and adds to the comment about
the gl_framebuffer "Name" field so that this isn't a surprise to other
driver writers.
(cherry picked from commit 6dceeb2eb8)
2009-03-18 10:47:24 -07:00
Brian Paul
9feb26584a swrast: use better _swrast_compute_lambda() function
The MAX-based function can produce values that are non-monotonic for a span
which causes glitches in texture filtering.  The sqrt-based one avoids that.

This is perhaps slightly slower than before, but the difference
probably isn't noticable given we're doing software mipmap filtering.

Issue reported by Nir Radian <nirr@horizonsemi.com>

(cherry picked from master, commit c334ce273e)
2009-03-17 10:34:45 -06:00
Ian Romanick
a8528a2e86 Mark current bits as 2009Q1-RC1 for Intel driver. 2009-03-16 13:39:32 -07:00
Michel Dänzer
aa85973f95 Fixup previous commit.
radeonScheduleSwap() already takes the lock in the SwapBuffers case, only
the CopySubBuffer case was missing it.
2009-03-16 12:51:50 +01:00
Michel Dänzer
9c591c52c7 radeon: Take the hardware lock for swaps and flips.
Otherwise they fail with AIGLX at least.
2009-03-16 11:33:14 +01:00
Brian Paul
119360cccd i965: init dest reg CondMask = COND_TR (the proper default)
Plus fix up a debug printf.
(cherry picked from commit 20f49252e1)
2009-03-13 17:38:40 -07:00
Brian Paul
ac2216542d glsl: fix vec4_texp_rect IR code (need projective version) (cherry picked from commit ad2cfa4199) 2009-03-13 17:38:40 -07:00
Brian Paul
37e5c057f1 i965: check if we run out of GRF/temp registers
Before this change we would up emitting instructions with invalid register
numbers.  This typically (but not always) hung the GPU.  For now, just
prevent emitting bad instructions to avoid hangs.  Still need to do some
kind of proper error recovery.
(cherry picked from commit e60b3067d8)
2009-03-13 17:38:40 -07:00
Brian Paul
4d9b8e0f93 mesa: added _mesa_fprintf() wrapper (cherry picked from commit 596b8fbbbf) 2009-03-13 17:38:40 -07:00
Brian Paul
c1b71f46b5 i965: fix emit_math1() function used for scalar instructions
Instructions such as RCP, RSQ, LOG must smear the result of the function
across the dest register's X, Y, Z and W channels (subject to write masking).
Before this change, only the X component was getting written.

Among other things, this fixes cube map texture sampling in GLSL shaders
(since cube lookups involve normalizing the texcoord).
(cherry picked from commit 3485801978)
2009-03-13 17:38:39 -07:00
Brian Paul
4a25ac9564 i965: rewrite the code for handling shader subroutine calls
Previously, the prog_instruction::Data field was used to map original Mesa
instructions to brw instructions in order to resolve subroutine calls.  This
was a rather tangled mess.  Plus it's an obstacle to implementing dynamic
allocation/growing of the instruction buffer (it's still a fixed size).

Mesa's GLSL compiler emits a label for each subroutine and CAL instruction.
Now we use those labels to patch the subroutine calls after code generation
has been done.  We just keep a list of all CAL instructions that needs patching
and a list of all subroutine labels.  It's a simple matter to resolve them.

This also consolidates some redundant post-emit code between brw_vs_emit.c and
brw_wm_glsl.c and removes some loops that cleared the prog_instruction::Data
fields at the end.

Plus, a bunch of new comments.
(cherry picked from commit c51c822ee0)
2009-03-13 17:38:39 -07:00
Eric Anholt
35d965b39b intel: Fix bpp setting of blits to 8bpp targets.
This was causing hangs in cairogears, as we would blit to the 8bpp target
(A8 texture) as 16bpp, and stomp over state objects.
(cherry picked from commit 19e134051c)
2009-03-13 17:38:39 -07:00
Robert Ellison
d0aab00609 i965: add software fallback for conformant 3D textures and GL_CLAMP
The i965 hardware cannot do GL_CLAMP behavior on textures; an earlier
commit forced a software fallback if strict conformance was required
(i.e. the INTEL_STRICT_CONFORMANCE environment variable was set) and
2D textures were used, but it was somewhat flawed - it could trigger
the software fallback even if 2D textures weren't enabled, as long
as one texture unit was enabled.

This fixes that, and adds software fallback for GL_CLAMP behavior with
1D and 3D textures.

It also adds support for a particular setting of the INTEL_STRICT_CONFORMANCE
environment variable, which forces software fallbacks to be taken *all*
the time.  This is helpful with debugging.  The value is:
   export INTEL_STRICT_CONFORMANCE=2
(cherry picked from commit 3468315087)
2009-03-13 17:38:39 -07:00
Brian Paul
ef33d0f103 mesa: don't draw arrays if vertex position array is not enabled
For regular GL, we must have vertex positions in order to draw.  But ES2
doesn't have that requirement (positions can be computed from any array
of data).

See bug 19911.
(cherry picked from commit 97dd2ddbd9)
2009-03-13 17:38:39 -07:00
Robert Ellison
349b819768 i965: texture fixes: bordered textures, fallback rendering
i965 doesn't natively support GL_CLAMP; it treats it like
GL_CLAMP_TO_EDGE, which fails conformance tests.

This fix adds a clause to the check_fallbacks() test to check
whether GL_CLAMP is in use on any enabled 2D texture.  If so,
and if strict conformance is required (via INTEL_STRICT_CONFORMANCE),
a software fallback is mandated.

In addition, validate textures *before* checking for fallbacks,
rather than after; otherwise, the texture state is never validated
and can't be trusted.  (In particular, if texturing is enabled and
the sampler would access any level beyond level 0 of a texture, the
sampler will segfault, because texture validation sets the firstLevel
and lastLevel fields of a texture object so that the valid levels
will be mapped and accessed correctly.  If texture validation doesn't
occur, only level 0 is accessed correctly, and that only because
firstLevel and lastLevel happen to be set to 0.)
(cherry picked from commit 17c7852bf9)
2009-03-13 17:38:39 -07:00
Dave Airlie
50443db882 texmem: fix typo from brianp's changes.
Reported by cjb via tinderbox on irc
(cherry picked from commit 487a55af78)
2009-03-13 17:38:39 -07:00
Brian Paul
c503cacb53 mesa: use an array for current texture objects
Use loops to consolidate lots of texture object code.
(cherry picked from commit 9818734e01)
2009-03-13 17:38:39 -07:00
Brian Paul
e862b4e38f mesa: use an array for default texture objects
Replace Default1D/2D/3D/Cube/etc with DefaultTex[TEXTURE_x_INDEX].
The same should be done with the Current1D/2D/3D/etc pointers...
(cherry picked from commit 4d24b639d1)
2009-03-13 17:38:39 -07:00
Robert Ellison
e9dfc858fb Fix an i965 assertion failure on glClear()
While running conform with render-to-texture:

	conform -d 33 -v 2 -t -direct

the i965 driver failed this assertion:

intel_clear.c:77: intel_clear_tris: Assertion `(mask & ~((1 << BUFFER_BACK_LEFT) | (1 << BUFFER_FRONT_LEFT) | (1 << BUFFER_DEPTH) | (1 << BUFFER_STENCIL))) == 0' failed.

The problem is that intel_clear_tris() is called by intelClear() to
clear any and all of the available color buffers, but intel_clear_tris()
actually only handles the back left and front left color buffers; so
the assertion fails as soon as you try to clear a non-standard color
buffer.

The fix is to have intelClear() only call intel_clear_tris() with
buffers that intel_clear_tris() can support.  intelClear() already backs
down to _swrast_Clear() for all buffers that aren't handled explicitly.
(cherry picked from commit 0ccbc3c905)
2009-03-13 17:38:39 -07:00
Brian Paul
5efbca1e21 intel: fix datatype typo, s/GLboolean/GLuint/
Fixes mysterious failures in glean glsl1 test.
(cherry picked from commit da2b661ee4)
2009-03-13 17:38:39 -07:00
Kristian Høgsberg
d6d8663a88 intel: Fix intelSetTexBuffer miptree leak.
The intelImage also holds a reference to the miptree, so unref that as well.
(cherry picked from commit 5b354d39d4)
2009-03-13 17:38:39 -07:00
Eric Anholt
13990bd98a intel: tell libdrm whether we want a cpu-ready or gpu-ready BO for regions.
This lets us avoid allocing new buffers for renderbuffers, finalized miptrees,
and PBO-uploaded textures when there's an unreferenced but still active one
cached, while also avoiding CPU waits for batchbuffers and CPU-uploaded
textures.  The size of BOs allocated for a desktop running current GL
cairogears on i915 is cut in half with this.

Note that this means we require libdrm 2.4.5.
(cherry picked from commit 40dd024be6)
2009-03-13 17:38:39 -07:00
Eric Anholt
def630d0a2 i965: Fix render target read domains.
We were asking for something illegal (write_domain != 0 && read_domains !=
write_domain) because at the time of writing the region surfaces were used
for texturing occasionally as well, and we weren't really clear on the model
GEM was going to use.

This reliably triggered a kernel bug with domain handling, resulting in
oglconform mustpass.c failure.  Of course, it only became visible after
01bc4d441f cleaned up some gratuitous flushing.
(cherry picked from commit 078e8a61b2)
2009-03-13 17:38:39 -07:00
Eric Anholt
ca2564f1e6 intel: Don't do the extra MI_FLUSH in flushing except when doing glFlush().
Everything other than "make sure the last rendering ends up visible on the
screen" doesn't need that behavior.
(cherry picked from commit 01bc4d441f)
2009-03-13 17:38:38 -07:00
Eric Anholt
711a57f7c7 intel: don't crash when dri2 tells us about buffers we don't care about. (cherry picked from commit f82f1ffba9) 2009-03-13 17:38:38 -07:00
Eric Anholt
058cf2fff1 dri2: Initialize variables for the getbuffers round-trip reduction.
Missed setting the initial values which usually didn't hurt at runtime.
(cherry picked from commit 680c708dee)
2009-03-13 17:38:38 -07:00
Eric Anholt
715f509c5d intel: Fix tri clear to do FBO color attachments as well.
This is a 2% win in fbo_firecube, and would avoid a sw fallback for
masked clears.
(cherry picked from commit fd51cf1531)
2009-03-13 17:38:38 -07:00
Eric Anholt
e704e6c6f3 i965: Fix fallback on stencil drawing to fbo when the visual lacks stencil.
Noticed this with the fbotexture demo.
(cherry picked from commit c06f4e2a37)
2009-03-13 17:38:38 -07:00
Brian Paul
01f34e667a i965: need to disable current shader, if any, in intel_clear_tris()
Fixes bad background in all the progs/glsl/ tests.
(cherry picked from commit 60b3fe6c19)
2009-03-13 17:38:38 -07:00
Eric Anholt
4d0a7b33c5 intel: Speed up glDrawPixels(GL_ALPHA) by using an alpha texture format. (cherry picked from commit 0b63f6449e) 2009-03-13 17:38:38 -07:00
Eric Anholt
fb1d2ed34c intel: Fix some state leakage of {Client,}ActiveTexture in metaops.
Found while debugging cairo-gl.
(cherry picked from commit d11981e0d7)
2009-03-13 17:38:38 -07:00
Eric Anholt
9395fedf98 i965: Remove brw->attribs now that we can just always look in the GLcontext. (cherry picked from commit 052c1d66a1) 2009-03-13 17:38:38 -07:00
Eric Anholt
9abc0d80af i965: Delete old metaops code now that there are no remaining consumers. (cherry picked from commit 14321fcfde) 2009-03-13 17:38:38 -07:00
Brian Paul
90e89c01df i965: init array->Format fields (see bug 19708) (cherry picked from commit 628b52241b) 2009-03-13 17:38:38 -07:00
Eric Anholt
790d93e362 intel: If we're doing a depth clear with tris, do color with it.
This is a 10% win on the ever-important glxgears not-a-benchmark.
(cherry picked from commit 67ee22c89f)
2009-03-13 17:38:38 -07:00
Eric Anholt
e9f3783169 i915: Only call CalcViewport from DrawBuffers instead of Viewport.
This saves an inadvertent round-trip to the X Server on DrawBuffers, which was
hurting some metaops.
(cherry picked from commit ac0dfbdf0f)
2009-03-13 17:38:38 -07:00
Brian Paul
e41780fedc intel: move some driver functions around
A step toward consolidating i915/intel_state.c and i965/intel_state.c
(cherry picked from commit 84c8b5bbf9)
2009-03-13 17:38:38 -07:00
Eric Anholt
d0edbbb3f3 intel: replace custom metaops clear with generic.
No real-world impact on performance seen.  Even glxgears seems to be, if
anything, happier.
(cherry picked from commit c96bac0950)
2009-03-13 17:38:38 -07:00
Brian Paul
e10119c23e intel: make intelUpdateScreenFromSAREA() static (cherry picked from commit aae2729aeb) 2009-03-13 17:38:38 -07:00
Brian Paul
208c087f39 intel: remove unused var (cherry picked from commit 66c7f06413) 2009-03-13 17:38:38 -07:00
Shaohua Li
0c8b40b42b i915: Add support for a new G33-like chipset.
Signed-off-by: Shaohua Li <shaohua.li@intel.com>
Signed-off-by: Eric Anholt <eric@anholt.net>
(cherry picked from commit 40290745ea)
2009-03-13 17:38:37 -07:00
Xiang, Haihao
5199f451bb i965: fix for RHW workaround
It is possible that an object whose vertices all are outside of a
view plane is passed to clip thread due to the RHW workaround. This
object should be rejected by clip thread. Fix bug #19879
(cherry picked from commit 68915fd6fa)
2009-03-13 17:38:37 -07:00
Brian Paul
dd7cde5230 i965: tell GLSL compiler to emit code using condition codes
The default for EmitCondCodes got flipped when gallium-0.2 was merged.
This fixes GLSL if/else/endif regressions.
Drivers that use GLSL should always explicitly set the flag to be safe.
(cherry picked from commit a9e753c84c)
2009-03-13 17:38:37 -07:00
Eric Anholt
ab5746e5d8 tdfx: Fix begin/endquery for current API. (cherry picked from commit 0cb295584f) 2009-03-13 17:38:37 -07:00
Brian Paul
3bd446c0ab i965: add missing break for OPCODE_RET case
This doesn't effect correctness, but we were emitting an extraneous ADD.
(cherry picked from commit 74b6d55864)
2009-03-13 17:38:37 -07:00
Brian Paul
9b78402ee4 mesa: more info in error messages (cherry picked from commit 1ca05a066b) 2009-03-13 17:38:37 -07:00
Brian Paul
cf1ef0f308 mesa: minor error msg improvement (cherry picked from commit 803504e69f) 2009-03-13 17:38:37 -07:00
Chris Wilson
fd1f65ba61 intel: Decode MI operands using specific length masks
The MI opcodes have different variable length masks, so use an operand
specific mask to decode the length.
(cherry picked from commit e92d97d75b)
2009-03-13 17:38:37 -07:00
Chris Wilson
967345b497 intel: Correct decoding of 3DSTATE_PIXEL_SHADER_CONSTANTS
A couple of minor typos that proclaimed an error in the wrong command, and
failed to offset the mask.
(cherry picked from commit 05d130a35a)
2009-03-13 17:38:37 -07:00
Ian Romanick
41ad853a6a glxgears: No, really. Fix the dyslexia. (cherry picked from commit 5b5ddfb89c) 2009-03-13 17:38:37 -07:00
Ian Romanick
842baa29cb Fix dyslexia. (cherry picked from commit 9d6880ec8d) 2009-03-13 17:38:37 -07:00
Ian Romanick
9556d870a1 glxgears: Log a message if synched to vblank
Tries to use either GLX_MESA_swap_control or GLX_SGI_video_sync to
detect whether the display is synchronized to the vertical blank.  If
it detects this, a message will be printed.  HOPEFULLY this will
prevent some of the bug reports such as "glxgears only gets 59.7fps.
What's wrong with my driver?"
(cherry picked from commit 58b9cd411f)
2009-03-13 17:38:37 -07:00
Brian Paul
42ce790086 mesa: refactor glTexParameter code (cherry picked from commit 318e53a4bf) 2009-03-13 17:38:37 -07:00
Robert Ellison
b17769af42 mesa: add missing texture_put_row_rgb() function in texrender.c
The wrap_texture() function doesn't set the renderbuffer PutRowRGB() method,
which is used to implement DrawPixels().  This fix adds an implementation
of this method.
(cherry picked from commit 523febe12e)
2009-03-13 17:38:37 -07:00
Brian Paul
9030277b0d intel: move glClear-related code into new intel_clear.c file (cherry picked from commit 4451eb2e75) 2009-03-13 17:38:37 -07:00
Brian Paul
a37a9bf769 intel: Move swap-related functions from intel_buffers.c to new intel_swapbuffers.c (cherry picked from commit 6fcebbe719) 2009-03-13 17:38:37 -07:00
Brian Paul
8afb8a8145 i965: scissor rect was inverted when rendering to texture (cherry picked from commit 3b23a8e07d) 2009-03-13 17:38:37 -07:00
Brian Paul
801f933694 mesa: consolidate glGetTexEnvi/f() code with new get_texenvi() helper (cherry picked from commit ad338c14c2) 2009-03-13 17:38:36 -07:00
Jesse Barnes
75ecd6ebbf intel: fix the mismerge of the vblank pipe enable sanity check
Fix the last merge fix, had the blocks ordered incorrectly.
(cherry picked from commit e57e398960)
2009-03-13 17:38:36 -07:00
Jesse Barnes
1cd7317fdb intel: move pipe enable sanity check to where it belongs
Bah, applied the patches in the wrong order, not Owain's fault...
(cherry picked from commit 216bff5fd4)
2009-03-13 17:38:36 -07:00
Owain Ainsworth
1865291701 intel: fix vblank crtc selection with DRI1 when only one pipe is enabled.
On Mobile chipsets, we often enable PipeB instead of PipeA, but the test
in here was insufficient, falling back to pipe A if the area
intersection returned zero. Therefore, in the case where a window went
off to the top of the left of the screen, it would freeze, waiting on
the wrong vblank.

Fix this mess by checking the sarea for a crtc being zero sized, and in
that case always default to the other one.
(cherry picked from commit 0b5266ff64)
2009-03-13 17:38:36 -07:00
Owain G. Ainsworth
3edbcce7d5 intel: Prevent an "irq is not working" printf when only pipe B is enabled.
intelMakeCurrent is called before intelWindowMoved (in fact, it calls
it), so calculation of the correct vblank crtc has not happened yet.
Fix this by making a function that fixes up a set of vblank flags and
call if from both functions.
(cherry picked from commit 39b4061bb9)
2009-03-13 17:38:36 -07:00
Robert Ellison
b1fb34d0ac i965: fix line stipple fallback for GL_LINE_STRIP primitives
When doing line stipple, the stipple count resets on each line segment,
unless the primitive is a GL_LINE_LOOP or a GL_LINE_STRIP.

The existing code correctly identifies the need for a software fallback
to handle conformant line stipple on GL_LINE_LOOP primitives, but
neglects to make the same assessment on GL_LINE_STRIP primitives.
This fixes it so they match.
(cherry picked from commit 73658ff04f)
2009-03-13 17:38:36 -07:00
Ian Romanick
606099f545 swrast: Enable GL_EXT_stencil_two_side (cherry picked from commit b5fbdef7ec) 2009-03-13 17:38:36 -07:00
Brian Paul
32e3142071 i965: minor improvements in brw_wm_populate_key() (cherry picked from commit 89fddf978c) 2009-03-13 17:38:36 -07:00
Brian Paul
66eea4e104 mesa: fix/update/restore comments related to two-sided stencil (cherry picked from commit a304cc6cca) 2009-03-13 17:38:36 -07:00
Brian Paul
e428cf3afd mesa: initialize ctx->Stencil._BackFace = 1
Back-face stencil operations didn't work correctly because this value was
zero.  It needs to be 1 or 2.  The only place it's set otherwise is in
glEnable/Disable(GL_STENCIL_TEST_TWO_SIDE_EXT).
(cherry picked from commit 2a968113a9)
2009-03-13 17:38:36 -07:00
Ian Romanick
842b5164d2 Track two sets of back-face stencil state
Track separate back-face stencil state for OpenGL 2.0 /
GL_ATI_separate_stencil and GL_EXT_stencil_two_side.  This allows all
three to be enabled in a driver.  One set of state is set via the 2.0
or ATI functions and is used when STENCIL_TEST_TWO_SIDE_EXT is
disabled.  The other is set by StencilFunc and StencilOp when the
active stencil face is set to BACK.  The GL_EXT_stencil_two_side spec has
more details.

http://opengl.org/registry/specs/EXT/stencil_two_side.txt
(cherry picked from commit dde7cb9628)
2009-03-13 17:38:36 -07:00
Brian Paul
a6f7e909a7 mesa: fix transposed red/blue in store_texel_rgb888/bgr888() functions
(cherry picked from master, commit 862dccd560)
2009-03-12 09:32:55 -06:00
Brian Paul
ca87e5a7bd mesa: add missing _glthread_INIT_MUTEX in _mesa_new_framebuffer()
(cherry picked from master, commit 81569c2f69)
2009-03-12 08:12:54 -06:00
Alan Hourihane
45c4b4dfbd xdemos: On termination with esc close the contexts correctly. 2009-03-11 13:36:26 +00:00
Dave Airlie
0fc6c2644c radeon: remove unused lines 2009-03-10 11:00:14 +10:00
Dave Airlie
14c3bddbac r200: enable hw clears 2009-03-10 19:03:07 +10:00
Brian Paul
2adaec1226 xmesa: set back-buffer's drawable field
Fixes back-buffer rendering when MESA_BACK_BUFFER=pixmap

(cherry picked from master, commit 22bac2a1a0)
2009-03-09 16:28:50 -06:00
Brian Paul
549586c319 i965: fix cube map lock-up / corruption
If we're using anything but GL_NEAREST sampling of a cube map, we need to
use the BRW_TEXCOORDMODE_CUBE texcoord wrap mode.  Before this, the GPU
would either lock up or subsequent texture filtering would be corrupted.

(cherry picked from master, commit 6f915b10d5)
2009-03-09 11:57:16 -06:00
Dave Airlie
c122cc4097 r300: emit texture in GTT or VRAM 2009-03-09 13:44:03 +10:00
Dave Airlie
778cf80d9e r300: move firevertices out into the main place its needed.
This fixes a hang on context destruction on rs690
2009-03-09 13:06:10 +11:00
Dave Airlie
1386e8a6ba radeon: fix cut-n-paste typo 2009-03-08 02:41:30 +10:00
Dave Airlie
f881035fd8 rs690: fix r300 swtcl bug in DMA code.
When we finish emitting swtcl objects, we request space in the cmdbuf,
and flush if no space exists. However in this case we also flush
the DMA buffer we just put the vertices we wanted to send in.

This checks in advance if we have space in the buffer.
2009-03-07 17:23:40 +11:00
Dan Nicholson
463ac421a5 autoconf: Restore _GNU_SOURCE for all Linux systems
This catches the linux-uclibc case and any others that were being set
prior to 98fcdf3f. Fixes bug 20345.

Signed-off-by: Dan Nicholson <dbn.lists@gmail.com>
(cherry picked from commit ac55db1d7d)
2009-03-06 07:59:00 -08:00
Brian Paul
6801240205 mesa: Reads must also be done with lock held.
Otherwise two threads might think each made the refcount go zero.

(cherry picked from master, commit 8bbb6b352a)
2009-03-06 07:51:18 -07:00
Brian Paul
a22088b7d5 mesa: Fix typo.
Windows threads block if one over-unlocks them.

(cherry picked from master, commit f6159ba4d5)
2009-03-06 07:50:55 -07:00
Dave Airlie
760068cc8d r300: fix uninit variable warning 2009-03-06 23:42:35 +11:00
Dave Airlie
e0313ef061 r300: fix swtcl codepaths 2009-03-06 23:42:17 +11:00
Dave Airlie
c6ac53bc40 radeon: implement userspace clears
This is pretty much Eric Anholts implementation of clear using the GL state machine
from the Intel drivers.

It works quite well for now for us, probably could do with trying to use Z engine for
clears.
2009-03-06 16:07:23 +10:00
Dave Airlie
b074aacdb2 r200: cs emit state fixups 2009-03-06 05:42:37 +10:00
Dave Airlie
a03a4dd524 r200: remove depth check for dri2 2009-03-06 04:48:20 +10:00
Dave Airlie
7ba9eb1e85 r200: temporary sw clear code 2009-03-06 04:48:20 +10:00
Brian Paul
e89c49147f docs: update glext.h to version 46 2009-03-05 08:25:17 -07:00
Brian Paul
67634240d1 gl: update glext.h to version 46 2009-03-05 08:25:09 -07:00
Dave Airlie
9d72a75917 radeon: use t->bo to figure out of settexbuffer override is in action 2009-03-05 19:00:17 +10:00
Dave Airlie
eba8008916 r200: port over state emits for kms from radeon
this needs testing on real hw
2009-03-05 18:58:48 +10:00
Dave Airlie
5c80eb7ec1 r200: add set tex buffer support 2009-03-06 02:37:10 +10:00
Dave Airlie
31f1298807 radeon: r100 clean up CS packet size calc 2009-03-04 22:26:44 +10:00
Dave Airlie
924bf0d8d3 radeon: settexbuffer support
This gets DRI2 compiz going
2009-03-04 22:26:20 +10:00
Dave Airlie
26d0172a5b radeon: fix texturing for r100 2009-03-04 20:24:08 +10:00
Dave Airlie
940d47de08 radeon: use swrast clear - fail on depth
need to write real hw user clear
2009-03-04 18:36:46 +10:00
Dave Airlie
e0de73e8a5 radeon: fixup some segfaults/exit at startup 2009-03-04 18:36:13 +10:00
Brian Paul
819b028a8e mesa: fix sw fallback state validation bug
When a hw driver fell back to swrast, swrast wasn't always getting informed
of program changes.  When fixed function is translated into shaders, flags
like _NEW_LIGHT, _NEW_TEXTURE, etc. should really signal _NEW_PROGRAM.
In this case, swrast wasn't seeing _NEW_PROGRAM when new fragment shaders
were generated.

(cherry picked from master, commit de1caa5507)
2009-03-03 14:25:28 -07:00
Dave Airlie
54b42c0a4a radeon: remove debugging 2009-03-03 03:37:23 +10:00
Dave Airlie
2b85fccae5 radeon: refactor framebuffer code like intel
this is a step towards fbos and should fix pageflipping, but
I think the first flip seems broken.
2009-03-03 03:29:37 +10:00
Brian Paul
a43c30ef41 mesa: update fragResults array in arb_output_attrib_string()
Plus add some comments.

(cherry picked from master, commit a070937c00)
2009-02-27 13:49:58 -07:00
Brian Paul
b65bfde84d mesa: set bufObj->Pointer = NULL after unmapping
Also, ctx->Driver.UnmapBuffer can never be null, so remove conditional.

(cherry picked from master, commit 67025f7893)
2009-02-27 13:13:31 -07:00
Brian Paul
c39e6917ac mesa: if a buffer object is mapped when glDeleteBuffers() is called, unmap it
(cherry picked from master, commit a7f434b486)
2009-02-27 13:05:51 -07:00
Brian Paul
c79079895f mesa: fix incorrect error handling in glBufferDataARB()
If glBufferDataARB() is called while a buffer object is currently mapped
we're supposed to unmap the current buffer, then replace it.  Don't generate
an error.

(cherry picked from master, commit 75e3ccf6a5)
2009-02-27 12:58:07 -07:00
Alex Deucher
863c76a7bb R300: add support for RS600 chips 2009-02-27 14:48:24 -05:00
Alex Deucher
5a34ace3e6 R300: set the number of GB pipes on all r3xx-r5xx chips 2009-02-27 14:31:14 -05:00
Dave Airlie
0dba8883e3 r300: make ste text buffer work with > 2048 on r500 2009-02-27 14:04:03 +10:00
Dave Airlie
26c1b0af02 radeon: add more fbconfigs
this makes glxgears get its background back when running under DRI2
2009-02-27 14:04:03 +10:00
Dave Airlie
7f44b62a4a r300: remove depth offset exits in favour of rrb depth changes 2009-02-27 14:04:03 +10:00
Dave Airlie
294aab9b71 r200: fixup emit sizes for kms 2009-02-27 03:37:30 +10:00
Dave Airlie
e267a090ab r200: port over cs emit changes from radeon 2009-02-27 03:05:42 +10:00
Dave Airlie
2972d06526 radeon: fixup old packets emission for CS case 2009-02-26 18:26:22 +10:00
Dave Airlie
6d7164705b r100: fixup kms state emissions 2009-02-26 15:32:34 +10:00
Dave Airlie
6415e64cbc radeon: avoid page flip code in DRI2 2009-02-26 15:32:34 +10:00
Dave Airlie
3ec7137a75 radeon: enable DRI2 for r100 2009-02-26 15:32:33 +10:00
Dave Airlie
925ea2d9a5 radeon: move CB/ZB state init into emit code
This removes the use of the sarea for this stuff so makes DRI2 easier
and emits the CB/ZB info in the correct place
2009-02-26 15:32:27 +10:00
Dave Airlie
158ede35d5 r300: fixup texture state emission for kms path 2009-02-26 11:09:32 +10:00
Dave Airlie
2c033f3893 r300: don't call page flip on DRI2 2009-02-26 11:09:16 +10:00
Dave Airlie
bc5f94c1e1 r300: don't flush VAP too often.
Flush the VAP the first time for each state atom we upload new
VAP data
2009-02-26 11:08:14 +10:00
Alex Deucher
4480e631cd R300: Add support for RS600 chips 2009-02-25 17:48:45 -05:00
Dave Airlie
199867bd45 r300: drop r300Flush for the generic one 2009-02-25 18:06:44 +10:00
Brian Paul
c32661c3ce mesa: Build DRI by default on Linux/sparc
Signed-off-by: David S. Miller <davem@davemloft.net>

(cherry picked from master, commit 32dc28ac7a)
2009-02-24 20:08:00 -07:00
Brian Paul
d5c06bb812 glsl: yet another swizzled expression fix
This fixes swizzled conditional expressions such "(b ? p : q).x"

(cherry picked from master, commit 00f0b05d5f)
2009-02-24 08:32:01 -07:00
Brian Paul
9d5aa36239 glsl: fix another swizzle-related bug
This fixes the case of "infinitely" nested swizzles such as EXPR.wzyx.yxwz.xxyz
This doesn't appear in typical shaders but with function inlining and the
compiler's internal use of swizzles it can happen.
New glean glsl1 test case added for this.

(cherry picked from master, commit d9881356a6)
2009-02-24 08:31:02 -07:00
Dave Airlie
2ebf9b9521 r300: fix bo ref/unref, plugs DRI handle leaks 2009-02-24 12:04:49 +10:00
Brian Paul
e3050c1777 docs: Haiku fixes 2009-02-23 08:16:09 -07:00
Brian Paul
06295ddbdd mesa: fixes for building on Haiku
(cherry picked from master, commit 41172c0430)

Conflicts:
	src/mesa/main/dlopen.c
2009-02-23 08:15:43 -07:00
Dave Airlie
c32a28d86e r300: fixup old setTexOffset DRI1 extension 2009-02-23 15:41:30 +10:00
Dave Airlie
f4502f0f8c radeon: add more debug info to the flush debug 2009-02-23 14:04:22 +10:00
Dave Airlie
018f5f92cc r300: revert back autostate change on cacheflush emit 2009-02-23 14:04:22 +10:00
Dave Airlie
13ed7985b2 r300: use OUT_BATCH_REGVAL in a few more places 2009-02-23 14:04:20 +10:00
Dave Airlie
6ffd472b0e r300: set u to 0 so debug logs are easier to read 2009-02-23 14:04:19 +10:00
Dave Airlie
8c23970479 radeon: stabilise r300 driver like the F10 mesa bufmgr
For some reason flushs caused by this CS needs flush hook,
caused the chip to lockup on r300 under compiz, whereas
the F10 driver was rock solid.
2009-02-23 14:04:18 +10:00
Dave Airlie
77161c5ff5 radeon: add some debugging for flush ioctls 2009-02-23 14:04:18 +10:00
Dave Airlie
d4bfe34cb9 radeon: make state atom print like old r300 code 2009-02-23 14:04:17 +10:00
Dave Airlie
b4a90c6213 radeon: fixup legacy bo/cs out of VRAM waiting.
This is similiar to the code from the F10 r300 bufmgr
2009-02-23 14:04:17 +10:00
Brian Paul
e2092bb23c demos: update multitex.c GLSL demo to use vertex arrays or glVertex-mode
Press 'a' to toggle drawing mode.

(cherry picked from master, commit 8e8b25c26a)
2009-02-19 17:05:14 -07:00
Brian Paul
528836d0ad util: added more functions to extfuncs.h
(cherry picked from master, commit 4c5f390328)
2009-02-19 17:04:42 -07:00
Brian Paul
3511442e43 mesa: fix GLSL issue preventing use of all 16 generic vertex attributes
Only 15 actually worked before since we always reserved generic[0] as an
alias for vertex position.

The case of vertex attribute 0 is tricky.  The spec says that there is no
aliasing between generic vertex attributes 0..MAX_VERTEX_ATTRIBS-1 and the
conventional attributes.  But it also says that calls to glVertexAttrib(0, v)
are equivalent to glVertex(v).  The distinction seems to be in glVertex-mode
versus vertex array mode.

So update the VBO code so that if the shader uses generic[0] but not gl_Vertex,
route the attribute data set with glVertex() to go to shader input generic[0].

No change needed for the glDrawArrays/Elements() path.

This is a potentially risky change so regressions are possible.  All the usual
tests seem OK though.

(cherry picked from mesa, commit dea0d4d563)

Follow-up: This patch doesn't seem to be as risky as noted above.
There have been no known regressions on Mesa/master because of it.
2009-02-19 17:01:17 -07:00
Brian Paul
d20c53b511 glsl: update program->InputsRead when referencing input attributes
This info will be used in the linker for allocating generic vertex attribs.

(cherry picked from master, commit 1cb7cd1292)
2009-02-19 17:00:06 -07:00
Brian Paul
091cc122ad glsl: asst improvements, clean-ups in set_program_uniform()
Move the is_boolean/integer_type() calls out of the loops.
Move the is_sampler_type() function near the bool/int functions.
Add a bunch of comments.

(cherry picked from master, commit c4ffbf009e)
2009-02-18 17:53:08 -07:00
Brian Paul
c983abbb9e glsl: fix inequality in set_program_uniform()
We were off by one when checking for too many uniform values.

(cherry picked from master, commit b9d8f717d2)
2009-02-18 17:52:47 -07:00
Brian Paul
a0a81204c2 mesa: bump gl.h version comment to 7.4 (bug 20170) 2009-02-18 15:37:44 -07:00
Brian Paul
409d4f839c glsl: fix link failure for variable-indexed varying output arrays
If the vertex shader writes to a varying array with a variable index,
mark all the elements of that array as being written.

For example, if the vertex shader does:

   for (i = 0; i < 4; i++)
      gl_TexCoord[i] = expr;

Mark all texcoord outputs as being written, not just the first.

Linking will fail if a fragment shader tries to read an input that's not
written by the vertex shader.  Before this fix, this linker test could fail.

(cherry picked from master, commit dac19f17f3)
2009-02-18 14:29:46 -07:00
Brian Paul
0ab36958ea mesa: improved error msg
(cherry picked from master, commit 621c999d82)
2009-02-18 13:41:12 -07:00
Brian Paul
c2445f43a3 mesa: increase MAX_UNIFORMS to 1024 (of vec4 type)
Old limit was 256.  Note that no arrays are declared to this size.
The only place we have to be careful about raising this limit is the
prog_src/dst_register Index bitfields.  These have been bumped up too.

Added assertions to check we don't exceed the bitfield in the future too.

(cherry picked from master, commit 5b2f8dc013)
2009-02-18 13:40:57 -07:00
Brian Paul
f3d1c136b7 glsl: fix a swizzle-related regression
This new issue was exposed by commit 6eabfc27f1

(cherry picked from master, commit 212f41b80f)
2009-02-18 13:37:31 -07:00
Dave Airlie
da17b36412 r300: make DRI2 not crash on compiz start 2009-02-18 10:47:17 +10:00
Dave Airlie
e9d6beaab4 radeon: move device param id check ifndef 2009-02-18 10:47:17 +10:00
Brian Paul
dd10a8b09d docs: 7.4 relnotes: report GLSL 1.20, fixed GLSL array index bug 2009-02-17 16:39:45 -07:00
Brian Paul
dd312366da glsl: silence some uninit var warnings
(cherry picked from master, commit 9d49802b7a)
2009-02-17 16:38:30 -07:00
Brian Paul
d2fe466ef3 mesa: turn on reporting of GLSL version 1.20
The new array features, precision/invariant/centroid qualifiers, etc. were
done a while back.  The glGetString(GL_SHADING_LANGUAGE_VERSION) query returns
"1.20" now (for drivers that support it anyway).

(cherry picked from master, commit f59719c6c7)
2009-02-17 16:37:41 -07:00
Brian Paul
fe5328bfad glsl: fix mistake in a comment
(cherry picked from master, commit be8dd01678)
2009-02-17 16:36:15 -07:00
Brian Paul
c0891dde07 glsl: fix an array indexing bug
This fixes a bug found with swizzled array indexes such as in "array[index.z]"
where "index" is an ivec4.

(cherry picked from master, commit 6eabfc27f1)
2009-02-17 16:35:59 -07:00
Dave Airlie
745c787338 radeon: initialise swapped objects pointer 2009-02-17 16:01:16 +10:00
Dave Airlie
9c040745fe radeon: legacy texMem interface fixups.
The texmem.c interface is wildly messed up it really wants to own the objects
so let it, pain in the ass but this code should work a lot better now
2009-02-17 14:48:49 +10:00
Dave Airlie
7ce6af25e5 Revert "dri/radeon: export a function to cleanup a texture object."
This reverts commit 5325f86240.
2009-02-17 14:46:12 +10:00
Dave Airlie
2ba4fc3d60 radeon/r200: drop legacy texture heap code 2009-02-17 14:00:24 +10:00
Dave Airlie
48e7b940eb radeon/r200: fixup texturing aging calls 2009-02-17 13:39:38 +10:00
Brian Paul
0e6d9c1a55 docs: recent 7.4 bug fixes 2009-02-16 20:35:12 -07:00
Brian Paul
5f74a66132 glsl: allow setting arrays of samplers in set_program_uniform()
Arrays of sampler vars haven't been tested much and might actually be broken.
Will need to be revisited someday.

Another fix for bug 20056.

(cherry picked from master, commit 2b4f0216bf)
2009-02-16 20:30:49 -07:00
Brian Paul
46f8b62d5f glsl: raise GL_INVALID_OPERATION for glUniform(location < -1)
location = -1 is silently ignored, but other negative values should raise
an error.

Another fix for bug 20056.

(cherry picked from master, commit 234f03e90a)
2009-02-16 20:30:06 -07:00
Brian Paul
3e3e80c431 glsl: rework _mesa_get_uniform[fi]v() to avoid using a fixed size intermediate array
(cherry picked from master, commit 4ef7a93296)
2009-02-16 20:29:36 -07:00
Brian Paul
0486d117e4 glsl: fix glUniform() array bounds error checking
If too many array elements are specified, they're to be silently ignored (don't
raise a GL error).

Fixes another issue in bug 20056.

(cherry picked from master, commit 2c1ea0720d)
2009-02-16 20:28:57 -07:00
Brian Paul
29981c14da glsl: fix incorrect size returned by glGetActiveUniform() for array elements.
Fixes one of the issues in bug 20056.

(cherry picked from master, commit 369d1859d7)
2009-02-16 20:28:14 -07:00
Brian Paul
98d5efb2c5 glsl: use _slang_var_swizzle() in a few places to simplify the code.
(cherry picked from master, commit 285b500bb7)
2009-02-16 20:26:58 -07:00
Brian Paul
77a44aafaf mesa: another fix for program/texture state validation
This fixes a regression introduced in 46ae1abbac

Break program validation into two steps, do part before texture state
validation and do the rest after:
1. Determine Vertex/Fragment _Enabled state.
2. Update texture state.
3. Determine pointers to current Vertex/Fragment programs (which may involve
generating new "fixed-function" programs).

See comments in the code for more details of the dependencies.

(cherry picked from master, commit 537d3ed6f3)
2009-02-16 20:23:17 -07:00
Brian Paul
8278c70716 mesa: fix/change state validation order for program/texture state
Program state needs to be updated before texture state since the later depends
on the former.

Fixes piglit texgen failure.  The second time through the modes (press 't'
three times) we disable the fragment program and return to conventional texture
mode.  State validation failed here because update_texture() saw stale fragment
program state.

(cherry picked from master, commit 46ae1abbac)
2009-02-16 20:22:46 -07:00
Dave Airlie
7c7ff659ce radeon: fixup destroy texture object exit path and update LRU
the destroy path was doing bad things with structure names, make it do less
bad things, use container_of instead
2009-02-17 11:17:22 +10:00
Dave Airlie
43c71a2d40 radeon: remove leftover debug 2009-02-17 10:42:51 +10:00
Dave Airlie
62d504d818 radeon/r200: drop dirty state from texture object + pp_txoffset
this is just more code cleanup for old dead code
2009-02-17 10:41:21 +10:00
Dave Airlie
a365f9b78b r200: align with r100 code 2009-02-17 10:28:43 +10:00
Dave Airlie
646325a5ef radeon: fix not emitting texture state correctly
this is whole texture dirty bit is probably not needed with the current
codebase, need to revisit
2009-02-17 10:27:45 +10:00
Dave Airlie
0a8cba9a65 radeon: steal miptree optimisation from intel codebase
This replaces a miptree if it won't distrub anything else.
2009-02-17 10:26:58 +10:00
Dave Airlie
7a1dbcabf3 radeon: move YUV on first texunit check after hw state is setup 2009-02-17 10:26:33 +10:00
Dave Airlie
5325f86240 dri/radeon: export a function to cleanup a texture object.
The radeon legacy code want to cleanup not free the texture obj,
so export a function to do that and wrap it.
2009-02-17 10:25:34 +10:00
Alan Hourihane
ac0955f5e2 demos: fix glxpixmap and call glXWaitGL before calling XCopyArea. 2009-02-16 11:55:47 +00:00
Alan Hourihane
4130c35ca8 dri2: support glXWaitX & glXWaitGL by using fake front buffer. 2009-02-16 11:48:24 +00:00
Dave Airlie
ecf0a3eac1 radeon: fix texcompress2 test.
this makes compressed subimages work properly.
2009-02-16 09:51:08 +10:00
Dave Airlie
f069bc4a8e radeon: fix compressed tex subimage unpack parameter 2009-02-16 17:16:28 +10:00
Dave Airlie
b0e8ac8fd2 radeon: add cflags to decide whether to link libdrm_radeon or not.
You don't need libdrm_radeon for the legacy driver to build,
only for the experimental mm/cs paths.
2009-02-15 17:03:47 +10:00
Nicolai Haehnle
7d19d27684 radeon-common: Fix crash in glGetTexImage
Since texture images are now stored in miptrees, we cannot usually
access them directly via the Data pointer.

So we wrap Mesa's implementation by map/unmap calls.

This crash was triggered by Sauerbraten, Piglit now contains a
regression test.

Signed-off-by: Nicolai Haehnle <nhaehnle@gmail.com>
2009-02-14 21:46:44 +01:00
Nicolai Haehnle
2d9471b281 r300: Fix crash in cubemap tree creation
The mip tree creation would crash if the first baselevel image to be uploaded
was not the positive-x image.

Found with Sauerbraten, also added a regression test to Piglit.

Signed-off-by: Nicolai Haehnle <nhaehnle@gmail.com>
2009-02-14 20:47:08 +01:00
Nicolai Haehnle
9a26164f35 r300: Redirect constant TEX coordinates
R3xx/R5xx fragment program texture constants must come from a hardware
register instead of the constant file, so we redirect if necessary during
the native rewrite phase.

The symptoms of this bug started appearing when the Mesa fixed function
texenvprogram code started using STATE_CURRENT_ATTRIB constants for
texture coordinates when the corresponding attributes were constant across
all vertices.

Signed-off-by: Nicolai Haehnle <nhaehnle@gmail.com>
2009-02-14 17:09:54 +01:00
Michel Dänzer
5f3ab230ea r300: Fix R300_CMD_SCRATCH on big endian. 2009-02-14 20:40:48 +10:00
Dave Airlie
b1b7bc66a4 radeon: remove unused radeon_compat.c 2009-02-14 20:34:20 +10:00
Dave Airlie
f8c2beccd4 r200: fixup cube emit debug 2009-02-14 20:13:55 +10:00
Dave Airlie
fd81835dc7 r200: fix another cmdbuf sizing issue 2009-02-14 20:13:55 +10:00
Dave Airlie
f3a1f321cf radeon: check for valid bo in release arrays 2009-02-14 12:05:36 +10:00
Dave Airlie
fcc7a691dc radeon: remove old cube code 2009-02-14 12:05:36 +10:00
Dave Airlie
c0ae4d3c55 radeon/r300: fix warnings 2009-02-14 07:49:15 +10:00
Dave Airlie
cd4e37c8fb radeon: add initial cubemap support appears to work 2009-02-14 05:57:52 +10:00
Brian Paul
d440647eb8 autoconf: Use include-fixed directory with makedepend on newer GCC
On newer GCC releases, the compiler's headers have been split between
the include and include-fixed directories. Add both if the directories
exist.

Signed-off-by: Dan Nicholson <dbn.lists@gmail.com>
Signed-off-by: Julien Cristau <jcristau@debian.org>

(cherry picked from master, commit a3d223f0d2)
2009-02-13 09:10:09 -07:00
Dave Airlie
2753dd42fd radeon/r200: make setTexOffset work again 2009-02-13 23:34:53 +10:00
Dave Airlie
f363a97d25 radeon/r200: fix set tex offset functions 2009-02-13 23:29:27 +10:00
Dave Airlie
ed8340192e radeon: revert unneeded change to texturing code 2009-02-13 23:02:12 +10:00
Dave Airlie
9fd8da299b radeon: fix compressed texture upload on all radeons
tested on r200, texcmp works. May need more verification
2009-02-13 22:49:06 +10:00
Dave Airlie
8123897615 r200: update with changes from r100 driver for texture state 2009-02-13 19:39:21 +10:00
Dave Airlie
695ca1e2be r200: port over state emit fix from r100 2009-02-13 18:50:57 +10:00
Dave Airlie
ade3660942 r200: fixup some CS emission sizes 2009-02-13 01:27:21 +10:00
Dave Airlie
393c699e21 r200: use correct finish interface 2009-02-13 00:04:11 +10:00
Dave Airlie
5ee1dd2133 radeon: fixup include ordering 2009-02-13 01:21:37 +10:00
Dave Airlie
53116910b1 Merge remote branch 'origin/master' into radeon-rewrite
Conflicts:
	configure.ac
	src/mesa/drivers/dri/r200/r200_context.c
	src/mesa/drivers/dri/r300/r300_render.c
2009-02-13 01:11:25 +10:00
Dave Airlie
7e104f9cde r300: fix warning about mesa_lock_context_texture 2009-02-13 01:04:18 +10:00
Dave Airlie
dc531ba406 radeon: add stdint include 2009-02-12 14:44:20 +10:00
Dave Airlie
899b91b1fb radeon: add mminfo struct to wrapper 2009-02-12 14:43:25 +10:00
Dave Airlie
ec0939b013 radeon: add defines for future bits 2009-02-12 14:41:16 +10:00
Dave Airlie
1e77f7b55c r200: make build complete 2009-02-12 14:39:33 +10:00
Dave Airlie
56a13a7ca9 r300: make r300 work with latest changes 2009-02-12 14:36:12 +10:00
Dave Airlie
c83d0bfe06 radeon: make build without libdrm_radeon better 2009-02-12 14:16:24 +10:00
Dave Airlie
d513915d27 radeon/r200/r300: make build again with tracker changes 2009-02-13 00:05:39 +10:00
Dave Airlie
9314d936e8 radeon: remove depends on libdrm_radeon for now.
will fixup makefiles later to detect and use libdrm_Radeon in proper
places
2009-02-12 23:53:41 +10:00
Dave Airlie
dc8a707c67 radeon/r200/r300: make build with out libdrm_radeon installed for now 2009-02-12 23:52:51 +10:00
Dave Airlie
8cb16e6daf r200/r300: get up to speed on renamed files 2009-02-12 22:48:18 +10:00
Dave Airlie
23d3559bd4 radeon: renaming and headers cleanup 2009-02-12 22:38:10 +10:00
Dave Airlie
df4a1348b1 r100/r200: fix front rendering issue. 2009-02-12 21:44:34 +10:00
Dave Airlie
1090d206de radeon/r200/r300: another big merge upheavel.
This merges lots of the hw state atom emission and firevertices code.

it also removes a lot of the extra radeon crap from r300

and merge scissor
2009-02-12 21:16:39 +10:00
Dave Airlie
f3f1f7dc20 r300: disable assert that fires 2009-02-11 19:04:39 +10:00
Dave Airlie
3713a7accf radeon: unmap in case of two dma regions being used for one cmdbuf 2009-02-11 19:03:56 +10:00
Dave Airlie
7e98907eb8 radeon: cleanup cmdbuffer 2009-02-11 16:52:56 +10:00
Dave Airlie
832446c892 r300: fix front buffer rendering properly fixes tests in glean 2009-02-11 16:50:19 +10:00
Dave Airlie
c5d9a7ab30 r200: fix build 2009-02-11 20:10:59 +10:00
Dave Airlie
edbe1fac6a radeon: fix span init needs more work 2009-02-11 07:02:18 +10:00
Dave Airlie
45496122b7 radeon/r200/r300: merge span code into single shared file 2009-02-11 05:47:55 +10:00
Dave Airlie
7394c429c0 radeon/r200: flush vertices when data in cmdbuf.
This fixes a whole bunch of regressions in piglit
2009-02-11 05:07:31 +10:00
Dave Airlie
18aca218a2 radeon: r100 can't use some of the texture formats.
this fixes the texrect-many test
2009-02-11 02:41:39 +10:00
Dave Airlie
4c36282ef9 radeon/r200/r300: fix span code for depth reading.
makes the maskedClear test work
2009-02-11 02:41:11 +10:00
Dave Airlie
3e4d0c2a5d r100: remove debug code 2009-02-10 23:39:13 +10:00
Dave Airlie
639b5fca0c r100: fix 3D texture fallback 2009-02-10 23:38:51 +10:00
Dave Airlie
c3ca94bc91 radeon: fix fallback case where t->mt is valid NULL 2009-02-10 23:36:28 +10:00
Dave Airlie
b1df5ed6db radeon: put back state emission lastcmd 2009-02-10 04:57:37 +10:00
Dave Airlie
d2fa89140e r200: invalidate texture paths in some more places 2009-02-10 04:56:16 +10:00
Dave Airlie
ccf7814a31 radeon: major cleanups removing old dead codepaths.
This should be working gears on radeon state
2009-02-10 04:54:24 +10:00
Dave Airlie
9df844b109 radeon: fix alignment issues in ELT code 2009-02-09 23:19:42 +10:00
Dave Airlie
3fafaf8959 radeon: make more r100 work 2009-02-09 03:50:38 +10:00
Dave Airlie
abdf1f65d2 r200: cleanup some bits that aren't used 2009-02-09 03:50:07 +10:00
Brian Paul
7e8f2c56c0 mesa: fix logic error in computing enableBits in update_texture_state()
If we had a vertex shader but no fragment shader (i.e. fixed function) we
didn't get the right enabled texture targets.

Fixes blank/white texture problem.

(cherry picked from master, commit b46611633c)
2009-02-07 12:04:15 -07:00
Brian Paul
a0880a152f mesa: fix tnl->render_inputs_bitset setup for fragment program texcoords
Handle the case where there's no per-vertex texcoords but the fragment shader
needs texcoords.

Fixes piglit shaders/fp-generic/dph test.

(cherry picked from master, commit f6d23943cd)
2009-02-07 12:03:37 -07:00
Brian Paul
4608a9172f swrast: return (0,0,0,1) when sampling incomplete textures, not (0,0,0,0)
Fixes piglit shaders/fp-incomplete-tex test.

(cherry picked from master, commit 1df62651b2)

Conflicts:
	src/mesa/swrast/s_fragprog.c

Also updated the fetch_texel_lod(), fetch_texel_deriv() functions to match
those in git/master.
2009-02-07 12:02:22 -07:00
Brian Paul
d0e38f7ec0 glsl: replace assertion with conditional in _slang_pop_var_table()
We were hitting the assertion when we ran out of registers, which can happen.

Also, add some additional assertions and freshen up some comments.

(cherry picked from master, commit 0744805d58)
2009-02-07 11:57:43 -07:00
Dave Airlie
e223b7c312 radeon: port over arrays code even though not in use yet 2009-02-06 20:30:03 +10:00
Dave Airlie
36d3f3e74a r100: fixup radeon so gears seems to work 2009-02-06 20:04:42 +10:00
Dave Airlie
16f4b10170 radeon: remove unused texmem 2009-02-06 19:36:39 +10:00
Dave Airlie
0a43603c1c r300: fix some autostate batch setups 2009-02-06 09:18:15 +10:00
Dave Airlie
8fe61fc5ba radeon/r200 remove more unused code 2009-02-04 16:01:41 +10:00
Dave Airlie
b584b0728d radeon: make compile again.
Not tested but ripped out lots of stuff unneeded anymore time to test later
2009-02-04 15:58:08 +10:00
Dave Airlie
88a409fa8e r300: fix up CS for modesetting - gears under kms works 2009-02-04 15:12:16 +10:00
Dave Airlie
c370776b02 radeon: make generate_mipmap static 2009-02-04 13:41:05 +10:00
Dave Airlie
0bcac04100 r300: fix swtcl 2009-02-04 13:40:48 +10:00
Dave Airlie
c1a42f5cdc r200: fixup DMA region stuff 2009-02-04 23:40:41 +10:00
Dave Airlie
e44effcfcb radeon: call getpagesize once and store in a static 2009-02-04 13:16:41 +10:00
Dave Airlie
711cbf30a1 r300: make dma buffer reuse much more sensible 2009-02-04 13:16:03 +10:00
Dave Airlie
55c8a79a33 radeon: add support for stencil buffers + misc debug changes
this adds the stencil rb setup, along with misc changes to formatting
and debug
2009-02-04 11:19:26 +10:00
Dave Airlie
3f59bee438 r200: move to new mipmap interface 2009-02-04 11:17:37 +10:00
Dave Airlie
c85a3851b6 radeon: only do the fb read if we are mapping a VRAM object
this makes writing the DMA buffers got a lot better
2009-02-04 11:14:38 +10:00
Dave Airlie
e8f575d657 radeon_cs: move to inline cs_write_dword
this gets back some of the CPU this was wasting
2009-02-04 11:13:54 +10:00
Brian Paul
a69bdbbbdd docs: fixed Windows build error, added MESA_GLX_FORCE_DIRECT env var 2009-02-03 15:40:16 -07:00
Brian Paul
88c97a2662 docs: document new MESA_GLX_FORCE_DIRECT env var for the Xlib driver
(cherry picked from master, commit 2f51be75c5)
2009-02-03 15:39:13 -07:00
Brian Paul
ce9c69ddbc xlib: use MESA_GLX_FORCE_DIRECT to make glXIsDirect() always return True
Some apps won't run w/ indirect rendering contexts.
Also, consolidate some context-init code in new init_glx_context() function.

(cherry-picked from master, commit 49e80bf6b1)
2009-02-03 15:38:44 -07:00
Eric Anholt
e430fcb716 dri2: Avoid round-tripping on DRI2GetBuffers for the same set of buffers.
We only wanted to request when asked for the same set of buffers when a resize
has happened.  We can just watch the protocol stream for a ConfigureNotify
and flag to do it then.

This is about a 5% win from doing two glViewport()s per frame in openarena.
2009-02-03 21:36:38 +00:00
Dave Airlie
4c078cfbad radeon: add a reference to the static buffers so they don't get deleted 2009-02-03 12:38:31 +10:00
Dave Airlie
d9cf131925 r300: fixup mipmap + texsubimage issues
This fixes a few regression in piglit, and adds some debug to the mipmap code
2009-02-03 09:49:45 +10:00
Dave Airlie
dbf72bdd3d radeon_bo: align size of bo to page size.
This is really required for the VRAM allocator upload function.
2009-02-03 09:48:27 +10:00
Brian Paul
11a363e632 mesa: move code after decls. Fixes Window build failure.
(cherry picked from master, commit 92ced46eaf)
2009-02-02 07:50:31 -07:00
Dave Airlie
75762a8219 radeon: this code forgot to add dPriv x/y back to spans 2009-02-02 12:26:22 +10:00
Dave Airlie
f4dfafd50a r300: rename validate textures to validate buffers 2009-02-02 12:26:04 +10:00
Julien Cristau
9a3a20b2b9 debian/rules: on lpia, only build the i915 and i965 dri drivers
Based on Ubuntu changes, modified to also build swrast.
2009-01-31 23:04:06 +01:00
Julien Cristau
4672811541 debian/control: build the dri drivers on lpia
add lpia to the Architecture field for libgl1-mesa-dri{,-dbg} to match Ubuntu.
2009-01-31 22:30:15 +01:00
Julien Cristau
3cad3d28a5 mangle upstream version in debian/watch
Fix watch file to make uscan not consider release candidates as newer than
actual releases.
2009-01-31 22:07:51 +01:00
Brian Paul
41e63fbdb2 docs: recent bug fixes for 7.4 2009-01-30 16:09:58 -07:00
Brian Paul
b543401a5c mesa: fix incorrect call to clear_teximage_fields() in _mesa_TexImage2D()
Fixes failed assertion / segfault for particular proxy texture tests.

(cherry picked from master, commit ea4b183b8c)
2009-01-30 16:06:52 -07:00
Brian Paul
8c4f08fbad mesa: add missing _mesa_reference_texobj() calls for texture array targets
(cherry picked from master, commit 7c48719a5f)
2009-01-30 16:06:21 -07:00
Brian Paul
f3081a34d2 mesa: remove incorrect refcounting adjustment in adjust_buffer_object_ref_counts()
Fixes bug 19835.  However, a more elaborate fix should be implemented someday
which uses proper reference counting for gl_array_object.

(cherry picked from master, commit 88e0b92a74)
2009-01-30 16:05:51 -07:00
Julien Cristau
cff0971f87 Prepare changelog for upload 2009-01-30 20:00:37 +01:00
Julien Cristau
5ac4c69d83 More superfluous directories 2009-01-30 19:56:29 +01:00
Julien Cristau
a314c40cc4 Document my changes in debian/changelog 2009-01-30 19:42:38 +01:00
Julien Cristau
959fd6b8f6 Add back progs/fbdev
It was added to the tarballs in 22b0b2f47e
2009-01-30 19:34:47 +01:00
Julien Cristau
937f0da04a Delete more directories that aren't in the tarball 2009-01-30 19:25:50 +01:00
Julien Cristau
73bc5967e2 Merge commit '5a458977113e4a0d3c389b03801cf6ce580d3935' into debian-experimental 2009-01-30 19:06:19 +01:00
Dave Airlie
f68a61d883 r200/r300: swtcl fixups to use old dma buffers on top of BOs 2009-01-31 02:00:12 +10:00
Dave Airlie
e45213d89b r200/r300: add aperture space checks 2009-01-31 01:59:57 +10:00
Dave Airlie
08bb7eedfb r200: fix swtcl - slow but works 2009-01-30 20:03:17 +10:00
Dave Airlie
70661f678e WIP comit 2009-01-29 20:46:31 +10:00
Dave Airlie
c9bb5cd20e r200: bring back single dma flush 2009-01-29 20:33:07 +10:00
Dave Airlie
59b183ce0f radeon: remove even more common code 2009-01-29 19:11:31 +10:00
Dave Airlie
5ba92a5b05 radeon/r200/r300: bring back old style DMA buffer on top of BOs.
this gets back a lot of the lots speed in gears on r500 at least

I also fixed the legacy bufmgr to deal when the dma space fills up
2009-01-29 16:47:37 +10:00
Dave Airlie
682ebc79d5 r200: start work on userspace clear for r200 2009-01-29 23:03:47 +10:00
Dave Airlie
5fbb00a11e r200: unref swtcl buffer correctly 2009-01-29 23:03:34 +10:00
Dave Airlie
b13746b558 r300: fix some whitespace 2009-01-29 23:03:21 +10:00
Dave Airlie
474d282a1d r200: re-write state handlers for new CS mechanism 2009-01-29 23:02:43 +10:00
Dave Airlie
31a112e6e8 r200: avoid setting variable on kernel mm setup 2009-01-29 23:01:41 +10:00
Dave Airlie
ab6edc9dce radeon: add repeated register packet one 2009-01-29 23:01:21 +10:00
Brian Paul
7b1d3cf392 docs: i965 fixes 2009-01-28 17:02:39 -07:00
Brian Paul
25515b557e i965: fix bug in pass0_precalc_mov()
Previously, "in-place" swizzles such as:
   MOV t, t.xxyx;
were handled incorrectly.  Fixed by splitting the one loop into two loops so we
get all the refs before assigning them (to avoid potential clobbering).

(cherry picked from master/commit faa48915d2)
2009-01-28 17:01:34 -07:00
Brian Paul
51625ff86e i965: widen per-texture bitfields for 16 texture image units
(cherry picked from master/commit f78c388b6c)
2009-01-28 17:01:03 -07:00
Brian Paul
4d8f661726 intel: check if stencil test is enabled in intel_stencil_drawpixels()
(cherry picked from master/commit 72ee0e247d)
2009-01-28 17:00:23 -07:00
Brian Paul
efa69a2f66 intel: save/restore GL matrix mode in intel_meta_set_passthrough_transform(), intel_meta_restore_transform()
(cherry picked from master, commit 723648f2ee)
2009-01-28 16:55:16 -07:00
Timo Aaltonen
a2dce49158 New changelog entry for 7.3 2009-01-25 17:51:16 +02:00
Timo Aaltonen
e4b28de803 Merge branch 'upstream-experimental' into debian-experimental 2009-01-25 17:30:47 +02:00
Brian Paul
30a6dd78d5 docs: fix typo 2009-01-22 10:39:05 -07:00
Brian Paul
9f75836308 mesa: set version to 7.4 for mesa_7_4_branch 2009-01-22 10:19:39 -07:00
Dave Airlie
f69e2f42d5 r200: fix up swtcl/tcl flushes 2009-01-22 22:50:36 +10:00
Dave Airlie
d93dc43382 radeon: plug memory leak running gears 2009-01-23 08:08:34 +10:00
Dave Airlie
9780127449 radeon: remove some debugging 2009-01-23 08:03:03 +10:00
Dave Airlie
8b56a86385 radeon: better free of array 2009-01-22 21:49:58 +10:00
Dave Airlie
860d0cc656 radeon: free all relocs in array 2009-01-22 21:47:38 +10:00
Dave Airlie
02952a41eb radeon: check relocs before deref 2009-01-22 21:38:35 +10:00
Dave Airlie
2c8b55b351 radeon: fix relocs even more 2009-01-22 21:35:58 +10:00
Dave Airlie
c66e38d24f radeon: fix reloc free harder 2009-01-22 21:31:06 +10:00
Dave Airlie
bb7756eaed radeon: free indices caught with valgrind 2009-01-22 21:29:22 +10:00
Dave Airlie
a5b54eb3c9 radeon: cleanup bo unref codepath in pending code
assert for bad case hopefully
2009-01-22 21:19:56 +10:00
Dave Airlie
11995807f1 radeon: fix counting for cfree handles in an inline 2009-01-22 21:12:54 +10:00
Dave Airlie
014c52eb6b radeon: add r100/r200 workarounds for legacy aging 2009-01-23 02:47:15 +10:00
Dave Airlie
4ca76586c2 r200: disable some debug 2009-01-23 00:23:10 +10:00
Dave Airlie
7d01cb37d9 r200: emit elts into a separate ELT bo 2009-01-23 00:17:38 +10:00
Dave Airlie
eda2284961 r200r300: start merging span code 2009-01-22 04:14:40 +10:00
Julien Cristau
f5c47105db Prepare changelog for upload 2009-01-21 19:01:24 +01:00
Julien Cristau
f1939c8685 Refresh patches 03 and 04. 2009-01-21 19:01:17 +01:00
Julien Cristau
3ac4d678ef Delete some more files which aren't in the tarballs 2009-01-21 18:51:07 +01:00
Dave Airlie
0788e42471 r200: remove indexed verts 2009-01-22 02:38:00 +10:00
Dave Airlie
909aeb005f radeon: fix 1D textures 2009-01-22 01:24:50 +10:00
Dave Airlie
674b204ba7 r200: fix cubemaps 2009-01-22 01:17:31 +10:00
Dave Airlie
61bb82636f r200/r300: port r200 texture handling to common code
we now get texrect + trivial textures working
2009-01-22 01:05:43 +10:00
Dave Airlie
2bf31b7ffd r300/radeon: move face_for_target 2009-01-21 18:41:11 +10:00
Julien Cristau
fcfec66865 update changelog 2009-01-20 18:50:10 +00:00
Julien Cristau
53426d7113 Merge tag 'mesa_7_3_rc3' into debian-experimental
Conflicts:

	progs/tests/Makefile
2009-01-20 18:49:21 +00:00
Dave Airlie
e0ec3243e8 r300: start migrating common functions into common code 2009-01-21 02:21:45 +10:00
Dave Airlie
ddbd6ed326 r300: move to common texture_image object 2009-01-21 02:15:28 +10:00
Dave Airlie
33dc14c707 radeon/r200/r300: start to move to common miptree/texobj 2009-01-21 02:10:56 +10:00
Dave Airlie
d9c4a01bad r200: make tri render on my r200. 2009-01-21 01:40:33 +10:00
Dave Airlie
04029e5ddb r200: tri runs without crashing - doesn't draw anything 2009-01-20 22:59:34 +10:00
Dave Airlie
ed3a1cce73 r200: clear is working at least - not much else 2009-01-20 22:51:04 +10:00
Timo Aaltonen
1d4756de06 Update the changelog. 2009-01-16 23:12:14 +02:00
Timo Aaltonen
c1abb821f9 Merge commit 'mesa_7_3_rc2' into debian-experimental 2009-01-16 23:05:20 +02:00
Dave Airlie
08d90fe8a5 r300: move some more function to generic 2009-01-15 16:56:50 +10:00
Dave Airlie
1a51b76343 radeon/r200/r300: start to make cmd buf useful 2009-01-15 16:45:39 +10:00
Dave Airlie
0c0a55a211 r100/r200: move to new atom style emission 2009-01-15 16:38:59 +10:00
Dave Airlie
47e3a7d794 radeon: get ctx right in copybuffer 2009-01-14 15:54:28 +10:00
Dave Airlie
4aa874c636 r200: add missing symbols 2009-01-14 15:48:02 +10:00
Dave Airlie
8c6a7d0174 radeon/r200/r300: make legacy emit non-r300 specific 2009-01-14 15:45:29 +10:00
Dave Airlie
e7d06a55c5 radeon: move debug symbol add DRI2 2009-01-14 15:21:45 +10:00
Dave Airlie
61da612a4f r300: start moving new r300 cmdbuf into common code 2009-01-14 15:14:09 +10:00
Dave Airlie
23295cf8e8 radeon/r200/r300: consolidate swap buffers 2009-01-14 13:38:12 +10:00
Dave Airlie
44b916b2c0 radeon: remove old lock code 2009-01-14 13:38:03 +10:00
Dave Airlie
7e5e327cea radeon/r200/r300: consolidate the buffer copy/flip code into one place 2009-01-14 13:23:24 +10:00
Dave Airlie
d29e96bf33 radeon/r200/r300: attempt to move lock to common code 2009-01-14 12:04:00 +10:00
Dave Airlie
4637235183 radeon/r200/r300: initial attempt to convert to common context code 2009-01-14 10:54:52 +10:00
Dave Airlie
0217ed2cf9 radeon/r200: move more stuff closer together in context 2009-01-14 08:40:15 +10:00
Dave Airlie
b6e4869069 radeon/r200: move state atom to common header 2009-01-14 06:28:43 +10:00
Dave Airlie
692ca82116 radeon/r200: start splitting out commonalities into separate headers 2009-01-13 22:55:27 +10:00
Dave Airlie
4b9a09e9f6 radeon: use bo_wait to wait for all buffers to be rendered to
Not 100% sure this is correct, but its what Intel does and its better than
CP_IDLE.
2009-01-13 16:50:15 +10:00
Kristian Høgsberg
d67987b0d1 Bump dri2proto requirement to 1.99.3, drop CopyRegion bitmask from protocol.
(cherry picked from commit 154a9e5317)
2009-01-11 09:45:04 +10:00
Dave Airlie
efe68930dc radeon/r300: add code to setup r300 vs r500 using pci device from kernel 2009-01-11 09:47:38 +10:00
Julien Cristau
88083e9bab Prepare changelog for upload 2009-01-10 22:34:36 +01:00
Julien Cristau
47e54545ed Delete some now unused code from debian/rules. 2009-01-10 22:13:17 +01:00
Julien Cristau
54885ff0ad Delete unused configs/debian-*, and install-source.sh script.
We've switched to using autoconf, and mesa-swx11-source is gone.
2009-01-10 21:55:19 +01:00
Julien Cristau
502fbe7cb3 Merge branch 'debian-unstable' into debian-experimental
Conflicts:

	debian/changelog
	debian/rules
2009-01-10 21:42:57 +01:00
Julien Cristau
08fdb497fb Merge commit 'origin/upstream-unstable' into debian-experimental 2009-01-10 21:38:10 +01:00
Julien Cristau
2a6711c0e5 add bug closers 2009-01-10 21:02:55 +01:00
Julien Cristau
382a8f6e29 Require libdrm-dev 2.4.3. 2009-01-10 20:41:16 +01:00
Julien Cristau
a713ba4399 Update changelog 2009-01-10 20:31:20 +01:00
Julien Cristau
5359febc9b Merge tag 'mesa_7_3_rc1' into debian-experimental
Conflicts:

	progs/tests/Makefile
	progs/tests/floattex.c
2009-01-10 20:30:41 +01:00
Dave Airlie
2a287ddd32 r300: disable settexoffset extension on r300 2008-12-22 17:04:39 +10:00
Dave Airlie
d9b325f77e radeon: fix library name for consistency 2008-12-22 12:28:16 +10:00
Dave Airlie
e14ffb1fa1 radeon: remove start/end offset + cleanup some whitespace 2008-12-22 12:11:21 +10:00
Dave Airlie
a42000bd6b radeon: fixup r500 FP emission for new CS 2008-12-22 11:41:23 +10:00
Dave Airlie
9f2732d312 radeno: hopefully make r200/radeon build 2008-12-21 09:54:35 +10:00
Julien Cristau
85d882983f Prepare changelog for upload 2008-12-14 09:59:33 +05:30
Timo Aaltonen
5387880f18 delete progs/trivial/ 2008-12-09 02:16:44 +02:00
Timo Aaltonen
a7a9398411 Build-depend on x11proto-dri2-dev (>= 1.99.3) 2008-12-09 02:01:40 +02:00
Timo Aaltonen
7593023f0b Update the changelog for the snapshot
also drop 01_disable-intel-classic-warn.diff since it's obsolete now.
2008-12-09 01:57:44 +02:00
Timo Aaltonen
92d9a71f60 Merge commit 'origin/debian-experimental' into debian-experimental
Conflicts:
	include/GLES/egltypes.h
	progs/miniglx/glfbdevtest.c
	progs/miniglx/manytex.c
	progs/miniglx/sample_server.c
	progs/miniglx/sample_server2.c
	progs/miniglx/texline.c
	progs/tests/Makefile.win
	progs/tests/antialias.c
	progs/tests/cva.c
	progs/tests/dinoshade.c
	progs/tests/getprocaddress.py
	progs/tests/jkrahntest.c
	progs/tests/manytex.c
	progs/tests/multipal.c
	progs/tests/multiwindow.c
	progs/tests/sharedtex.c
	progs/tests/texline.c
	progs/tests/texrect.c
	progs/tests/texwrap.c
	progs/trivial/Makefile
2008-12-09 01:38:08 +02:00
Timo Aaltonen
661890211e Merge commit 'mesa_7_2' into debian-experimental 2008-12-09 01:36:36 +02:00
Dave Airlie
72cd2c8c0c radeon: make DRI1 one work with new CS mechanism 2008-12-01 16:39:58 +10:00
Jerome Glisse
9770bb32f5 radeon: cs add print cs callback 2008-11-16 17:59:46 +01:00
Jerome Glisse
f1d98e5127 radeon: fix pointer dangling 2008-11-16 17:58:43 +01:00
Jerome Glisse
56c458e0f2 radeon: update to libdrm-radeon API changes 2008-11-15 10:40:32 +01:00
Jerome Glisse
5b79c18c83 radeon: dri2 don't forget to free buffer 2008-11-14 11:26:17 +01:00
Jerome Glisse
93a9d2f18d r300: release bo from pixmap 2008-11-14 11:26:17 +01:00
Jerome Glisse
c26ec97b13 r300: convert to new relocations format (see libdrm-radeon) 2008-11-14 11:26:17 +01:00
Jerome Glisse
d07d137931 r300: SetTex extension support 2008-11-14 11:26:17 +01:00
Jerome Glisse
3b43c28195 r300: cs + DRI2 support
If DRI2 is enabled then switch cmd assembly to directly build
hw packet.
2008-11-14 11:26:17 +01:00
Jerome Glisse
e5d5dab8c0 r300: bo and cs abstraction.
This abstract memory management and command stream building so we
can use different backend either legacy one which use old pathway
or a new one like with a new memory manager. This works was done by :

Nicolai Haehnle
Dave Airlie
Jerome Glisse
2008-11-14 11:26:17 +01:00
Julien Cristau
0206e20240 Also build the x86-specific dri drivers on kfreebsd (closes: #492894). 2008-10-26 15:58:46 +01:00
Julien Cristau
83a4719056 Update changelog 2008-10-26 15:34:37 +01:00
Ian Romanick
6cfe871c75 Use 3Dnow! x86-64 routines only on processors that support 3Dnow!
Added an x86-64 CPUID function and use it to detect 3Dnow!  If 3Dnow!
is available, use _mesa_3dnow_transform_points4_3d_no_rot,
_mesa_3dnow_transform_points4_perspective,
_mesa_3dnow_transform_points4_2d_no_rot, and _mesa_3dnow_transform_points4_2d.

This fixes long standing bug #8724.
(cherry picked from commit 2b8d8989fb)
2008-10-26 15:23:27 +01:00
Julien Cristau
84bb8fc695 Prepare changelog for upload 2008-09-24 14:28:28 +02:00
Julien Cristau
872cb1a0dd intel: don't warn about TTM init failure. 2008-09-24 14:25:30 +02:00
Julien Cristau
ee80a3a623 Remove the build-dep on dri2proto, DRI2 support has been removed. 2008-09-24 12:55:15 +02:00
Timo Aaltonen
e700c5ad99 Update the changelog, refresh patch 04. 2008-09-23 16:09:00 +03:00
Timo Aaltonen
08c0ec7a89 Merge commit 'mesa_7_2' into debian-experimental
Conflicts:

	include/GLES/egl.h
2008-09-23 16:06:40 +03:00
Brian Paul
35fe0e56e6 mesa: docs: remove parenthesis 2008-09-20 09:28:22 -06:00
Brian Paul
69e5311ad3 mesa: set 7.2 version for tarballs 2008-09-20 09:24:17 -06:00
Brian Paul
e884c4db2b mesa: prep for 7.2 release 2008-09-20 09:23:50 -06:00
Adam Jackson
e681bee04e Update to SGI FreeB 2.0.
Under the terms of version 1.1, "once Covered Code has been published
under a particular version of the License, Recipient may, for the
duration of the License, continue to use it under the terms of that
version, or choose to use such Covered Code under the terms of any
subsequent version published by SGI."

FreeB 2.0 license refers to "dates of first publication".  They are here
taken to be 1991-2000, as noted in the original license text:

 ** Original Code. The Original Code is: OpenGL Sample Implementation,
 ** Version 1.2.1, released January 26, 2000, developed by Silicon Graphics,
 ** Inc. The Original Code is Copyright (c) 1991-2000 Silicon Graphics, Inc.
 ** Copyright in any portions created by third parties is as indicated
 ** elsewhere herein. All Rights Reserved.

Official FreeB 2.0 text:

http://oss.sgi.com/projects/FreeB/SGIFreeSWLicB.2.0.pdf

As always, this code has not been tested for conformance with the OpenGL
specification.  OpenGL conformance testing is available from
http://khronos.org/ and is required for use of the OpenGL logo in
product advertising and promotion.
2008-09-20 09:21:34 -06:00
Julien Cristau
07c1fcc604 Prepare changelog for upload 2008-09-20 16:32:02 +02:00
Julien Cristau
7959b95efa Update debian/copyright to the SGI Free Software License B, version 2.0.
It now mirrors the free X11 license used by X.Org (closes: #368560).
http://www.sgi.com/company_info/newsroom/press_releases/2008/september/opengl.html
2008-09-19 18:03:59 +02:00
Brian Paul
3dd48d903f document _tnl_InvalidateState() fix 2008-09-18 15:28:31 -06:00
Brian Paul
e0ea4337fc mesa: fix null ptr deref bug in _tnl_InvalidateState(), bug 15834 2008-09-18 15:27:55 -06:00
Brian Paul
6290d7fd29 mesa: fix bug in previous changes to _slang_resolve_attributes() 2008-09-17 09:13:28 -06:00
Brian Paul
84ad182ab8 document glBindAttribLocation fixes 2008-09-16 16:37:17 -06:00
Brian Paul
a155ead515 mesa: rework GLSL vertex attribute binding
Calls to glBindAttribLocation() should not take effect until the next time
that glLinkProgram() is called.
gl_shader_program::Attributes now just contains user-defined bindings.
gl_shader_program::VertexProgram->Attributes contains the actual/final bindings.
2008-09-16 15:58:05 -06:00
Brian Paul
5b0f652456 mesa: fix display list regression (check if save->prim_count > 0 in vbo_save_EndList()) 2008-09-16 13:32:13 -06:00
Brian Paul
1be50e1638 fix msaa enable/disable bug 2008-09-15 17:15:51 -06:00
Brian Paul
4fefa29d8c mesa: fix MSAA enable state in update_multisample() 2008-09-15 17:14:41 -06:00
Brian Paul
ef479d9f2a document display list bug fix 2008-09-15 09:22:07 -06:00
Brian Paul
fc04604856 mesa: remove some assertions that are invalid during context tear-down 2008-09-15 09:20:30 -06:00
Keith Whitwell
ef2bd7860f mesa: get another class of degenerate dlists working
Primitive begin in one dlist, end in another.
2008-09-15 09:20:23 -06:00
Shane Blackett
dca8b4c964 glut: s/glut_fbc.c/glut_fcb.c/ 2008-09-14 17:51:53 -06:00
Brian Paul
419353dc2f mesa: Makefile: 7.2 release candidate 1 2008-09-13 16:06:12 -06:00
Brian Paul
38d3b2262b mesa: documentation updates for 7.2 release 2008-09-13 14:43:54 -06:00
Brian Paul
4db2a7f36c updated Cell driver info 2008-09-13 14:39:39 -06:00
Brian Paul
1145042fd2 Mesa: version bumps for 7.2 release 2008-09-13 14:36:35 -06:00
Brian Paul
772131280a document 7.2 bug fixes, etc 2008-09-13 14:36:17 -06:00
Jakub Bogusz
ee913c0fcc tdfx: fix crash and lack of visuals bug 2008-09-13 14:34:51 -06:00
Guillaume Melquiond
cd1804c43a i915: fix himask constant init for 64-bit build 2008-09-13 14:26:35 -06:00
Guillaume Melquiond
253784d45e glx: fix 64-bit datatype issue 2008-09-13 14:26:25 -06:00
Guillaume Melquiond
463d19d477 mesa: return after _mesa_problem() calls 2008-09-13 14:26:18 -06:00
Guillaume Melquiond
6e4fd90ca5 mesa: #include <stdio.h> 2008-09-13 14:26:13 -06:00
Guillaume Melquiond
06188c0c5c remove invalid XDestroyWindow() call 2008-09-13 14:26:06 -06:00
Guillaume Melquiond
dec9097647 silence warning 2008-09-13 14:25:59 -06:00
Guillaume Melquiond
e234339dba GLU: fix asst warnings 2008-09-13 14:25:53 -06:00
Ian Romanick
bb09d23e92 Remove DRI2 support
Remove support for the original incarnation of DRI2.  This version has
since been abandoned and will never ship.  This eliminates a build
dependency on a component that only exists in Fedora 9 and in now-dead
up-stream development trees.

I also recommend that we spin a Mesa 7.1.1 release with this patch.

Signed-off-by: Ian Romanick <ian.d.romanick@intel.com>
2008-09-12 13:48:14 -07:00
Xiang, Haihao
1ffbcddb6f i965: Add support for G41 chipset which is another 4 series.
(cherry picked from commit b2e083eba2)
2008-09-12 09:29:00 +08:00
Brice Goglin
5cd892a4e4 Fix grammar and punctuation in glxinfo(1) 2008-09-11 19:13:46 +02:00
Shane Blackett
33cf8f5c06 added 24bpp support 2008-09-11 08:35:37 -06:00
Shane Blackett
7b8d878bed Fixes for Mingw 2008-09-10 08:23:19 -06:00
Brian Paul
86ae34fbb4 mesa: replace MALLOC w/ CALLOC to fix memory error in glPushClientAttrib() 2008-09-05 08:07:07 -06:00
Brian Paul
16f3461fd6 mesa: improved gl_buffer_object reference counting
Use new _mesa_reference_buffer_object() function wherever possible.
Fixes buffer object/display list crash reported in ParaView.
2008-09-04 15:26:07 -06:00
Xiang, Haihao
0ac8886b51 intel: Fix depth_stencil texture.
(cherry picked from commit 0adfd10210)
2008-09-04 11:54:31 +08:00
Xiang, Haihao
1729d37223 mesa: merge stencil values into depth values for MESA_FORMAT_S8_Z24
(cherry picked from commit 218df7f9c5)
2008-09-04 11:54:21 +08:00
Jakob Bornecrantz
81edef6f9f mesa: Support for MESA_FORMAT_S8_Z24 texture
cherry-picked from gallium-0.1
(cherry picked from commit dc44bb8e92)
2008-09-04 11:54:08 +08:00
Brian Paul
e040e18c7b fix BUFFER_DEPTH/BUFFER_ACCUM mix-up 2008-09-02 18:13:53 -06:00
Roland Scheidegger
14d186644b fix no error generated when calling glLight{if}[v] inside begin/end (bug 17408) 2008-09-02 15:49:35 +02:00
Xiang, Haihao
e4535e4d5e i965: force thread switch after IF/ELSE/ENDIF. partial fix for #16882.
A thread switch is implicitly invoked after the issuance of an IF/ELSE/ENDIF
instruction if necessary. Unfortunately it seems sometimes a forced thread
switch is needed.
2008-08-29 10:30:12 +08:00
Xiang, Haihao
a008813890 i965: mask control for BREAK/CONT/DO/WHILE. partial fix fox #16882 2008-08-29 10:30:03 +08:00
Xiang, Haihao
da50dc7bb3 i965: Push/pop instruction state. partial fix for #16882 2008-08-29 10:29:57 +08:00
Brian Paul
7f628d9cbc mesa: bump MAX_INSN to 350 2008-08-28 15:16:33 -06:00
Julien Cristau
f9affb3059 Prepare changelog for upload 2008-08-27 19:52:30 +02:00
Julien Cristau
fd7cc514d2 Some more parallel build updates. 2008-08-27 19:52:14 +02:00
Julien Cristau
f6a927b45f Update changelog 2008-08-27 17:29:28 +02:00
Julien Cristau
8772e02b68 Merge tag 'mesa_7_1' into debian-experimental 2008-08-27 17:28:31 +02:00
Brian Paul
b2ffd0be03 placeholder for upcoming 7.2 release notes 2008-08-26 16:24:37 -06:00
Brian Paul
912b16c689 added 7.1 MD5 sums 2008-08-26 16:11:56 -06:00
Brian Paul
6d9b25e522 mesa: don't check for GLSL 1.2 to advertise GL 2.1
The GLSL 1.2 features are minor...
2008-08-26 15:50:11 -06:00
Corbin Simpson
31bad23f0f note ATI R500 series support 2008-08-26 12:39:27 -06:00
Timo Jyrinki
29b9b25e72 asst. html doc updates 2008-08-26 12:36:23 -06:00
Brian Paul
e794f496c6 mesa: assorted updates/prep for 7.1 release 2008-08-25 14:09:14 -06:00
Brian Paul
68067c66d3 mesa: glsl: regenerated file 2008-08-25 09:16:21 -06:00
Brian Paul
ad5474e995 mesa: glsl: grab latest fixes from gallium-0.1 branch
Includes:
1. Fixes failed asserting about bad swizzles in src reg emit.
2. Tracks uniform var usage.
3. Emit exp() in terms of EXP2 instruction.
2008-08-25 09:15:16 -06:00
Julien Cristau
ac8771ee99 Update changelog 2008-08-24 17:38:03 +02:00
Julien Cristau
16358bb3cc Merge branch 'mesa_7_2_branch' of git.freedesktop.org:/git/mesa/mesa into debian-experimental 2008-08-24 17:34:47 +02:00
Julien Cristau
ef160330e5 Merge tag 'mesa_7_1_rc4' into debian-experimental
Conflicts:

	progs/fp/Makefile
	progs/slang/Makefile
	progs/tools/trace/gltrace_support.cc
	progs/trivial/Makefile
2008-08-16 18:43:53 +02:00
Julien Cristau
332dcfb60b Add parallel build support. 2008-08-04 12:49:03 +02:00
Julien Cristau
a8dde163dc Prepare changelog for upload 2008-07-13 19:42:01 +02:00
Julien Cristau
868d0accef update changelog and patches
01_fix-installdir.patch dropped, applied upstream
04_osmesa_version.diff needed fixing
2008-07-13 19:36:56 +02:00
Julien Cristau
64e57ed257 Merge branch 'master' of git://anongit.freedesktop.org/git/mesa/mesa into debian-experimental
Conflicts:

	progs/tests/antialias.c
	progs/tools/trace/Makefile
2008-07-13 19:20:03 +02:00
Julien Cristau
e325b76444 Prepare changelog for upload 2008-07-12 18:56:22 +02:00
Julien Cristau
34eedc6a98 update changelog 2008-07-12 18:55:55 +02:00
Julien Cristau
8c21c2e07e Merge branch 'mesa_7_0_branch' of git://anongit.freedesktop.org/git/mesa/mesa into debian-unstable 2008-07-12 17:21:50 +02:00
Brian Paul
27425708f5 mesa: return -1, not GL_FALSE if _glapi_add_dispatch() fails name sanity check 2008-07-09 15:06:49 -06:00
Brian Paul
fc07b6cda0 ARB program, GLSL fixes 2008-07-09 08:58:47 -06:00
Brian Paul
562ed27eb5 mesa: remove debug code 2008-07-09 08:52:44 -06:00
Brian Paul
0a0e09078d mesa: implement glGetUniformiv() with new ctx->Driver function
The old implementation could overwrite the caller's param buffer.

cherry-picked from master
2008-07-09 08:51:35 -06:00
Brian Paul
50bc5a75a7 mesa: fix state.clip[n].plane parsing bug (bug 16611) 2008-07-09 08:42:49 -06:00
Brian Paul
6661f53eb3 mesa: check for OpenBSD (bug 15604)
cherry-picked from master
2008-07-09 08:42:28 -06:00
Xiang, Haihao
b8782affc8 i915: fall back to software rendering when shadow comparison is
enabled for 1D texture. fix #12176

Cherry-picked from commit 75e4db1804
2008-07-09 13:44:13 +08:00
Brian Paul
9a9e839b9b added null texObj ptr check (bug 15567) 2008-07-08 15:13:23 -06:00
Julien Cristau
b04ccc9a03 Disable the i915tex driver, it doesn't build against libdrm 2.3.1. 2008-07-08 18:18:56 +02:00
Xiang, Haihao
aa522e14ee i965: official name for GM45 chipset 2008-07-08 14:39:01 +08:00
Julien Cristau
dabd09f5a9 some more debian/rules adjustments
build the software libGL with --disable-gl-osmesa, and try to fix some
rules dependencies
2008-07-06 14:03:58 +02:00
Julien Cristau
46ffb3c0b1 debian/rules cleanup and fixes
* tell configure which dri drivers we want to build, based on the old
  configs/debian-dri-default
* disable direct rendering for the glx libGL on the hurd
* make sure patches are applied before we run autoreconf, and autoreconf
  runs before all builds
2008-07-05 14:03:57 +02:00
Julien Cristau
4b9b01f0a5 Use --with-driver=dri for the dri config
the default is xlib on some architectures and dri on others, so we
need to set that explicitly
2008-07-05 12:59:14 +02:00
Timo Aaltonen
0261355a03 Fix confflags CFLAGS and clean up confflags-dri. 2008-07-04 11:50:09 +03:00
Timo Aaltonen
beb8547c71 Delete two files not available on the tarball.
docs/gears.png
src/glut/os2/src-glut_os2pm.zip
2008-07-04 11:50:08 +03:00
Timo Aaltonen
4aa518a2d7 Add a patch from upstream to set installdir properly.
this also replaces 01_fix-libdir.patch and the need to set --libdir for
every target.
2008-07-04 11:50:08 +03:00
root
08af66d57e Revert "Remove configs/current on clean."
This reverts commit 2380f8bd93.

Conflicts:

	debian/changelog
2008-07-04 11:50:08 +03:00
root
38eb154b39 Use --enable-glx-tls for dri. 2008-07-04 11:50:08 +03:00
Timo Aaltonen
2954e4c3d7 Disable glut for swx11 targets.
It was not built before either and would need new build-deps (xi xmu).
2008-07-04 11:50:08 +03:00
Julien Cristau
213803b4d4 fix libOSMesa versioning, to revert accidental SONAME bump. 2008-07-03 18:30:35 +02:00
Timo Aaltonen
2380f8bd93 Remove configs/current on clean. 2008-07-03 18:37:28 +03:00
Timo Aaltonen
e846ebc1a1 don't chmod configure which does not exist. 2008-07-03 18:14:25 +03:00
Timo Aaltonen
6dedd60350 Further autoconf changes:
add automake & autoconf to build-deps
add some cleanup rules
2008-07-03 15:53:19 +03:00
Timo Aaltonen
063a487fe1 Fix the configure.ac patch somewhat
workaround the problems by setting --libdir for all flavours, otherwise
the path used is /usr/usr/lib.
2008-07-03 13:20:21 +03:00
Timo Aaltonen
99a35fd4e1 01_fix-libdir.patch: libdir handling is broken in configure.ac, fix it. 2008-07-03 09:31:23 +03:00
Timo Aaltonen
cbaac82c2c Further tweaks to the autoconf stuff. Getting closer but still not there 2008-07-03 09:26:46 +03:00
Brian Paul
2c9e332bce mesa: when linking a shader program, make sure all the shaders compiled OK
cherry-picked from master
2008-07-02 17:05:01 -06:00
Brian Paul
e89deed74d mesa: fix error codes in _mesa_shader_source(), _mesa_get_shader_source()
cherry-picked from master
If the 'shader' parameter is wrong, need to either generate GL_INVALID_VALUE
or GL_INVALID_OPERATION.  It depends on whether 'shader' actually names a
'program' or is a totally unknown ID.
There might be other cases to fix...
2008-07-02 17:02:41 -06:00
Brian Paul
5cb6f5515f mesa: regenerated file 2008-07-02 17:02:14 -06:00
Brian Paul
c5024d4a5c mesa: added some missing equal() notEqual() intrinsics
cherry-picked from master
2008-07-02 17:01:26 -06:00
Timo Aaltonen
9d72de1fb2 Run autoreconf before building the various flavours. 2008-07-03 00:20:58 +03:00
Brian Paul
62626467b4 fixes some GLSL bugs 2008-07-02 12:45:16 -06:00
Brian Paul
c55a72ef48 mesa: regenerated files 2008-07-02 12:42:52 -06:00
Brian Paul
8a353c4020 mesa: fix all(bvec2) function typo, add missing bvec2/3/4() constuctors
cherry-picked from master
2008-07-02 12:42:12 -06:00
Brian Paul
8261c40bb9 mesa: init default span fog if fragprog uses fog input register
See bug #16194 for original patch.  Cleaned up a bit here.
2008-07-02 08:58:32 -06:00
Timo Aaltonen
053bf7f5db rules: Replace the old build system with the new autotools-based system. 2008-07-02 17:56:51 +03:00
Timo Aaltonen
e6a5e6512f Add gl.pc to libgl1-mesa-dev 2008-07-02 14:07:23 +03:00
Timo Aaltonen
bc32cd7fc8 Add dri_interface.h to mesa-common-dev. 2008-07-01 18:58:17 +03:00
Timo Aaltonen
24fde3cf34 Drop mesa-swx11-source. 2008-07-01 18:56:38 +03:00
Timo Aaltonen
7ceaa0916a Re-add linux-osmesa-static and linux-osmesa32-static
they were dropped by mistake during the merge.
2008-07-01 18:51:01 +03:00
Timo Aaltonen
4c958fbfb4 Build-depend on x11proto-dri2-dev. 2008-07-01 16:24:46 +03:00
Timo Aaltonen
9795ef4348 Refresh patches, and drop obsolete 00_create-libdir.patch and 01_fix-makefile.patch 2008-07-01 16:07:17 +03:00
Julien Cristau
768d8e0563 update changelog and require libdrm 2.3.1 2008-07-01 13:46:54 +02:00
Julien Cristau
374be37dd9 Merge branch 'master' of git.freedesktop.org:/git/mesa/mesa into debian-experimental
Conflicts:

	.gitignore
	Makefile
	bin/mklib
	configs/.gitignore
	configs/default
	configs/freebsd
	configs/freebsd-dri
	configs/linux-osmesa
	configs/linux-osmesa16
	configs/linux-osmesa16-static
	configs/linux-osmesa32
	docs/download.html
	docs/install.html
	docs/news.html
	docs/relnotes.html
	doxygen/Makefile
	doxygen/doxy.bat
	doxygen/header.html
	doxygen/header_subset.html
	include/GL/internal/dri_interface.h
	progs/demos/.gitignore
	progs/directfb/Makefile
	progs/egl/Makefile
	progs/fbdev/Makefile
	progs/fbdev/glfbdevtest.c
	progs/fp/Makefile
	progs/glsl/.gitignore
	progs/glsl/Makefile
	progs/glsl/bump.c
	progs/glsl/mandelbrot.c
	progs/glsl/noise.c
	progs/glsl/toyball.c
	progs/miniglx/Makefile
	progs/samples/.gitignore
	progs/slang/Makefile
	progs/tests/.gitignore
	progs/tests/Makefile
	progs/tests/arbnpot.c
	progs/tests/cva.c
	progs/tests/dinoshade.c
	progs/tests/drawbuffers.c
	progs/tests/fbotest2.c
	progs/tests/fbotexture.c
	progs/tests/getprocaddress.c
	progs/tests/mipmap_limits.c
	progs/tests/multipal.c
	progs/tests/texline.c
	progs/tools/trace/Makefile
	progs/trivial/Makefile
	progs/trivial/dlist-edgeflag-dangling.c
	progs/trivial/dlist-edgeflag.c
	progs/trivial/point-param.c
	progs/trivial/quad-clip-nearplane.c
	progs/trivial/tri.c
	progs/vp/Makefile
	progs/xdemos/.gitignore
	progs/xdemos/Makefile
	progs/xdemos/glthreads.c
	src/egl/Makefile
	src/egl/drivers/demo/Makefile
	src/egl/drivers/dri/Makefile
	src/egl/main/Makefile
	src/glu/mesa/Makefile
	src/glu/mesa/Makefile.m32
	src/glu/mesa/project.c
	src/glu/mini/project.c
	src/glut/directfb/Makefile
	src/glut/directfb/callback.c
	src/glut/directfb/events.c
	src/glut/directfb/internal.h
	src/glut/directfb/window.c
	src/glut/os2/Makefile
	src/glut/os2/WarpWin.cpp
	src/glut/os2/glutOverlay.cpp
	src/glut/os2/glut_8x13.cpp
	src/glut/os2/glut_9x15.cpp
	src/glut/os2/glut_bitmap.cpp
	src/glut/os2/glut_cindex.cpp
	src/glut/os2/glut_cmap.cpp
	src/glut/os2/glut_cursor.cpp
	src/glut/os2/glut_event.cpp
	src/glut/os2/glut_ext.cpp
	src/glut/os2/glut_fullscrn.cpp
	src/glut/os2/glut_gamemode.cpp
	src/glut/os2/glut_get.cpp
	src/glut/os2/glut_hel10.cpp
	src/glut/os2/glut_hel12.cpp
	src/glut/os2/glut_hel18.cpp
	src/glut/os2/glut_init.cpp
	src/glut/os2/glut_input.cpp
	src/glut/os2/glut_key.cpp
	src/glut/os2/glut_keyctrl.cpp
	src/glut/os2/glut_keyup.cpp
	src/glut/os2/glut_mesa.cpp
	src/glut/os2/glut_modifier.cpp
	src/glut/os2/glut_roman.cpp
	src/glut/os2/glut_shapes.cpp
	src/glut/os2/glut_stroke.cpp
	src/glut/os2/glut_swap.cpp
	src/glut/os2/glut_teapot.cpp
	src/glut/os2/glut_tr24.cpp
	src/glut/os2/glut_util.cpp
	src/glut/os2/glut_vidresize.cpp
	src/glut/os2/glut_warp.cpp
	src/glut/os2/glut_win.cpp
	src/glut/os2/glut_winmisc.cpp
	src/glut/os2/glutbitmap.h
	src/glut/os2/glutstroke.h
	src/glut/os2/layerutil.h
	src/glut/os2/libGlut.DEF
	src/glut/os2/os2_glx.cpp
	src/glut/os2/os2_menu.cpp
	src/glut/os2/os2_winproc.cpp
	src/glw/Makefile
	src/glx/mini/Makefile
	src/glx/mini/miniglx.c
	src/glx/x11/glxext.c
	src/mesa/Makefile
	src/mesa/drivers/allegro/amesa.c
	src/mesa/drivers/allegro/direct.h
	src/mesa/drivers/allegro/generic.h
	src/mesa/drivers/d3d/D3DCAPS.CPP
	src/mesa/drivers/d3d/D3DHAL.H
	src/mesa/drivers/d3d/D3DInit.cpp
	src/mesa/drivers/d3d/D3DMESA.H
	src/mesa/drivers/d3d/D3DRaster.cpp
	src/mesa/drivers/d3d/D3DTEXT.CPP
	src/mesa/drivers/d3d/D3DTextureMgr.cpp
	src/mesa/drivers/d3d/D3DTextureMgr.h
	src/mesa/drivers/d3d/D3DUTILS.CPP
	src/mesa/drivers/d3d/DDrawPROCS.c
	src/mesa/drivers/d3d/DEBUG.C
	src/mesa/drivers/d3d/DEBUG.H
	src/mesa/drivers/d3d/DbgEnv.bat
	src/mesa/drivers/d3d/MAKEFILE
	src/mesa/drivers/d3d/OPENGL32.DEF
	src/mesa/drivers/d3d/WGL.C
	src/mesa/drivers/dri/Makefile.template
	src/mesa/drivers/dri/common/dri_bufmgr.c
	src/mesa/drivers/dri/common/dri_drmpool.c
	src/mesa/drivers/dri/common/dri_util.c
	src/mesa/drivers/dri/common/dri_util.h
	src/mesa/drivers/dri/common/xmlconfig.c
	src/mesa/drivers/dri/glcore/Makefile
	src/mesa/drivers/dri/i915/i915_fragprog.c
	src/mesa/drivers/dri/i915/i915_program.h
	src/mesa/drivers/dri/i915/i915_texprog.c
	src/mesa/drivers/dri/i915/i915_texstate.c
	src/mesa/drivers/dri/i915/i915_vtbl.c
	src/mesa/drivers/dri/i915/intel_context.c
	src/mesa/drivers/dri/i915/intel_context.h
	src/mesa/drivers/dri/i915/intel_pixel.c
	src/mesa/drivers/dri/i915/intel_render.c
	src/mesa/drivers/dri/i915/intel_screen.c
	src/mesa/drivers/dri/i915/intel_state.c
	src/mesa/drivers/dri/i915/intel_tex.c
	src/mesa/drivers/dri/i915/intel_tris.c
	src/mesa/drivers/dri/i915tex/i830_reg.h
	src/mesa/drivers/dri/i915tex/i830_texstate.c
	src/mesa/drivers/dri/i915tex/i830_vtbl.c
	src/mesa/drivers/dri/i915tex/i915_fragprog.c
	src/mesa/drivers/dri/i915tex/i915_metaops.c
	src/mesa/drivers/dri/i915tex/i915_tex_layout.c
	src/mesa/drivers/dri/i915tex/i915_texstate.c
	src/mesa/drivers/dri/i915tex/i915_vtbl.c
	src/mesa/drivers/dri/i915tex/intel_render.c
	src/mesa/drivers/dri/i915tex/intel_screen.c
	src/mesa/drivers/dri/i915tex/intel_tris.c
	src/mesa/drivers/dri/i965/brw_aub.c
	src/mesa/drivers/dri/i965/brw_aub_playback.c
	src/mesa/drivers/dri/i965/brw_cc.c
	src/mesa/drivers/dri/i965/brw_clip.c
	src/mesa/drivers/dri/i965/brw_clip_state.c
	src/mesa/drivers/dri/i965/brw_clip_util.c
	src/mesa/drivers/dri/i965/brw_context.c
	src/mesa/drivers/dri/i965/brw_curbe.c
	src/mesa/drivers/dri/i965/brw_defines.h
	src/mesa/drivers/dri/i965/brw_draw.c
	src/mesa/drivers/dri/i965/brw_draw_upload.c
	src/mesa/drivers/dri/i965/brw_eu.h
	src/mesa/drivers/dri/i965/brw_eu_emit.c
	src/mesa/drivers/dri/i965/brw_gs_state.c
	src/mesa/drivers/dri/i965/brw_misc_state.c
	src/mesa/drivers/dri/i965/brw_sf_emit.c
	src/mesa/drivers/dri/i965/brw_sf_state.c
	src/mesa/drivers/dri/i965/brw_state_cache.c
	src/mesa/drivers/dri/i965/brw_state_pool.c
	src/mesa/drivers/dri/i965/brw_tex.c
	src/mesa/drivers/dri/i965/brw_tex_layout.c
	src/mesa/drivers/dri/i965/brw_vs_state.c
	src/mesa/drivers/dri/i965/brw_vs_tnl.c
	src/mesa/drivers/dri/i965/brw_wm.c
	src/mesa/drivers/dri/i965/brw_wm.h
	src/mesa/drivers/dri/i965/brw_wm_glsl.c
	src/mesa/drivers/dri/i965/brw_wm_sampler_state.c
	src/mesa/drivers/dri/i965/brw_wm_state.c
	src/mesa/drivers/dri/i965/brw_wm_surface_state.c
	src/mesa/drivers/dri/i965/bufmgr_fake.c
	src/mesa/drivers/dri/i965/intel_batchbuffer.c
	src/mesa/drivers/dri/i965/intel_batchbuffer.h
	src/mesa/drivers/dri/i965/intel_blit.c
	src/mesa/drivers/dri/i965/intel_blit.h
	src/mesa/drivers/dri/i965/intel_buffers.c
	src/mesa/drivers/dri/i965/intel_context.c
	src/mesa/drivers/dri/i965/intel_context.h
	src/mesa/drivers/dri/i965/intel_mipmap_tree.c
	src/mesa/drivers/dri/i965/intel_mipmap_tree.h
	src/mesa/drivers/dri/i965/intel_pixel_bitmap.c
	src/mesa/drivers/dri/i965/intel_pixel_copy.c
	src/mesa/drivers/dri/i965/intel_screen.c
	src/mesa/drivers/dri/i965/intel_tex_validate.c
	src/mesa/drivers/dri/i965/server/i830_common.h
	src/mesa/drivers/dri/intel/intel_batchbuffer.c
	src/mesa/drivers/dri/intel/intel_batchbuffer.h
	src/mesa/drivers/dri/intel/intel_blit.c
	src/mesa/drivers/dri/intel/intel_buffers.c
	src/mesa/drivers/dri/intel/intel_context.c
	src/mesa/drivers/dri/intel/intel_context.h
	src/mesa/drivers/dri/intel/intel_mipmap_tree.c
	src/mesa/drivers/dri/intel/intel_mipmap_tree.h
	src/mesa/drivers/dri/intel/intel_screen.h
	src/mesa/drivers/dri/r200/r200_texstate.c
	src/mesa/drivers/dri/r300/r300_cmdbuf.c
	src/mesa/drivers/dri/r300/r300_context.h
	src/mesa/drivers/dri/r300/r300_ioctl.c
	src/mesa/drivers/dri/r300/r300_reg.h
	src/mesa/drivers/dri/r300/r300_state.c
	src/mesa/drivers/dri/r300/r300_tex.h
	src/mesa/drivers/dri/r300/r300_texstate.c
	src/mesa/drivers/dri/radeon/radeon_screen.c
	src/mesa/drivers/windows/gdi/wmesa.c
	src/mesa/drivers/x11/fakeglx.c
	src/mesa/drivers/x11/xm_dd.c
	src/mesa/glapi/Makefile
	src/mesa/glapi/dispatch.h
	src/mesa/glapi/glapioffsets.h
	src/mesa/glapi/glapitable.h
	src/mesa/glapi/glapitemp.h
	src/mesa/glapi/glprocs.h
	src/mesa/main/api_validate.c
	src/mesa/main/attrib.c
	src/mesa/main/config.h
	src/mesa/main/context.c
	src/mesa/main/context.h
	src/mesa/main/dlist.c
	src/mesa/main/drawpix.c
	src/mesa/main/enums.c
	src/mesa/main/fbobject.c
	src/mesa/main/image.c
	src/mesa/main/imports.h
	src/mesa/main/mtypes.h
	src/mesa/main/points.c
	src/mesa/main/state.c
	src/mesa/main/texcompress_fxt1.c
	src/mesa/main/texenvprogram.c
	src/mesa/main/teximage.c
	src/mesa/main/texobj.c
	src/mesa/main/texstate.c
	src/mesa/main/version.h
	src/mesa/shader/prog_execute.c
	src/mesa/shader/program.c
	src/mesa/shader/shader_api.c
	src/mesa/shader/slang/library/slang_core.gc
	src/mesa/shader/slang/library/slang_core_gc.h
	src/mesa/shader/slang/slang_codegen.c
	src/mesa/sources
	src/mesa/sparc/glapi_sparc.S
	src/mesa/swrast/s_aalinetemp.h
	src/mesa/swrast/s_aatriangle.c
	src/mesa/swrast/s_aatritemp.h
	src/mesa/swrast/s_context.c
	src/mesa/swrast/s_copypix.c
	src/mesa/swrast/s_drawpix.c
	src/mesa/swrast/s_fragprog.c
	src/mesa/swrast/s_pointtemp.h
	src/mesa/swrast/s_readpix.c
	src/mesa/swrast/s_span.c
	src/mesa/swrast/s_texfilter.c
	src/mesa/swrast/s_tritemp.h
	src/mesa/swrast/s_zoom.c
	src/mesa/tnl/t_draw.c
	src/mesa/tnl/t_vb_fog.c
	src/mesa/tnl/t_vb_program.c
	src/mesa/tnl/t_vp_build.c
	src/mesa/vbo/vbo_split_copy.c
	src/mesa/x86-64/xform4.S
	src/mesa/x86/common_x86.c
	src/mesa/x86/glapi_x86.S
	windows/VC6/mesa/mesa/mesa.dsp
2008-07-01 13:18:27 +02:00
Xiang, Haihao
9fa552eb0f dri: Take the base image size into account when computing
first level of the mipmap. fix #16421
2008-07-01 11:50:11 +08:00
Brian Paul
5f8ad807be s/GL_INVALID_VALUE/GL_INVALID_OPERATION/ in _mesa_get_uniformfv() 2008-06-28 16:50:07 -06:00
Zou Nan hai
b6e165d661 optimize 965 clip
1. increase clip thread number to 2
  2. do cliptest for -rhw

Cherry-picked from commits b47c9f8c91,
aa88d11e7d.
2008-06-23 15:16:11 +08:00
Roland Scheidegger
afbb645906 r200: fix typo in r200TryDrawPixels parameter validation (bug 16406) 2008-06-21 02:52:18 +02:00
Brice Goglin
2b831e73f5 Prepare changelog for upload 2008-06-18 20:59:24 +02:00
Brice Goglin
6ec170290c Put all configs/ changes into the .diff.gz
Put back our configs/ changes into the .diff.gz since choose-configs
needs them before quilt is invoked. Put 04_cleanup-osmesa-configs.patch
there as well for #485161.
2008-06-18 20:59:09 +02:00
Brice Goglin
7c8ea0899a Revert "Move our configs/ changes from the .diff.gz into our quilt patches"
This reverts commit 03970183fc.

Conflicts:

	debian/changelog
2008-06-18 20:55:42 +02:00
Brice Goglin
f81070dbd5 Pull from mesa_7_0_branch 2008-06-18 20:55:00 +02:00
Brice Goglin
955c2ef48f Merge branch 'mesa_7_0_branch' of git://git.freedesktop.org/git/mesa/mesa into debian-unstable 2008-06-18 20:52:25 +02:00
Xiang, Haihao
2ac4919d24 i965: add support for Intel 4 series chipsets 2008-06-18 15:48:45 +08:00
Xiang, Haihao
3ed89025f3 i915: The pitch passed to intelEmitCopyBlitLocked should be in pixels,
not in bytes. Reported by Christopher Dissauer.
2008-06-18 13:52:04 +08:00
Xiang, Haihao
5b42bbce70 i915: fix data size in intelTryDrawPixels. Reported by Christopher Dissauer 2008-06-18 13:40:22 +08:00
Brian Paul
d2e0a11aab mesa: fix inconsistent use of GL_UNSIGNED_INT vs. GL_UNSIGNED_INT_24_8_EXT for Z unpacking 2008-06-17 16:44:00 -06:00
Brice Goglin
5033e5b36d Prepare changelog for upload 2008-06-17 20:01:01 +02:00
Brice Goglin
6a6a9c1c5a Pull from mesa_7_0_branch 2008-06-17 20:00:37 +02:00
Brice Goglin
3d6aa2e06f Merge branch 'mesa_7_0_branch' of git://git.freedesktop.org/git/mesa/mesa into debian-unstable 2008-06-17 19:54:47 +02:00
Brice Goglin
03970183fc Move our configs/ changes from the .diff.gz into our quilt patches
with 04_cleanup-osmesa-configs.patch renamed into 04_debian-configs.patch
2008-06-17 19:32:21 +02:00
Brian Paul
47d046c93f mesa: make mm.c use unsigned ints for offsets.
If you have a GPU using this code and it has the offsets up in this space,
this fails.

cherry-picked from master
2008-06-17 10:10:53 -06:00
Wilfried Holzke
718724deeb assorted glide driver fixes/updates 2008-06-17 10:03:03 -06:00
Brian Paul
85c325c36c add hyphen to rm command 2008-06-17 10:02:10 -06:00
Brian Paul
7e6d99f5ec glu: silence warnings 2008-06-17 09:01:40 -06:00
Brian Paul
6ce6dc961b bump version to 7.0.4 2008-06-16 10:19:29 -06:00
Brian Paul
186883611e fix glPixelZoom stack over flow on Windows 2008-06-16 10:19:28 -06:00
Brian Paul
48b3c59cb9 mesa: allocate pixel zoom arrays on heap, not stack
Fixes stack overflow on Windows.

cherry-picked from master
2008-06-16 10:19:28 -06:00
Brian Paul
04b9d5bc23 Fix _mesa_new_program() recursive call regression
This was introduced by the "i965 GLSL merge" from master (ce7a9efb09)
2008-06-16 10:19:28 -06:00
Brian Paul
91707e9020 fix GLSL generic vertex attrib linking bug 2008-06-16 10:19:28 -06:00
Xiang, Haihao
82a0e82232 i965: fix intel_batchbuffer_space. (bug#14709) 2008-06-13 13:53:46 +08:00
Brice Goglin
fe4264bf45 Prepare changelog for upload 2008-06-13 06:53:55 +02:00
Brice Goglin
2fa795a213 Pull from mesa_7_0_branch 2008-06-11 18:59:59 +02:00
Brice Goglin
e32aaf5da8 Merge branch 'mesa_7_0_branch' of git://git.freedesktop.org/git/mesa/mesa into debian-unstable 2008-06-11 18:58:59 +02:00
Brian
03447de338 disable ctx->Driver.NewProgram() call in _mesa_new_program()
This was causing infinite recursive calls w/ software drivers.
All vertex/fragment shaders should be allocated by calling
ctx->Driver.NewProgram(), not by calling _mesa_new_program().

(Cherry picked from commit 40133487db,
351a83163a).
2008-06-11 17:03:47 +08:00
Dave Airlie
ee5f4a4caf r300: disable the lowimpact fallbacks by default.
because really we should be able to just fix the driver.
(cherry picked from commit 7013eecf28)

There are actually even better reasons for this, the bottom line being that
enabling these fallbacks makes a lot of apps unusable mostly for no gain
whatsoever.
2008-06-11 10:42:16 +02:00
Xiang, Haihao
c04f3933ab i915: fix fd.o #14966 2008-06-11 11:36:01 +08:00
Xiang, Haihao
8f328c45e5 i915: Keith Whitwell's swizzling TEX patch. fix #8283
Cherry picked from commit 3369cd9a6f
2008-06-11 11:32:12 +08:00
Brice Goglin
9676f0cffc Pull from mesa_7_0_branch 2008-06-10 23:18:28 +02:00
Brice Goglin
2d0ca23319 Merge branch 'mesa_7_0_branch' of git://git.freedesktop.org/git/mesa/mesa into debian-unstable 2008-06-10 22:48:43 +02:00
Xiang, Haihao
6f4c8b5b50 i965: apply commit 6c1a98e97a to glsl
(cherry picked from commit a742bed99a)
2008-06-10 16:46:02 +08:00
Michal Wajdeczko
f8bd9cc30f Add support for ATI_separate_stencil in display lists.
(cherry picked from commit 7f747204ea)
2008-06-10 16:28:06 +08:00
Michal Wajdeczko
d9f9b1cd0b [965] Correctly set read mask for OPCODE_SWZ in pass1.
While OPCODE_SWZ has usually been optimized away in pass0, it may still
exist if a SWZ with dst saturate was emitted in pass_fp.  Fixes an error
in oglconform fpalu.c.
(cherry picked from commit 13a6f73a64)
2008-06-10 16:21:31 +08:00
Michal Wajdeczko
eca283976b [965] Avoid emitting dead code for DPx/math instructions.
The pass1 optimization stage clears out writemasks and registers, but the
instructions themselves are still being processed at this stage, and could
have resulted in them still being emitted.
(cherry picked from commit c60b5dfde8)
2008-06-10 16:18:48 +08:00
Michal Wajdeczko
2176259ca6 [965] Improve pinterp performance by delaying reads of just-written regs.
(cherry picked from commit bb419970ef)
2008-06-10 16:18:09 +08:00
Michal Wajdeczko
8fe6fcb900 [965] Fix negating of unsigned value in emit_wpos_xy.
(cherry picked from commit 6c1a98e97a)
2008-06-10 16:16:52 +08:00
Michal Wajdeczko
76d6edcc38 [965] Add MVP code for position invariant vertex programs.
This fixes the arbvptorus demo.
(cherry picked from commit 5f10438f2d)
2008-06-10 16:13:06 +08:00
Michal Wajdeczko
98d6c671f5 [win32] Use native aligned memory allocation functions.
(cherry picked from commit 31fe7cf5e3)
2008-06-10 16:12:18 +08:00
Andrzej Trznadel
f652811df4 [965] Fix fp temp reg release code to not usually release all temps.
Also, use wrapped ffs() instead of native.
(cherry picked from commit 3105bc1d88)
2008-06-10 15:45:11 +08:00
Andrzej Trznadel
e279f4601d Fix compat implementation of ffs() to return 1-based bit numbers.
(cherry picked from commit e9809a36aa)
2008-06-10 15:44:53 +08:00
Keith Packard
87a30337a1 [i965] short immediate values must be replicated to both halves of the dword
The 32-bit immediate value in the i965 instruction word must contain two
copies of any 16-bit constants. brw_imm_uw and brw_imm_w just needed to
copy the value into both halves of the immediate value instruction field.
(cherry picked from commit ca73488f48)
2008-06-10 15:37:11 +08:00
Eric Anholt
9c2047b275 [965] Don't let the negate flags of src0 affect 1 constants in precalc_dst/lit
This patch is a variant of a submission by Michal Wajdeczko to fix
oglconform fpalu failures.
(cherry picked from commit b4cbf6983e)
2008-06-10 15:32:53 +08:00
Zou Nan hai
1dcb0433a3 [i915] fix fragment.position 2008-06-10 15:28:07 +08:00
Zou Nan hai
5ff27e02b3 [i965] fix wpos height 1 pixel higher
(cherry picked from commit b0f681b458)
2008-06-10 15:25:20 +08:00
Eric Anholt
4beee58e57 [965] Bug #9151: make fragment.position return window coords not screen coords.
(cherry picked from commit 9c8f27ba13)
2008-06-10 15:22:08 +08:00
Eric Anholt
1f9de20719 [915] Fix COS function using same plan as SIN.
The previous COS function failed badly outside of [-pi/2, pi/2].
2008-06-10 14:55:52 +08:00
Eric Anholt
d05a8d9750 [915] Use a quartic term to improve the accuracy of SIN results.
This is described in the link in the comment, and is the same technique that
r300 uses.
2008-06-10 14:46:12 +08:00
Eric Anholt
db5f206c00 [915] Fix fp SIN function, and use a quadratic approximation instead of Taylor.
The Taylor series notably fails at producing sin(pi) == 0, which leads to
discontinuity every 2*pi.  The quadratic gets us sin(pi) == 0 behavior, at the
expense of going from 2.4% THD with working Taylor series to 3.8% THD (easily
seen on comparative graphs of the two).  However, our previous implementation
was producing sin(pi) < -1 and worse, so any reasonable approximation is an
improvement.  This also fixes the repeating behavior, where the previous
implementation would repeat sin(x) for x>pi as sin(x % pi) and the opposite
for x < -pi.
2008-06-10 14:22:36 +08:00
Eric Anholt
9dface8347 [965] Fix potential segfaults from bad realloc.
C has no order of evaluation restrictions on function arguments, so we
attempted to realloc from new-size to new-size.
(cherry picked from commit e747e9a072)
2008-06-10 13:54:01 +08:00
Eric Anholt
32f4940883 [965] Fix inversion of SLT/SGE results in vertex programs.
The WM code had this right, so copy its behavior.  This reverts a flipping
of the arguments to SLT in brw_vs_tnl which came in with the GLSL code that
probably occurred to work around the flipped results, and brings the code back
in line with t_vp_build.c.
(cherry picked from commit 9bae03a583)
2008-06-10 13:44:54 +08:00
Eric Anholt
a7969a9b93 [965] Fix and enable separate stencil.
Note that this does not enable GL_EXT_stencil_two_side, because Mesa's computed
_TestTwoSide ends up respecting only STENCIL_TEST_TWO_SIDE_EXT (defaults to
GL_FALSE), even if the application uses only GL 2.0 / ATI entrypoints.
(cherry picked from commit 9136e1f2c8)
2008-06-10 13:30:25 +08:00
Eric Anholt
ad88130df5 [965] Replace our own depth constants in intel context with GL context ones. 2008-06-10 13:08:09 +08:00
Eric Anholt
d1e71bc08b [965] Remove dead code in upload_wm_surfaces.
(cherry picked from commit 3ecdae82d7)
2008-06-10 11:19:53 +08:00
Roland Scheidegger
fa58fe247c i965: fix OPCODE_TEX when additional ops are needed 2008-06-08 14:04:39 +02:00
Brian Paul
4b71478326 Set the attribute as used.
Cherry-picked from gallium-0.1
2008-06-04 14:42:55 -06:00
Zou Nan hai
0989471fdb [i915] GL_DEPTH_TEXTURE_MODE fix
Cherry picked from commit 7233eabaf0
with manual changes.
2008-06-04 15:57:37 +08:00
Xiang, Haihao
696140bd1d i965: handle source depth to render target for glsl,
(cherry picked from commit d2540e6d4b)
2008-06-04 11:54:25 +08:00
Brian
380d15b7fe replace // comment with /* */ (bug 14916)
(cherry picked from commit eecb3ab7c6)
2008-06-04 11:52:38 +08:00
Xiang, Haihao
41261d64b2 i965: use _Current pointer instead of Current pointer.
Cherry picked from commit de1e9880f8
2008-06-04 11:51:19 +08:00
Zou Nan hai
ce7a9efb09 [i965] Add support for GL shading language in I965 driver.
Cherry picked from commit 6ef27b88e6,
d0ebdca4fa.
2008-06-04 11:47:08 +08:00
Zou Nan hai
8a38ebe328 [i965] This is to fix random crash in some maps of Ut2004 demo.
e.g. bridge of fate.
 	If vs output is big, driver may fall back to use 8 urb entries for vs,
	unfortunally, for some unknown reason, if vs is working at 4x2 mode,
	8 entries is not enough, may lead to gpu hang.

Cherry picked from commmit c9c64a100d
2008-06-03 11:30:41 +08:00
Zou Nan hai
dcc6671b85 [i915] don't use 4x4 filter for 1D shadowmap
Cherry picked from commit d24a5254c2
2008-06-03 11:23:44 +08:00
Zou Nan hai
b53b7581e4 [i965] fix fd.o bug #11471 and #11478
1. Follow EXT_texture_rectangle with YCbCr texture
	2. swap UV component for MESA_FORMAT_YCBCR

Cherry picked from commit 7676980d38.
2008-06-03 11:04:10 +08:00
Zou Nan hai
64a4a03c2a EXT_texture_sRGB support on i965
Cherry picked from commit 6bf81a5edf,
246d1d2522.
2008-06-03 10:09:33 +08:00
Brian Paul
b878c3f518 i915tex: fix fragment fog swizzle (from master) (bug 16195) 2008-06-02 09:29:22 -06:00
Brian Paul
6164163ca8 glDrawElement + VBO bug fix 2008-06-02 09:28:31 -06:00
Zou Nan hai
e92a53cd92 [i965] flip point sprite
Cherry picked from commit 1202c434d9
2008-06-02 17:05:57 +08:00
Zou Nan hai
2467af98b1 ARB sprite point support on i965
Cherry picked from commmit 60179434d1,
505453a04e with manual changes.
2008-06-02 17:01:31 +08:00
Xiang, Haihao
6f851d8875 _generic_read_RGBA_span_BGRA8888_REV_SSE2: It should adjust the source
and target pointers after do the first 2 pixels. fix bug #15850

Cherry-picked from commit 4b7d301c94
2008-06-02 14:28:42 +08:00
Xiang, Haihao
9b99bf89c4 i965: depth offset on glPolygonMode(GL_LINE/GL_POINT)
Cherry picked from 184cf464f4
2008-06-02 14:20:23 +08:00
Xiang, Haihao
7346fca083 965: use RGB565 to render a bitmap if Depth is 16
Cherry-picked from commit 5982d39799.
2008-06-02 14:15:24 +08:00
Xiang, Haihao
7facbb69c6 i965: don't swizzle fogcoord if FogOption is FOG_NONE.
fix #10788 issue on 965.

Cherry picked from commit 83068115e2
2008-06-02 14:08:26 +08:00
Xiang, Haihao
f59267d650 i915: set fogcoord to (f,0,0,1). fix #10788 issue on 915.
Cherry picked from commit 7eef52e975
2008-06-02 14:06:14 +08:00
Xiang, Haihao
71cb014195 mesa: fix a bad cast in put_values_z24.
The values passed to put_values_z24 are GLuint,
not GLubyte. fix #13543

Cherry picked from commit cf46aee14a
2008-06-02 13:59:51 +08:00
Xiang, Haihao
6c0f8db9c2 i965: The jump instruction count is added
to IP pre-increment, and should point to
the first instruction after the do instruction
of the do-while block of code

Cherry picked from commit 46e03d584a
2008-06-02 13:54:45 +08:00
Xiang, Haihao
49f1e2fc4c i965: fix an error in brw_vs_tnl.c
Update the tnl program if the state of TEXMAT is changed.
2008-06-02 13:46:31 +08:00
Eric Anholt
2d26e19535 [965] Clarify a bit of index buffer upload code.
Cherry picked from commit 5a49e84fcd
2008-06-02 13:18:00 +08:00
Xiang, Haihao
5b0c6cd49a i965: align the address of the first element within
the index buffer. (fix#11910)

Cherry picked from ea07a0df9a
2008-06-02 13:16:53 +08:00
Xiang, Haihao
c3ee8e46cc i965: fix projtex_mask
projtex_mask is only an 8bit field, and wm.input_size_masks includes
other attributes' information, therefore right shift is needed.

Cherry picked from 88451b04e9
2008-06-02 13:01:11 +08:00
Xiang, Haihao
46aac24261 i965: fix bad casts in do_blit_bitmap to support WindowPos correctly
Cherry picked from commit e66757c8ba
2008-06-02 11:54:35 +08:00
Xiang, Haihao
e1032ce718 i965: fix DEPTH_TEXTURE_MODE
Cherry picked from commit 6e620162a1 with
manual changes
2008-06-02 11:52:36 +08:00
Brian Paul
ce636f36f2 Fix segfault in _save_OBE_DrawElements() when using VBO and display list (bug 16156)
This was previously fixed in master by commit 982dcb74fd by Haihao Xiang.
2008-05-30 08:46:51 -06:00
Xiang, Haihao
93f2eec6b3 i965: roland's DXTn format texture patch(bug10347)
Cherry picked from commit db928291dc
2008-05-29 15:50:06 +08:00
Eric Anholt
46ef09d787 [965] Replace various alignment code with a shared ALIGN() macro.
In the process, fix some alignment issues:
- Scratch space allocation was aligned into units of 1KB, while the allocation
  wanted units of bytes, so we never allocated enough space for scratch.
- GRF register count was programmed as ALIGN(val - 1, 16) / 16 instead of
  ALIGN(val, 16) / 16 - 1, which overcounted for val != 16n+1.

Cherry picked from commit 77e0523fb7
2008-05-29 15:48:47 +08:00
Xiang, Haihao
7487ec0ff0 i965: align width/height for volume texture
Cherry picked from commit 00b86ecf6f
2008-05-29 15:45:12 +08:00
Xiang, Haihao
a25549866f intel: applying right alignment to compressed texture,
which make small textures(4x4,2x2,1x1) work well.

Cherry picked from commit 8ea66fa2ec
2008-05-29 15:43:31 +08:00
Xiang, Haihao
558cc6e38f i965: set mt->cpp differently with compressed texture
Cherry picked from commit 2cafd749b8
2008-05-29 15:40:44 +08:00
Xiang, Haihao
feb1fa1e83 i965: use BRW_TEXCOORDMODE_CLAMP instead of BRW_TEXCOORDMODE_CLAMP_BORDER
to implement GL_CLAMP

Cherry picked from commit ab99960858. fix #16005
2008-05-28 16:29:17 +08:00
Brian Paul
f32462343d allow GLX_SAMPLES_ARB==0 (bug 16073) 2008-05-27 09:49:44 -06:00
Brian Paul
08ef1b379a added sampler types to sizeof_glsl_type() 2008-05-27 08:50:15 -06:00
Karl Schultz
1e79831b56 dependency fixes (bug 13544) 2008-05-27 08:50:14 -06:00
Tormod Volden
7a29164f70 dri: vblank_mode warning
From what I can see the environment variables LIBGL_THROTTLE_REFRESH
and LIBGL_SYNC_REFRESH were taken out like 3 years ago, but this
warning was never updated.
2008-05-24 18:34:27 +02:00
Brian Paul
f2533e787e AA tri and glMaterial fixes 2008-05-16 15:35:19 -06:00
Brian Paul
b2ccd5c1ae fix memory access error in vbo_bind_vertex_list
Picked from master (commit 8fc1a6808d)
2008-05-16 15:35:19 -06:00
Brian Paul
6f63543dd7 fix an attr/src mix-up when setting-up/binding vertex arrays
This fixes problems with incorrect material coefficients when glMaterial
is called per-vertex.
2008-05-16 15:35:19 -06:00
Brian Paul
c966f1629b fix segfault in AA triangle code when using certain shaders 2008-05-16 15:35:19 -06:00
Xiang, Haihao
709f24adbb intel: Set right cliprects for the current draw region. fix #15057 2008-05-14 15:01:44 +08:00
Brian Paul
52fe7ea3d1 mesa: free shader program data before deleting shader objects.
Picked from master.
Fixes mem corruption seen when glean/api2 test exits.
2008-05-07 16:10:32 +01:00
Xiang, Haihao
44f6a6f9c4 i915: Add E7221 variant to i915.
Cherry picked from commit 39bcbe0921
2008-05-07 14:09:28 +08:00
Brian Paul
ac88b3dd16 Add support for GL_REPLACE_EXT texture env mode.
GL_REPLACE_EXT comes from the ancient GL_EXT_texture extension.  Found an old demo that
actually uses it.
The values of the GL_REPLACE and GL_REPLACE_EXT tokens is different, unfortunately.
2008-04-30 16:08:28 -06:00
Brian Paul
27b6fa5615 mesa: adjust glBitmap coords by a small epsilon
Fixes problem with bitmaps jumping around by one pixel depending on window
size.  The rasterpos is often X.9999 instead of X+1.
Run progs/redbook/drawf and resize window to check.

Cherry picked from gallium-0.1 branch
2008-04-29 18:38:26 -06:00
Brian Paul
68eb76dfb7 Enabled GL_EXT_multi_draw_arrays extension in R200/R300 drivers 2008-04-29 18:38:26 -06:00
Ove Kaaven
392760ee0c r200: fix state submission issue causing bogus textures (bug 15730) 2008-04-29 22:11:23 +02:00
Michel Dänzer
063b60a51f Change default of driconf "allow_large_textures" to announce hardware limits.
The previous default these days served mostly to cause artifical problems with
GLX compositing managers like compiz (see e.g.
http://bugs.freedesktop.org/show_bug.cgi?id=10501).

(cherry picked from commit acba9c1771)
2008-04-29 19:03:44 +02:00
Brian Paul
7b676192e9 enable GL_EXT_multi_draw_arrays (see bug 15670) 2008-04-24 16:31:28 -06:00
Brian Paul
138e0010eb added FreeBSD static config 2008-04-23 08:23:18 -06:00
Anatolij Shkodin
36bad2b478 added freebsd-static 2008-04-23 08:23:18 -06:00
Alan Hourihane
f6d6fc603e revert 2008-04-22 23:08:35 +01:00
Alan Hourihane
5545b46571 small cleanups 2008-04-22 20:29:42 +01:00
Alan Hourihane
06b0a7acce correct the return value 2008-04-22 20:29:00 +01:00
Alan Hourihane
534f30064d Fix error string 2008-04-22 20:28:35 +01:00
Brian Paul
6c9e1b2337 fix GL_ARB_texture_rectangle breakage 2008-04-14 13:44:05 -06:00
Brian Paul
62c67576e0 fixed WIN32 compile problem in libGLU 2008-04-14 13:41:17 -06:00
Brian Paul
91d59e4cb9 check for _WIN32 and __WIN32__ 2008-04-14 13:40:39 -06:00
Brian Paul
8de268bb3c add -Wl case (part of prev DragonFly patch) 2008-04-14 12:58:51 -06:00
Brian Paul
4fd7f6047c define #extension GL_ARB_texture_rectangle 2008-04-14 12:58:51 -06:00
David Flynn
ff3033e190 define #extension GL_ARB_texture_rectangle 2008-04-14 12:58:51 -06:00
Roland Scheidegger
18404076e3 r200: fix XPD vertex program instruction when using temps as inputs
due to the two read ports limit into temp memory may need the MAD_2 instruction
for the second instruction of the decomposed XPD.
While here, also try to avoid MAD_2 for MAD if all 3 inputs are temps but the
temps aren't actually distinct.
2008-04-12 02:40:44 +02:00
Brice Goglin
59c9c40c01 Prepare changelog for upload 2008-04-11 08:42:55 +02:00
Brice Goglin
666e0635da New upstream release 2008-04-11 08:41:32 +02:00
Brice Goglin
f9968a0346 Merge tag 'mesa_7_0_3' into debian-unstable 2008-04-11 08:38:26 +02:00
Hasso Tepper
39dca05d1d New dragonfly configs
A re-do commit, this time with the intended commit message.
2008-04-09 19:05:59 -06:00
Brian Paul
f51b76b670 Revert "Hasso Tepper <hasso@estpak.ee>"
This reverts commit 40ee989db5.
2008-04-09 19:04:36 -06:00
Brian Paul
40ee989db5 Hasso Tepper <hasso@estpak.ee> 2008-04-09 19:02:41 -06:00
Brian Paul
ef76dfc7a0 add link to 7.0.4 relnotes 2008-04-09 19:01:07 -06:00
Brian Paul
02ddc08353 initial 7.0.4 relnotes 2008-04-09 19:00:53 -06:00
Hasso Tepper
4b24d5261a patches for DragonFly OS 2008-04-09 18:59:19 -06:00
Brian
4b96a39c48 added MD5 sums for 7.0.3 2008-04-04 19:24:32 -06:00
Brian
48616e71d2 final prep/changes for 7.0.3 release 2008-04-04 19:06:30 -06:00
Brian
70d227ac62 7.0.3 release candidate 3 2008-04-01 18:04:13 -06:00
Eric Anholt
7f2c4f96f5 Bug #13492: Only call ProgramStringNotify if program parsing succeeded.
Wine intentionally tries some out-of-spec programs to test strictness, and
calling ProgramStringNotify on the results of a failed program parse resulted
in crashes in the 965 driver.
(cherry picked from commit 185320ae13)
2008-04-01 16:27:48 -07:00
Roland Scheidegger
667f0f60fc fix mistakenly set ATIFragmentShader._Enabled bit (bug 15269) 2008-04-01 23:25:04 +02:00
Brian
7592b8cc10 added some missing calls to _mesa_enable_x_y_extensions() 2008-04-01 08:41:24 -06:00
Brian
f55b831859 fix ARB f/v program comment parsing bug 2008-03-31 15:00:18 -06:00
Markus Amsler
217f7f7e5d fix parsing bug involving comments at the end of ARB v/f programs 2008-03-31 15:00:18 -06:00
Julien Cristau
2e5a63f365 Prepare changelog for upload 2008-03-31 16:47:34 +02:00
Julien Cristau
7c614b4666 Fix libgl1-mesa-swx11-i686's dependencies
Change libgl1-mesa-swx11-i686's pre-dependency on libgl1-mesa-swx11 to a
regular versioned dependency, and add ${shlibs:Depends}.
I'm not sure why this used Pre-Depends in the first place, I don't think
that's needed.
2008-03-31 16:47:17 +02:00
Julien Cristau
b23d908829 Update 02_use-ieee-fp-on-s390-and-m68k.patch. 2008-03-31 13:17:24 +02:00
Julien Cristau
5379b84e63 Update changelog and add bug closer 2008-03-31 13:11:59 +02:00
Julien Cristau
32c913308e Merge branch 'mesa_7_0_branch' of git.freedesktop.org:/git/mesa/mesa into debian-unstable 2008-03-31 13:00:20 +02:00
Xiang, Haihao
1e83d70b6d i965: Apply -ve rhw to 965. Fix the regression introduced by
commit da476ff02d. (bug#14940)
2008-03-31 09:37:55 +08:00
Brian
767dfa5b9c fix texture/renderbuffer mix-up in test_attachment_completeness() 2008-03-28 13:25:25 -06:00
Alan Hourihane
7ff5b38126 Fix build problems 2008-03-27 16:36:12 +00:00
Brian
e209f5300d updated glext.h to version 40 2008-03-25 08:11:47 -06:00
Brian
3c4b50c352 updated to version 40 2008-03-25 08:11:36 -06:00
Brian
4e7c2fcf18 add GL_READ_FRAMEBUFFER_BINDING_EXT case, regenerate get.c file 2008-03-24 19:55:46 -06:00
Brian
22534f94f5 fix wrong values for GL_READ/DRAW_FRAMEBUFFER_BINDING_EXT tokens 2008-03-24 19:55:04 -06:00
Brian
1a6928fdbe use ctx->Driver.DeleteProgram() in a few more places 2008-03-22 10:27:08 -06:00
Brian
325dbbac47 delete default programs with ctx->Driver.DeleteProgram() 2008-03-22 09:11:35 -06:00
Brian
39ac6b0481 Fix some PBO breakage.
In _mesa_Bitmap, can't early return if bitmap ptr is NULL, it may be an offset
into a PBO.  Similarly for _mesa_GetTexImage.
2008-03-21 12:32:29 -06:00
Brian
46cc4854e9 fix IEEE_ONE definition for ICC compiler (bug 15134) 2008-03-19 17:25:18 -06:00
Alan Hourihane
f93882512e set outputs_safe to 0 as it's possible for the code generation
to slip over the allocated memory for the vb.

pull in sse fixes from gallium-0.1
2008-03-19 01:03:48 +00:00
Markus Amsler
0dee2a4f6f only set InputsRead bit if input is really used 2008-03-17 08:35:34 -06:00
Brian
3cebc35669 init tmpNode to zeros 2008-03-14 14:16:00 -06:00
Brian Paul
e75a204fb9 mesa: fix emit_clamp() so that we don't use an output register as temporary
IR_CLAMP is decomposed into OPCODE_MIN+OPCODE_MAX.  Allocate a temporary
register for the intermediate value so we don't inadvertantly use an output
register (which are write-only on some GPUs).
2008-03-14 13:57:53 -06:00
Roland Scheidegger
ac06a5c16a fix state.lightprod ambient/specular w value (bug #14983) 2008-03-13 12:43:53 +01:00
Dan Nicholson
ed758fee0c Merge branch '7.0-glx' into mesa_7_0_branch 2008-03-10 16:45:49 -07:00
Jeremy Huddleston
a21c61ee8b Darwin: Fixed small error in darwin config files 2008-03-10 16:02:55 -07:00
Dan Nicholson
24697da20e glapi: Resync generated files with 7.0 branch
The previous commits pulled in the generated files from master. This
regenerates the files from the source on the 7.0 branch.
2008-03-10 15:17:59 -07:00
Jeremy Huddleston
7120c0089d Darwin: Config/source fixes to now build glxdemo apps and OSMesa
Also added darwin-fat-32bit darwin-fat-all configs and deleted old darwin-x86ppc config
2008-03-10 15:13:44 -07:00
Dan Nicholson
88a436a8f7 glapi: Generate xserver glapi sources in the mesa tree
Instead of generating the glapi sources for the xserver and commiting
them to the xserver tree, we can keep them in the mesa tree and change
the xserver build to use the files from the mesa tree.

This makes the xserver glx build more robust as it reduces the chances
for mismatches of the glX API used in the xserver vs. in mesa.
(cherry picked from commit 7688791fc5)
2008-03-10 15:03:13 -07:00
Dan Nicholson
2fdb5a245d glapi: Correct prerequisites for gl_and_glX_API.xml
The indirect_dispatch.h and indirect_table.c source files use
gl_and_glX_API.xml in their generation rather than glX_API.xml, but it
wasn't listed in their prerequisites. In turn, gl_and_glX_API.xml uses
glX_API.xml, but this is already listed in $(COMMON_GLX).
(cherry picked from commit 929b6d2ebf)
2008-03-10 15:03:01 -07:00
Dan Nicholson
8441b53538 glapi: Use make automatic variables to clean up the commands
Make use of the make automatic variables $@ (the target) and $< (first
prerequisite) to clean up the commands for the glapi generation. This
improves readability and guards against typos since words are repeated
less frequently.
(cherry picked from commit fc67d47708)
2008-03-10 15:02:51 -07:00
Dan Nicholson
d336df8b73 glapi: Use variable for indent and flags
Put the path to indent and the flags to call it with in configs/default
rather than in the Makefile. This makes it easier to change the values
globally.
(cherry picked from commit 817af9bec2)
2008-03-10 15:02:36 -07:00
Brian
8aaf805b8a fix parsing of state.texenv.color (bug 14931) 2008-03-10 07:41:31 -06:00
Markus Amsler
8161fd2785 Set normalized flag for GLubyte arrays in _mesa_VertexAttribPointerNV() 2008-03-09 17:53:00 -06:00
Markus Amsler
2f23025dfe init vertex weight attrib to (1,0,0,0) 2008-03-09 17:51:21 -06:00
Brian
1867eac230 fix __builtin_expect() definition test for IBM XLC (sf bug 1909832) 2008-03-09 10:54:50 -06:00
Roland Scheidegger
096e35d05f state.depth.range alpha value should be 1, not 0 (bug #14733) 2008-03-01 02:57:01 +01:00
Xiang, Haihao
8998f52b97 Don't Swap buffer if a DRIDrawable is entirely obscured by another window. 2008-02-28 11:43:54 +01:00
Brian
0fd38dcc83 Replace glut_fbc.c with glut_fcb.c (cb=callback) 2008-02-25 10:57:54 -07:00
Julien Cristau
d89cf0649e Add bug closer for #408679. 2008-02-24 10:23:17 +01:00
Julien Cristau
31e9d9d4f8 Prepare changelog for upload. 2008-02-23 18:18:42 +01:00
Julien Cristau
ea9c6d3d9e 03_optional-progs-and-install.patch: partly applied upstream, fixed up 2008-02-23 16:08:53 +01:00
Brian
ff63cf8068 bump libGL.so version number 2008-02-22 07:59:39 -07:00
Julien Cristau
eaac94c35a Update changelog. 2008-02-22 12:16:27 +01:00
Julien Cristau
9291506af0 Merge branch 'mesa_7_0_branch' of git.freedesktop.org:/git/mesa/mesa into debian-unstable
Conflicts:

	src/glx/mini/Makefile
2008-02-22 12:09:35 +01:00
Brian
4716670de9 prep for 7.0.3 rc-2 2008-02-21 16:59:20 -07:00
Brian
33c5b38034 latest bug fixes 2008-02-20 09:39:59 -07:00
Brian
5737d6c565 Fix point rasterization regression caused by commit 95a2eb9767
Even-sized, non-AA points need 0.5 bias in position to hit the right pixels.
Test program from bug report 11016 retested and is OK.
2008-02-20 09:38:16 -07:00
Brian
08a7f56c6a raise GL_INVALID_OPERATION if glProgramString compilation fails
cherry picked from master.
2008-02-20 09:00:49 -07:00
Brian
7916f2b4aa Fix glBegin-time test for invalid programs/shaders.
Cherry picked from master.
2008-02-20 08:56:20 -07:00
Brian
193d303ac7 Added <size name="Get" mode="get"/> lines for point parameter tokens.
Cherry picked from master
2008-02-19 08:46:39 -07:00
Jeremy Huddleston
e70609b7b8 Apple: Pulled in changes from Apple's patchset to allow mesa to build on darwin again 2008-02-19 00:54:35 -08:00
Xiang, Haihao
da476ff02d i965: new integrated graphics chipset support 2008-02-19 15:59:50 +08:00
Brian
77e3b5d28b Fix potential glDrawPixels(GL_DEPTH_COMPONENT) crashes (bug 13915)
Also, general clean-up of the Xlib-optimized glDraw/CopyPixels code.
2008-02-16 09:56:26 -07:00
Brian
bf97ca448c Fix glBindTexture crash (bug 14514) 2008-02-15 13:42:19 -07:00
Roland Scheidegger
c5f8ff8b32 fix bug with generated fragment programs if vertex shader is active
When generating a fragment program from fixed function, checking
texUnit->_ReallyEnabled is not sufficient, need texUnit->Enabled too
since the former also represents texture enables from an active vertex
shader.
2008-02-15 17:26:58 +01:00
caner
50465766d1 miniglx doc updates 2008-02-14 09:34:08 -07:00
Xiang, Haihao
7d8df58a63 _mesa_swizzle_ubyt_image: Don't use single swizzle_copy call
if components don't match. fix #13508
2008-02-13 07:07:47 -07:00
Andy Skinner
762c074012 added -altopts to allow overriding all other opts 2008-02-07 13:19:55 -07:00
Brian
51f2ee3bfb fix bug 9871 2008-02-06 07:55:26 -07:00
Brian
b5cd34aa21 Fix bug 9871: enable user-defined clip planes for R300
Patch provided by Erkin Bahceci <erkinbah@gmail.com>
2008-02-06 07:54:24 -07:00
Tony DeFeo
ae5c6dcd42 [965] Fix memory leak when deleting buffers with backing store. 2008-02-05 10:49:44 -08:00
Roland Scheidegger
97196d0c8c regenerate glsl library functions 2008-01-31 01:36:23 +01:00
Roland Scheidegger
f6de56b88a fix w component of glsl vec4 asin 2008-01-31 01:35:52 +01:00
Brian
d64ea43b76 fix bugs 13507, 14293 2008-01-30 08:12:06 -07:00
Brian
2deaf93d24 check if fb->Delete is null (bugs 13507,14293) 2008-01-30 08:12:06 -07:00
Alex Deucher
a107ec8300 Add new RV380 pci id
bug 14289
(cherry picked from commit 80efe27560)
2008-01-29 10:15:32 -05:00
Alex Deucher
120a1f9508 Merge branch 'mesa_7_0_branch' of git+ssh://agd5f@git.freedesktop.org/git/mesa/mesa into mesa_7_0_branch 2008-01-29 09:50:26 -05:00
Alex Deucher
bb84007a57 R300: RV410 SE chips have half the pipes of regular RV410
This fixes 3D rendering on x700 SE chips.  Reported
by Kano.
(cherry picked from commit 0b7e0f8159)
2008-01-29 09:46:48 -05:00
Alan Hourihane
86234e55a6 pull some more fixes for pbo access from trunk 2008-01-28 11:23:53 +00:00
Alan Hourihane
61972077cd fix some pbo path problems 2008-01-28 11:15:53 +00:00
Xiang, Haihao
5a7feb8ea2 i965: valid message length includes message header. 2008-01-25 17:23:55 +08:00
Xiang, Haihao
4b4c131cd0 i965: re-define the type of reg.loopcount.
avoid some issues such that 1 + (-2) gets a big
positive value.
2008-01-25 17:23:15 +08:00
Julien Cristau
67617c8f89 Drop -O0 workaround on hppa.
Stop building with -O0 on hppa. Bug #451047 should be fixed in recent gcc
versions.
2008-01-24 22:52:48 +01:00
Brian
0fd23f01c6 Assorted patches for miniglx/linux-solo (Gavin Li <codeview@gmail.com>) 2008-01-23 16:04:02 -07:00
Adam Jackson
557b0d9df7 glxinfo: Fix multisample visual reporting.
strstr() == 0 tests for the string _not_ being present.  Originally
Red Hat bug #351871.
2008-01-22 14:04:39 -07:00
Brian
888f4380cf fix GLX vertex array bug 14197 2008-01-22 08:41:22 -07:00
Brian
3266c5e95a fix pc vs. gc->ps usage (bug 14197) 2008-01-22 08:38:48 -07:00
Brian
834decdaae Don't build yuvrect_client by default
Added 'extra' rule to build optional yuvrect_client, shape, xdemo programs
2008-01-22 07:56:31 -07:00
Brian
18b2d83173 remove unused var 2008-01-22 07:54:37 -07:00
Alexey Sokolov
30c65c3c62 define M_PI if needed 2008-01-22 07:42:40 -07:00
Brian
04fcc4cf1e prep for 7.0.3 release 2008-01-21 16:21:39 -07:00
Julien Cristau
09504dde1f Update changelog; add Vcs-* and Homepage fields in debian/control. 2008-01-17 22:26:48 +01:00
Julien Cristau
c04885f072 Merge branch 'mesa_7_0_branch' of git://anongit.freedesktop.org/git/mesa/mesa into debian-unstable
Conflicts:

	progs/tests/.gitignore
	progs/tests/Makefile
2008-01-14 22:30:03 +01:00
Michel Dänzer
48ae5cf09d i965: Fix byte vs. pixel unit mixup for aligned texture pitch.
I sincerely hope I don't manage to mess this up yet again...

Thanks again to Todd Merrill for pointing out the problem and testing the fix
on IRC.
2008-01-14 16:30:58 +01:00
Michel Dänzer
45cdb6eb45 i965: Fix unresolved symbol intel_miptree_pitch_align.
For some reason, I thought that function was shared with i915tex... The good
news is that i965 gets to keep the lower pitch alignment requirements.

Thanks to Todd Merrill for pointing out the problem on IRC.
2008-01-11 16:32:39 +01:00
Keith Packard
b9f3f732aa i915tex: Centralize mipmap pitch computations.
mipmap pitches must account for the device alignment requirements, which
used to be fairly simple; just align to a 4-byte boundary. However, to allow
textures to be drawn to under TTM, they now need to be aligned to a 64-byte
boundary. Placing all of the alignment constraints in a single function
allows this new constraint to be applied uniformly.

There was some pitch constraining code in intel_miptree_create, but that was
modifying the pitch long after the miptree had been layed out, so it only
served to wreck the mipmap and cause rendering errors.

(cherry picked from commit a183efc132 with manual
changes for mesa_7_0_branch by Michel Dänzer. One side effect of this is that
i965 also aligns the pitch of 2D textures to multiples of 64 bytes, hopefully
that won't cause any issues)
2008-01-08 16:48:13 +01:00
Brian
17006ddd6b fix 3d proxy texture depth bug 2008-01-05 15:44:51 -07:00
Brian
b77a354df3 fix depth/1 typo in glTexImage3D proxy code 2008-01-05 15:44:51 -07:00
Brian
71d46beebf additional stub functions 2008-01-02 07:23:41 -07:00
Brian
454e296eb1 additional GL_COLOR_ATTACHMENTx_EXT cases (bug 13767) 2008-01-02 07:20:08 -07:00
Brian
f9b696be2b fix vbo display list memleak upon context destruction 2008-01-01 10:23:56 -07:00
Brian
c923edbc71 additional GL_COLOR_ATTACHMENTx_EXT cases (bug 13767) 2008-01-01 10:10:18 -07:00
Brian
e20c1d987f fix GLSL uniform/attrib bugs (13753) 2008-01-01 09:59:51 -07:00
Bruce Merry
cd354eb10f Convert to 0/1 when setting boolean uniforms
Also add some extra tests to the shader_api regression tests
2008-01-01 09:59:51 -07:00
Bruce Merry
e9ac27ee23 Make use of count in _mesa_uniform_matrix 2008-01-01 09:59:50 -07:00
Bruce Merry
3f9dc9f5b6 Add a test program to test for assorted bugs in shader_api.c 2008-01-01 09:59:50 -07:00
Bruce Merry
ba709875ae More fixes to shader_api
- return GL_INVALID_OPERATION instead of GL_INVALID_VALUE if location is bad
- correct the type-checking of uniforms from my previous commit
- accept location of -1 in _mesa_uniform_matrix
2008-01-01 09:59:50 -07:00
Bruce Merry
80f8397b35 Fix several bugs relating to uniforms and attributes in GLSL API
- fix sizes for GL_FLOAT_MAT2x3 and GL_FLOAT_MAT4x3 in sizeof_glsl_type
- fix size returns in _mesa_get_active_attrib
- fix out-of-bounds array access to vec_types in _mesa_get_active_attrib
- fix queries of matrix uniforms in _mesa_get_uniformfv
- fix _mesa_get_uniformfv to only return one base, even from an array
- allow location == -1 in _mesa_uniform
- validate types in _mesa_uniform
- allow array overruns in _mesa_uniform
2008-01-01 09:59:50 -07:00
Brian
b45fa27fa1 added 'get' info for framebuffer object tokens 2008-01-01 09:26:30 -07:00
Brian
b59480645d add 'Get' info for MAX_3D_TEXTURE_SIZE (for bug 13811) 2008-01-01 09:04:13 -07:00
Brian
148cb36979 add missing double quote (bug 13878) 2008-01-01 07:59:58 -07:00
Roland Scheidegger
c1eb78f7ff fix GL_LINE_LOOP with drivers using own render pipeline stage (#12410, #13527)
primitive needs to include the begin/end flags (broken since vbo-0.2). Should
fix missing first/last line segment on gamma, i810, i915, mga, r200, radeon,
s3v, savage, unichrome (r300 already correct). Tested on r200, fixes #13527.
2007-12-22 18:49:42 +01:00
Brian
8aa0fd6b20 glGetActiveUniform fix 2007-12-20 09:08:12 -07:00
Brian
a1b3a908f5 return correct size from glGetActiveUniform (bug 13751) 2007-12-20 09:08:12 -07:00
Xiang, Haihao
f9e70d951a i965: allocate GRF registers before building subroutines,
it ensures there are sufficient registers for all subroutines.
2007-12-19 10:44:00 +08:00
Xiang, Haihao
41ed6be1da i965: restore the flag after building the subroutine of the
GS thread. fix #13240
2007-12-19 10:36:56 +08:00
Brian
27de28fc3e Remove -I$(TOP)/src/mesa/transform 2007-12-18 17:07:11 -07:00
Brian
dd2f01c229 simplify update two-side lighting test (follow-on to previous front/back-face changes) 2007-12-18 16:28:36 -07:00
Brian
deb5c56c77 fix NEED_SECONDARY_COLOR for vert/frag progs 2007-12-18 16:28:36 -07:00
Julien Cristau
9fd22f0e3f Prepare changelog for upload. 2007-12-18 19:13:27 +01:00
Julien Cristau
942372dcdf debian/control fixups
* Bump Standards-Version to 3.7.3.
* Move libgl1-mesa-swx11-dbg, mesa-common-dev and libosmesa6-dev to section
  libdevel.
* libgl1-mesa-swx11 conflicts with libgl1-mesa-glx.  Move it and
  libgl1-mesa-swx11-dev to priority extra.
* Fix typo in mesa-common-dev's long description.
2007-12-18 13:57:06 +01:00
Julien Cristau
b7f901088b Update changelog. 2007-12-18 13:32:01 +01:00
Julien Cristau
c02990525c Merge branch 'mesa_7_0_branch' of git.freedesktop.org:/git/mesa/mesa into debian-unstable
Conflicts:

	progs/trivial/quad-clip-nearplane.c
2007-12-18 12:28:29 +01:00
Michel Dänzer
0107acded0 i915tex: Fix issues with glDrawBuffer(GL_NONE).
Don't dereference NULL renderbuffer pointer, and make sure the software
fallback sticks.

Fixes https://bugs.freedesktop.org/show_bug.cgi?id=13694 .
2007-12-17 12:32:26 +01:00
Brian
2ac5e08d1d fix polygon cull regression 2007-12-14 14:36:23 -07:00
Dan Nicholson
1837b8c214 configs: Fix linking with static libGL and --as-needed
Linking of the programs breaks when using a static libGL and the GNU ld
option --as-needed. This is because libXext is needed for the XShm
functions.
(cherry picked from commit 6aaf9bdd41)
2007-12-07 11:51:18 -08:00
Brian
03d2bc1774 fix gl_FrontFacing 2007-12-04 14:07:15 -07:00
Brian
385bddbde0 fix span->facing computation and gl_FrontFacing initialization 2007-12-04 14:07:15 -07:00
Brian
c135426267 Fix gl_FrontFacing compilation problem 2007-12-04 14:07:15 -07:00
Michel Dänzer
4be0c98120 Use -Bsymbolic for linking all shared objects.
Fixes https://bugs.freedesktop.org/show_bug.cgi?id=10132 .

Also remove comment about SONAME, as SONAME only applies to shared libraries.
(cherry picked from commit fc7ddea853)
2007-12-04 18:33:07 +01:00
Brian
e760aebd5a fix two-side lighting bug/crash 2007-12-03 14:13:08 -07:00
Brian
1f6e7d9c29 fix DD_TRI_LIGHT_TWOSIDE bug (#13368) 2007-12-03 14:12:34 -07:00
Dan Nicholson
c6d421af05 Fix the library name in glw.pc
Fix a copy and paste error s/GLU/GLw/ in glw.pc.
(cherry picked from commit 2dc85e8078)
2007-12-03 12:08:03 -08:00
Brian
952df5e493 fix two-sided stencil 2007-12-03 12:00:21 -07:00
Brian
45acb8b058 added missing quote char 2007-12-03 12:00:21 -07:00
Michel Dänzer
e8997c0183 i915tex: Fix up state changes for i8xx.
(cherry picked from commit 2af613e0b8)
2007-12-03 09:38:13 +01:00
Brian
169e62f563 fix-build: remove ctx->_Facing assignment 2007-11-30 15:52:41 -07:00
Brian
1b43babfb1 fix broken two-sided stencil 2007-11-30 13:01:42 -07:00
Brian
43e902f774 better front-plane clip test 2007-11-30 09:09:12 -07:00
Xiang, Haihao
b0a800e249 i965: use uncompressed instruction to ensure only
Pixel Mask Copy is modified as the pixel shader thread
turns off pixels based on kill instructions.
2007-11-30 12:36:07 +08:00
Brian
73d5f232ad New ctx->Driver.Map/UnmapTexture() functions for accessing textures from t_vb_program.c 2007-11-29 08:18:11 -07:00
Brian
f7209541e4 cleanups, comments
Conflicts:

	src/mesa/tnl/t_vb_program.c
2007-11-29 08:18:11 -07:00
Brian
397a32dca7 Move _mesa_load_tracked_matrices() from TNL module to prog_statevars.c 2007-11-29 08:18:11 -07:00
Roland Scheidegger
e0719d7122 make sure state token values are fully initialized 2007-11-29 03:08:48 +01:00
Michel Dänzer
3f18c0a9f2 r200: Fix texture format regression on big endian systems.
See https://bugs.freedesktop.org/show_bug.cgi?id=13324 .

Also use tx_table_be for VALID_FORMAT, in case r200SetTexImages ever gets
called for MESA_FORMAT_RGB888.
(cherry picked from commit dc88a96631)
2007-11-28 10:25:01 +01:00
Delle
b14be61938 use DEFAULT_SOFTWARE_DEPTH_BITS 2007-11-27 18:18:48 -07:00
Brian
440d620308 minor additions to avoid FAQs 2007-11-27 10:32:39 -07:00
Brian
8dd9df0f3e document GLSL float f/F suffix bug 2007-11-27 10:32:39 -07:00
Brian
6b9534eaf5 set fp->UsesKill when emitting OPCODE_KIL 2007-11-27 10:32:39 -07:00
Brian
c91d374ad7 improve 24-bit Z to 32-bit Z conversion 2007-11-27 10:32:39 -07:00
Keith Whitwell
1cab4160bc i915tex: Fix some minor batchbuffer errors. 2007-11-26 17:12:15 +01:00
Keith Whitwell
718d2dfbbd i915tex: Catch cases where not all state is emitted for a new batchbuffer.
This could lead to incorrect rendering or even lockups.
2007-11-26 17:10:26 +01:00
Michel Dänzer
0967e1270d i915tex: Some additional blit fixes and assertions. 2007-11-26 16:59:41 +01:00
Michel Dänzer
a08c02f1a8 i915tex: Actually wait for previous commands to complete for glFinish(). 2007-11-26 16:59:00 +01:00
Brian
bdfd9afead Consolidate texture fetch code and use partial derivatives when possible. 2007-11-23 12:01:39 -07:00
Brian
1c91a590d6 fix a few GLSL bugs 2007-11-23 10:28:33 -07:00
Brian
65bd7968bf Fix parsing of gl_FrontLightModelProduct.sceneColor, don't segfault on variable
array indexes.
2007-11-23 10:26:02 -07:00
Brian
6ccd23b87b need to check border width in sample_linear_2d() - fixes failed assertion in texwrap.c test 2007-11-23 09:14:27 -07:00
Brian
823409b7d0 Bump version numbers to 7.0.3 for next release 2007-11-22 09:36:35 -07:00
Brian
c85d31f4a0 Recompute ctx->Point._Size if GL_POINT_SIZE_MIN/MAX changes.
Note that all the point size clamping stuff has been redone in Mesa/master.
2007-11-22 09:36:35 -07:00
Roland Scheidegger
24af5c44da fix z buffer read/write issue with rv100-like chips and old ddx 2007-11-22 02:55:25 +01:00
Brian
75efacf8eb Initial 7.0.3 relnotes 2007-11-20 08:16:25 -07:00
Brian
825e810247 bring over Fortran fixes from master 2007-11-20 08:15:19 -07:00
Brian
e20723cfc1 Obsolete 2007-11-20 08:13:14 -07:00
Brian
9f39a67c1d Rename glut_fbc.c -> glut_fcb.c (cb=callback) 2007-11-20 08:13:03 -07:00
Brian
2044f3f791 clamp lambda to Min/MaxLod 2007-11-19 13:05:10 -07:00
Brian
30d4e8c422 fix some texture format assertions, etc 2007-11-19 10:37:41 -07:00
Brian
92d552f6a2 fix out-of-bounds array index (ix=-1) 2007-11-19 09:54:41 -07:00
Brian
5adfcbbc4f added gl_dispatch_stub_772() 2007-11-16 10:03:57 -07:00
Roland Scheidegger
69969b3819 fix position invariant vertex programs for sw-tnl
do the same math as for fixed function pipe, including
user clip planes.
(mostly resurrected from the dead t_vb_arbprogram.c code)
2007-11-15 02:06:15 +01:00
Roland Scheidegger
edfee04fcb fix bogus assumption if ddx has set up surface reg for z buffer
this is wrong since even if ddx has not set up a surface reg to cover the z
buffer we should pretend it has on those rv100 chips since they presumably do
not do z buffer tiling if not using hyperz, so we can use linear addressing
just the same. Doesn't seem to fix #13080, but it's wrong anyway and the bug
almost certainly broke newer non-tcl chips.
2007-11-15 01:16:27 +01:00
Brice Goglin
ae0bf74db9 Prepare changelog for upload 2007-11-13 21:44:00 +01:00
Julien Cristau
1bf7ce97c0 * Add build-dep on libxext-dev. Thanks, Timo Aaltonen! 2007-11-13 21:40:49 +01:00
Julien Cristau
4971a009e0 * Workaround gcc ICE on hppa: build libOSMesa with -O0 (see bug#451047). 2007-11-13 20:59:08 +01:00
Julien Cristau
e1613ab80d Don't set -fno-strict-aliasing in configs/debian-default.
Upstream uses that since 7.0.2.
2007-11-13 20:57:58 +01:00
Brian
28c9930888 add pointer to Gallium3D info 2007-11-13 09:51:14 -07:00
Brian
e3a35a123e DRI memory manager info (fixes dangling link) 2007-11-13 09:50:42 -07:00
Brian
412168f2e8 remove dependency on libGLU 2007-11-12 08:21:21 -07:00
Brian
fc0fa0d636 add glw.pc.in to tarball list, remove from DEPEND_FILES 2007-11-12 07:52:20 -07:00
Brice Goglin
caf283329b Prepare changelog for upload 2007-11-11 11:55:05 +01:00
Brice Goglin
5cedd4a43e Remove DESTDIR from INSTALL_DIR in configs/debian-default
... and update 03_optional-progs-and-install.patch accordingly.
2007-11-11 11:49:16 +01:00
Brice Goglin
0595d32d8a Refresh 03_optional-progs-and-install.patch
The default Makefile requires libGLU to be built
while linking progs/xdemos. However, we don't build
libGLU and progs/xdemos at the same time, and
these progs don't actually need libGLU.
2007-11-11 11:48:32 +01:00
Brice Goglin
e339b4e8da New upstream release 2007-11-11 00:34:46 +01:00
Brice Goglin
11c827c588 Merge tag 'mesa_7_0_2' into debian-unstable
Conflicts:

	.gitignore
	progs/demos/.gitignore
	progs/directfb/Makefile
	progs/egl/Makefile
	progs/fbdev/Makefile
	progs/fp/Makefile
	progs/miniglx/Makefile
	progs/samples/.gitignore
	progs/slang/Makefile
	progs/tests/.gitignore
	progs/tests/Makefile
	progs/tools/trace/Makefile
	progs/trivial/Makefile
	progs/vp/Makefile
	progs/xdemos/.gitignore
	src/egl/drivers/demo/Makefile
	src/egl/drivers/dri/Makefile
	src/egl/main/Makefile
	src/glu/mesa/Makefile
	src/glut/directfb/Makefile
	src/glx/mini/Makefile
2007-11-11 00:24:52 +01:00
Brian
8a40b670c3 added md5 checksums 2007-11-10 09:53:00 -07:00
Brian
d9fa5cbfc9 final changes for 7.0.2 relesae 2007-11-10 09:41:52 -07:00
Benno Schulenberg
1c21564292 code clean-ups, reformatting 2007-11-09 08:53:41 -07:00
Benno Schulenberg
6cc96bf156 remove commented-out code 2007-11-09 08:53:15 -07:00
Brian
29afd4bbc4 fix blender/unichrome crash, bug 13142 2007-11-08 07:36:30 -07:00
Benno Schulenberg
4e3db063ec fix Unichrome/Blender crash, bug 13142 2007-11-08 07:36:30 -07:00
Brian
6560744c38 added -fno-strict-aliasing and -fPIC flags 2007-11-08 07:36:30 -07:00
Brian
572ad87881 change filenames for rc2 2007-11-08 07:36:30 -07:00
Michel Dänzer
2ab75d6cfa r200: Fix SetTexOffset format for 16 bit pixmaps/textures.
Use symbolic array indices to clarify.
2007-11-06 18:39:50 +01:00
Chris Rankin
041a8eb5ec r200: Implement SetTexOffset hook.
Implementation guidance by Michel Dänzer, final testing by Timo Aaltonen.
2007-11-06 18:32:33 +01:00
Brian
c1c13bdcfa Check for NULL VB->EdgeFlag array.
There might be a bug elsewhere, but this is a simple work-around for now.
See bug 12614
2007-11-05 14:43:03 -07:00
Brian
403edd34dd fix mmx code (bug 12614) 2007-11-05 14:38:12 -07:00
Brian
f279e48416 fix mmx code (bug 12614) 2007-11-05 14:38:05 -07:00
Brian
bf854d8d27 SSE codegen fixes 2007-11-03 08:45:42 -06:00
Brian
f334121679 Fix mem leak in SSE code generation path (Michel Dänzer) and don't crash if _mesa_exec_malloc() returns NULL. 2007-11-03 08:44:48 -06:00
Dan Nicholson
b88e2be609 Add -fno-strict-aliasing workaround for all GCC targets
Use a GCC option to work around aliasing bugs. See commit 013dbcd for
more details.
(cherry picked from commit 01b18abf93)

Conflicts:

    configs/freebsd
2007-11-01 11:07:02 -07:00
Dan Nicholson
08229c8bb8 configs: Set -fexceptions for GLUT on linux-dri like other targets
Quite a while ago, the GCC option -fexceptions was added for building
libglut. See here:

  http://article.gmane.org/gmane.comp.video.mesa3d.devel/9499

This was missing in the linux-dri targets.
(cherry picked from commit dbcd20f1c2)
2007-11-01 11:02:05 -07:00
Dan Nicholson
c984017f71 configs: Always use -fPIC for shared libraries, never for static
Mesa currently disables -fPIC for DRI on x86, but most Linux distros are
re-enabling -fPIC for all DRI arches. Let's just do that here since
that's normally what's wanted for shared libraries. Some justification:

http://bugs.gentoo.org/show_bug.cgi?id=110840#c9

On the other hand, position-independent code is only necessary when
building shared libraries, so disable it for the static cases.
(cherry picked from commit c3b5adaa9a)
2007-11-01 11:01:10 -07:00
Dan Nicholson
00e7dd8a13 Add -fno-strict-aliasing workaround for Linux GCC targets
Most Linux distros work around aliasing problems in Mesa by compiling
with the GCC option -fno-strict-aliasing. Two examples:

  https://bugs.freedesktop.org/show_bug.cgi?id=6046
  http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=394311

This makes -fno-strict-aliasing the default with a comment that
developers should consider commenting it out. There is a already a note
about these bugs in docs/helpwanted.html.
(cherry picked from commit 013dbcd611)
2007-11-01 10:56:01 -07:00
Brian
d11b375b16 fix typo 2007-10-31 09:43:17 -06:00
Brian
d1afa8146f updated help/to-do list 2007-10-31 09:40:58 -06:00
Brian
31d4ba8a93 glDrawArrays(count=0) bugfix 2007-10-31 09:40:20 -06:00
Brian
1a7640958c check for count==0 in _mesa_validate_DrawArrays() 2007-10-31 09:39:20 -06:00
Brian
2e2a5a450b note G33/Q33/Q35 support 2007-10-31 08:19:14 -06:00
Brian
574fd63ff0 fix GL_ATI_separate_stencil 2007-10-30 10:46:31 -06:00
Brian
1063d47526 Alias glStencilOpSeparateATI with glStencilOpSeparate.
(Cherry-pick from master)
2007-10-30 10:45:47 -06:00
Brian
b59a892d3e Finish up ATI_separate_stencil
Add entrypoints to glapi XML file and regenerate files.
Implement glStencilOpSeparateATI().
Consolidate some code in stencil.c

Conflicts:

	src/mesa/glapi/dispatch.h
	src/mesa/glapi/glapioffsets.h
	src/mesa/glapi/glapitable.h
	src/mesa/glapi/glapitemp.h
	src/mesa/glapi/glprocs.h
	src/mesa/main/enums.c
	src/mesa/main/state.c
	src/mesa/sparc/glapi_sparc.S
	src/mesa/x86-64/glapi_x86-64.S
	src/mesa/x86/glapi_x86.S
2007-10-30 10:34:26 -06:00
Roland Scheidegger
6e5d5d77df add missing _mesa_StencilFuncSeparateATI function 2007-10-30 10:26:56 -06:00
Dan Nicholson
a6319d18cf Build xdemos programs by default on linux-dri
Since libglut is no longer hardcoded, we can build the xdemos programs
so long as a GLX enabled libGL and libGLU have been built.
(cherry picked from commit 06ca14543e)
2007-10-29 12:08:34 -07:00
Dan Nicholson
5103e883fd update APP_LIB_DEPS for static library configs (patch 3/3)
(cherry picked from commit 162914675a)
2007-10-29 12:06:50 -07:00
Dan Nicholson
98c4ea4b24 simplify APP_LIB_DEPS (patch 2/3)
(cherry picked from commit 9ef1d9f03a)
2007-10-29 12:06:23 -07:00
Dan Nicholson
29b8cac7d7 specify app lib dependencies in Makefiles (patch 1/3)
(cherry-picked from commit c05aa5ec4c)

Conflicts: progs/demos/Makefile
           progs/xdemos/Makefile
2007-10-29 12:05:54 -07:00
Dan Nicholson
cdb02d43fe linux-dri-xcb: Fix undefined refs when linking with libGL
GL_LIB_DEPS was missing -lXdamage and -lXfixes, which was causing
linker errors when trying to build the programs.
(cherry picked from commit 3b9e28d507)
2007-10-29 11:44:30 -07:00
Michel Dänzer
50cecddc4a driFenceType: Really return fence type, not flags.
This typo could lead to the i915tex driver waiting for an EXE only fence as RW,
causing it to abort with an error.
2007-10-29 13:27:59 +00:00
Alan Hourihane
177f6398e5 Only set R_MODE with NV_point_sprite 2007-10-28 20:08:15 +00:00
Dan Nicholson
887bd6a46f configs: Fix linux-static to link correctly
The linux-static target was missing necessary libraries and hardcoding
their location to /usr/X11R6/lib. This makes it comparable to the x86
and x86-64 static targets.
(cherry picked from commit 9514209593)
2007-10-26 15:49:00 -07:00
Brian
9af5153410 use grep -q 2007-10-25 14:48:08 -06:00
Dan Nicholson
0e2103689e More ignored programs merged back from master
Some more entries in progs/*/.gitignore that were in master.
2007-10-25 11:59:26 -07:00
Brian
2c496d8e46 simplify/fix the ASM_FLAGS tests (bug 12931) 2007-10-25 11:12:17 -06:00
Brian
8f0ba02e44 Cray Xt3 config 2007-10-25 11:12:07 -06:00
Brian
524c56e417 Fix merge 2007-10-24 16:36:00 -06:00
Brian
773f3a266c added catamount-osmesa-pgi config, fixes for cross-compiling 2007-10-24 16:35:47 -06:00
Brian
882ada0d22 don't build x86, x86-64 dirs if not needed 2007-10-24 16:33:24 -06:00
Brian
6229005f93 properly init dst reg's CondMask/Swizzle fields 2007-10-23 10:55:14 -06:00
Brian
6c63b35ef7 bump up MAX_INSTRUCTIONS and add an assertion to catch emitting too many instructions 2007-10-23 10:25:34 -06:00
Brian
fb85e50e09 add directfb glut sources to tarball 2007-10-23 08:22:11 -06:00
Brian
5e5f908d0c don't apply ColorMask to main gc 2007-10-22 17:54:07 -06:00
Michel Dänzer
c09e2143c7 i915tex: Don't emit 'empty' blit rectangles.
The hardware seems to interpret them differently and produce unexpected
results...
2007-10-17 18:28:46 +02:00
Brian
74ced1e67f fix fog, rescale_normals bugs (from gallium branch) 2007-10-15 18:02:14 -06:00
Andreas Micheler
dd02c1609e faster write_rgba_span_front() 2007-10-15 08:28:06 -06:00
Brian
cdf4880a79 replace 'brick' with correct program name in printfs 2007-10-10 10:57:37 -06:00
Mrc Gran
2ec8e8547d fix force_s3tc_enable option 2007-10-10 09:16:12 -06:00
Dan Nicholson
b7c36d1d33 Ignore more generated files in progs/
Many of the directories in progs/ were missing .gitignore files or
were tracking generated files. This patch is basically the process of
running `make' in each directory and then finding the untracked files
with `git-ls-files -o --exclude-per-directory=.gitignore'. The existing
files were also sorted.

Conflicts:

	progs/demos/.gitignore
	progs/tests/.gitignore
	progs/xdemos/.gitignore
2007-10-10 08:49:59 -06:00
David Nusinow
8913402b74 Revert "* Disable building i915tex."
This reverts commit 76556f8264.
2007-10-06 17:54:29 -04:00
David Nusinow
c00dfefd6f Revert "Don't release just yet."
This reverts commit c3de7b5ade.
2007-10-06 17:54:13 -04:00
David Nusinow
c3de7b5ade Don't release just yet. 2007-10-04 23:10:47 -04:00
David Nusinow
76556f8264 * Disable building i915tex.
It was previously only built on x86 and amd64.  It was never
  production-ready and relies on a kernel interface that never went
  upstream.
2007-10-04 22:49:27 -04:00
Xiang, Haihao
970d18a708 Brian's fix for bug9829 2007-10-04 00:08:18 +02:00
Roland Scheidegger
9456e7f0ff minor fog calc cleanup 2007-10-03 22:34:36 +02:00
Roland Scheidegger
a5db24adc2 fog: fix issues with negative fog coords (may fix #10529)
Rework tnl fog a bit. Make sure we always use ABS(eyez) when fog coord source
is depth, OTOH it does not seem to be necessary to use it (as was done before
in some cases) if fog coord source is fogcoord (just to save some work).
This fixes tests/fog (the first 2 cases) with i915/i915tex.
2007-10-03 22:33:26 +02:00
Roland Scheidegger
17664e2620 make sure optimized fog params get updated 2007-10-03 22:33:03 +02:00
Roland Scheidegger
43a0eb0253 unbreak 3d textures (typo when setting tex layout) 2007-10-03 22:32:33 +02:00
Michel Dänzer
bcdaed2c0a i915tex: Work around texture pitch related performance drops on i915 at least. 2007-10-03 10:48:56 +02:00
Brian
78c6637db5 updated glext.h license info (Khronos), plus other clean-ups 2007-10-01 17:56:48 -06:00
Brian
44214a98fd fix VBO-split infinite loop (bug 12164) 2007-09-29 12:01:47 -06:00
Dan Nicholson
9cc6d2310c add support for LDFLAGS env var 2007-09-28 18:47:11 -06:00
Brian
1a045954be update the DRM/DRI instructions 2007-09-28 18:43:12 -06:00
Dave Airlie
b3fc9a1585 i965: fix vblank on 965gm laptops by bringing in code from i915
jbarnes has better fixes for this in 7.1, but for 7.0.2 this seems like the best
plan, for distros to pick it up.
2007-09-28 12:02:27 +10:00
Xiang, Haihao
2a86a449ca mesa: make sure the gotten value isn't greater than the
max depth buffer value on 64bit system. fix bug #12095
2007-09-27 10:44:45 -06:00
Xiang, Haihao
44f032db61 i965: handle all unfilled mode in clip stage. fix bug #12453 2007-09-27 10:40:22 -06:00
Brian
5a520729ee prep for 7.0.2 release 2007-09-27 10:35:10 -06:00
Brian
36fbe78c60 for Miniglx, use git sources 2007-09-27 10:34:44 -06:00
Brian
029bb17770 bump versions to 7.0.2 2007-09-27 10:30:13 -06:00
Brian
7958bee6be fix blend bug 12164 2007-09-27 10:25:57 -06:00
Brian
0b9bb21ce4 Restore old _TriangleCaps code to fix Blender problem (bug 12164) 2007-09-27 10:25:33 -06:00
Roland Bär
cfcc5b794e [i965] Bug #11812: Fix fwrite return value checks in AUB file code. 2007-09-26 08:00:17 -06:00
Zou Nan hai
925ff408a6 fix fd.o bug #12217, recalcuate urb when clip plane size change 2007-09-26 07:59:41 -06:00
Xiang, Haihao
f40ca444f5 i965: The cube map texture coordinates must be devided by the
component with the largest absolute value before they are
delivered. fix bug #12421
2007-09-26 07:58:57 -06:00
Zou Nan hai
638a5e0382 fix a bug in 965 ARB_occlusion_query,
fd.o bug #12132
2007-09-26 07:58:29 -06:00
Brian
6d777bf055 fix DrawRangeElements error msg 2007-09-23 13:57:36 -06:00
Brian
ae6d4e8bc0 fix -D_BSD_SOURC 2007-09-20 18:42:59 -06:00
Brian
f2728724d3 fix for __IBMC__ 2007-09-20 15:12:42 -06:00
Brian
bc95b34cce added bluegene-xlc-osmesa, fortran fixes 2007-09-20 15:12:21 -06:00
Brian
9eb89616af fixes for bluegene-xlc-osmesa config 2007-09-20 15:10:35 -06:00
Brian
f7713a6d81 Added bluegene-xlc-osmesa config (Alexander Neundorf) 2007-09-20 15:09:54 -06:00
Brian
1cec9b727a fix bug 10604 2007-09-14 13:43:58 -06:00
Brian
18a4730f5b From trunk: mesa: bind VBO_ATTRIB_XXX to correct input array when executing a display list. fix #10604
This also fixes Bill Mitchell's Fortan/plot bug.
2007-09-14 13:43:09 -06:00
Brian
1342aefcdd updated link 2007-09-14 09:57:16 -06:00
Brian
1fd4b1e702 fix glCopyPixel/glPixelZoom bug 12417) 2007-09-14 09:57:08 -06:00
Brian
32dff44c28 fix copypixels overlap test bug (#12417) 2007-09-14 09:56:05 -06:00
Brian
e7c2ae476a fix ARB fp/vp parsing bug 12313 2007-09-13 11:42:48 -06:00
Brian
a66301f83d added program_error2() function for better error reporting 2007-09-13 11:41:44 -06:00
Brian
a5f7d56221 Fix state.texgen parsing error (bug 12313).
Replace *(*inst++) with *(*inst)++ in a few places.
2007-09-13 11:29:51 -06:00
Brian
140080c1ec added .pc.in files to tarballs 2007-09-13 09:27:06 -06:00
Brian
ef43af6d43 added DSTDIR, pkg-config items 2007-09-12 10:12:20 -06:00
Brian
949d0532f0 updated with pkg-config info 2007-09-12 10:12:06 -06:00
Dan Nicholson
96efc76d74 pkg-config support 2007-09-12 10:03:31 -06:00
Dan Nicholson
6ca0d63692 DESTDIR support. 2007-09-12 10:01:06 -06:00
Xiang, Haihao
95fc2485e2 i965: fix bug#11925 2007-09-12 16:58:45 +08:00
Xiang, Haihao
d6ce1e4834 i965: fix #11378 2007-09-12 15:29:11 +08:00
Brian
2cc2b12fc7 fix indirect rendering crash 2007-09-11 10:59:10 -06:00
Brian
2259f81cf7 In _mesa_make_current(), don't unbind FBOs from the old context.
This fixes the X server crash reported by KeithP on Aug 29.
The old context's FBOs will be unreferenced during context destruction so
there's no memleak with this change.
2007-09-11 10:59:10 -06:00
Brian
791f12880f Update depth test state when binding new framebuffer object 2007-09-11 09:25:49 -06:00
Brian
7aa7373a64 fix comment 2007-09-11 09:25:49 -06:00
Xiang, Haihao
2f186a190f i965: take the secondary color into account when drawing
bitmap. fix#10688
2007-09-11 17:03:07 +08:00
Xiang, Haihao
357893a873 i965: limit on LOD Bias, fix#11987 2007-09-11 17:02:15 +08:00
Brian
a17881da5f clean-up (see bug 12317) 2007-09-10 08:36:01 -06:00
Brian
4872ee83a9 updated VC7 project files 2007-09-05 10:05:48 -06:00
Christoph Kubisch
5ec222a832 updated VC7 project files 2007-09-05 10:01:58 -06:00
Brian
40438b3440 Use temporary matrix in __gluInvertMatrixd() to fix aliasing problem (see bugs 12269, 6748) 2007-09-03 16:21:12 -06:00
Xiang, Haihao
e0b80660c8 fix bug#11009 2007-09-01 15:31:49 +08:00
Xiang, Haihao
a2016301f5 i965: Take the upper limitation on LOD into account. 2007-09-01 15:14:58 +08:00
Brian
7ec6729fb6 sync with trunk, fixing bug 12239 2007-08-31 16:36:17 -06:00
Brian
837a2cf72e fix i965 bugs, x86-64 bugs 2007-08-31 16:35:38 -06:00
Roland Scheidegger
0adca14536 fix another occurence of movaps which might not be aligned 2007-08-31 00:06:30 +02:00
Brian
57b0f66c6d s/movaps/movups/ (see bug 12216) 2007-08-30 08:41:43 -06:00
Xiang, Haihao
e47e7a9571 i965: store read drawable info in intel_context. Some OpenGL
operations are based on read drawable. fix bug#10136.
2007-08-30 14:06:26 +08:00
Xiang, Haihao
68ca01560f i965: check NULL pointer. fix bug#12193 2007-08-30 14:06:19 +08:00
Xiang, Haihao
64f1c91fcb i965: samplers group in fours in WM_STATE. fix bug#9415 2007-08-30 14:05:56 +08:00
Xiang, Haihao
7d33f94198 i965: flush batch buffer when getting the maximum. This makes
some 3D programs such as pymol work well.
2007-08-30 14:05:39 +08:00
Julien Cristau
369cda3752 Prepare changelog for upload. 2007-08-28 12:11:47 +02:00
Julien Cristau
846078d06f Delete generated files. 2007-08-28 12:07:45 +02:00
Julien Cristau
b18500d56e * Update to latest git (from mesa_7_0_branch)
+ adds support for some new intel chipsets (i915 and i915_tex dri drivers)
    (closes: #437333)
  + broken inline asm in dri drivers fixed (closes: #423739)
2007-08-28 12:07:25 +02:00
Julien Cristau
7d92c50490 Merge branch 'mesa_7_0_branch' of git.freedesktop.org:/git/mesa/mesa into debian-unstable 2007-08-28 11:06:22 +02:00
Brian
d69a596193 Fixed bugs 6748, 12141 2007-08-27 10:48:31 -06:00
Colin McDonald
8aa4ae638e fixed problem with big glDrawArrays (see bug 12141) 2007-08-27 10:47:49 -06:00
Brian
3069f34841 new __gluInvertMatrix() function (Mesa bug 6748) 2007-08-27 10:36:25 -06:00
Adam Jackson
b3788a0e4f Unbreak Linux builds with -fvisibility=hidden. 2007-08-24 08:49:59 +01:00
Brian
582bc029ab remove CallDepth++/-- accidentally removed in prev commit 2007-08-24 08:45:27 +01:00
Brian
e9e3099433 remove unneeded CallStack array 2007-08-23 08:17:35 +01:00
Brian
4fc561cc7b refactor bounds checking code 2007-08-20 13:12:10 +01:00
Brian
ad3e3a0b99 don't map buffer in _mesa_validate_DrawElements() unless needed 2007-08-20 12:55:26 +01:00
Brian
bfb8c849cb Remove recent texobj refcount debug/logging code. 2007-08-16 09:11:11 +01:00
Michel Dänzer
09dd25b5d1 i915tex: Unreference texture buffers on context destruction.
Not doing this could cause the buffers to leak under some circumstances.
2007-08-16 08:45:16 +02:00
Roland Scheidegger
c48efb1dbe suppress warning about ncon visuals (bug #6689) 2007-08-16 02:43:45 +02:00
Brian
5408acb6b7 log deleting/binding of FBOs 2007-08-15 15:47:28 +01:00
Brian
15481160f9 more debug output (context destroy, fb destroy) 2007-08-15 12:52:00 +01:00
Brian
00ccff03a5 Rewrite quite a bit of the code for glPush/PopAttrib() for texture state.
Remove the Saved1D/2D/etc fields from gl_texture_attrib in mtypes.h
Use a new texture_state struct in attrib.c that has the extra information
for restoring texture object state and saving references to the texture
objects (so they can't accidentally get deleted while referenced by the
attribute stack).  All the texobj refcounting is mutex-protected now.
2007-08-15 11:21:06 +01:00
Brian
21594921b1 copy Target in _mesa_copy_texture_object() 2007-08-15 11:18:38 +01:00
Brian
42c91eebc9 Added _mesa_free_attrib_data() to free anything left in the attribute stack upon context destruction.
Also, a bit more refcount debug info.
2007-08-15 10:10:02 +01:00
Brian
88273e08b4 more tex obj ref count debugging (temporary) 2007-08-15 08:55:03 +01:00
Brian
08f7fb45ef added some temporary texobj ref counting debug output 2007-08-14 19:45:02 +01:00
Brian
75ebda3ce6 Fix a few more problems with freeing FBOs/textures during context destruction.
Free FBOs before textures since the later may be referenced by the former.
Need to bind the context we're destroying if there isn't a current context
so that ctx->DeleteTexture() etc can be used.
2007-08-14 11:57:16 +01:00
Brian
53ff15fcbf fix blending/banding bug 2007-08-13 21:17:04 +01:00
Dan Torop
72adb70ee2 fix spantmp2 READ_RGBA inline asm (#11931) 2007-08-13 21:14:51 +01:00
Brian
960d41fcfe added more i915/945 chipsets 2007-08-13 21:11:17 +01:00
Brian
0c4e35b070 Add PCI IDs for the G33, Q33, and Q35 chipsets.
Conflicts:

	src/mesa/drivers/dri/i915/i915_texstate.c
	src/mesa/drivers/dri/i915/intel_context.c
	src/mesa/drivers/dri/i915/intel_context.h
	src/mesa/drivers/dri/i915/intel_screen.c
	src/mesa/drivers/dri/i915/intel_tex.c
2007-08-13 21:06:33 +01:00
Wang Zhenyu
c53f1cb813 i915tex: Add support for 945GME 2007-08-13 21:00:28 +01:00
Brian
f6696cc15e free any render/framebuffers left in hash tables when freeing shared state 2007-08-13 17:39:05 +01:00
Michel Dänzer
fef9a41fe4 i915tex: Make sure pitch is aligned properly for render-to-texture.
Just always align texture pitch to multiples of 64 bytes for now, pending a
more sophisticated scheme to do it only when really necessary.
2007-08-13 13:22:43 +02:00
Brian
e279a0a076 Implement mutex/locking around texture object reference counting.
Use new _mesa_reference_texobj() function for referencing/unreferencing
textures.  Add new assertions/tests to try to detect invalid usage of
deleted textures.
2007-08-13 11:28:52 +01:00
Brian
88c8aaed96 fix link to 7.0.1 relnotes 2007-08-09 15:59:38 +01:00
Julien Cristau
34beaefe1c Prepare changelog for upload. 2007-08-09 16:00:58 +02:00
Julien Cristau
10b828f193 New upstream release. 2007-08-09 11:56:00 +02:00
Julien Cristau
43e6260ed0 Merge tag 'mesa_7_0_1' into debian-experimental 2007-08-09 11:25:42 +02:00
Brian
62cbbd7226 fix byte swap bug for GLuint stencil indexes (bug 11909) 2007-08-09 08:45:01 +01:00
Brian
f7cbe7fcee move free() after dereference (bug 11878) 2007-08-07 22:06:48 +01:00
Brian
d8e4ff9079 fix potential NULL dereference (bug 11879) 2007-08-07 21:56:39 +01:00
Brian
510ff27eda remove SHELL line, replace -e test with new logic (Daniel Stone) 2007-08-07 21:52:22 +01:00
Brian
5abf055100 fix potential NULL dereference (bug 11880) 2007-08-07 21:46:42 +01:00
Brian
4bb5721f6b fix swizzle error test (bug 11881) 2007-08-07 21:43:46 +01:00
Brian
c41ab70d3a initial 7.0.2 notes 2007-08-07 08:44:35 +01:00
Brian
a05e403bf2 fix bug 9962 (vbo splitting) as in trunk 2007-08-07 08:43:31 +01:00
Brian
2f57e0f71d Merge branch 'mesa_7_0_branch' of git+ssh://brianp@git.freedesktop.org/git/mesa/mesa into mesa_7_0_branch 2007-08-07 08:21:50 +01:00
Brian
95a2eb9767 fix even-sized point positioning (bug 11874) 2007-08-07 08:20:18 +01:00
Brian
55175daed7 added md5 sums 2007-08-03 13:54:55 -06:00
Brian
ae16a51e95 added GLU bug fixes 2007-08-03 13:39:09 -06:00
Brian
4398d67546 update 7.0.1 release info/date 2007-08-03 13:32:47 -06:00
Brian
c93738687c remove -rc2 2007-08-03 13:32:28 -06:00
Brian
799492e606 add OSMESA_LIB_NAME 2007-08-03 10:08:16 -06:00
Brian
f33ff071bb added -lm 2007-08-03 07:24:33 -06:00
Brian
99e854743c added bluegene-osmesa 2007-08-02 14:24:05 -06:00
Brian
6f79062d91 OSmesa on BlueGene (Alexander Neundorf) 2007-08-02 14:22:52 -06:00
Brian
2f682c3995 fix stencil value masking bug 11805, and fix sizeof() bug 2007-08-02 09:08:53 -06:00
Brian
067370e68f fix invalid pointer usage in bezierPatchDeleteList(), bug 11807 2007-08-02 08:40:58 -06:00
Brian
2aa439a6a4 fix double free()s (bug 11808) 2007-08-02 08:38:10 -06:00
Brian
b477182dc3 s/MAX_TEXTURE_LEVELS/SIS_MAX_TEXTURE_LEVELS/ and add assertion (bug 11806) 2007-08-02 08:35:27 -06:00
Michel Dänzer
a8964ca89e i915tex: Better attempt to release miptree when overriding texture image.
The previous approach could lead to crashes in FBO code that dereferences the
miptree struct pointer unconditionally.
2007-08-02 12:14:03 +02:00
Brian
4f0e92d07c Merge branch 'mesa_7_0_branch' of git+ssh://brianp@git.freedesktop.org/git/mesa/mesa into mesa_7_0_branch 2007-08-01 17:03:09 -06:00
Brian
577f4e8a5f Obsolete 2007-08-01 11:45:47 -06:00
Brian
0586d9fe56 fix error code test limit (bug 11795) 2007-08-01 11:27:47 -06:00
Michel Dänzer
1f0d9bf05e i915tex: Missing piece of SetTexOffset hook implementation for I830 generation. 2007-08-01 17:46:32 +02:00
Michel Dänzer
8bcae2a527 i915tex: Implement SetTexOffset hook.
Only build tested for I830 generation.
2007-08-01 17:46:31 +02:00
Michel Dänzer
35ca9aae91 r300: Implement SetTexOffset hook. 2007-08-01 17:46:30 +02:00
Michel Dänzer
6cdd2bf8d7 Add interfaces for overriding texture images with driver specific 'offsets'.
To be used by AIGLX for GLX_EXT_texture_from_pixmap without several
additional data copies.
2007-08-01 17:46:29 +02:00
Brian
ce7d175adb fix mem leak (bug 11793) 2007-08-01 08:42:13 -06:00
Brian
1904fd095f fix mem leak (bug 11791) 2007-08-01 08:42:09 -06:00
Brian
897d0ac5cc fix some FreeBSD issues 2007-07-31 14:57:54 -06:00
Brian
e262d0182f fix failure caused by undeclared variable (bug 11783) 2007-07-31 09:43:40 -06:00
Brian
aa5b748c10 glGetAttribLocation always returned 1 (bug 11774) 2007-07-31 09:29:31 -06:00
Julien Cristau
c6728df4a3 Merge tag 'mesa_7_0_1_rc2' into debian-experimental 2007-07-31 04:00:13 +02:00
Brian
3c182c5bc8 Added sunos5-v9-cc-g++ config (Roland Egger) 2007-07-30 09:00:09 -06:00
Brian
1b5677847b _mesa_pack_bitmap() fix from trunk 2007-07-30 08:13:05 -06:00
Brian
1be59a9dbe dlist polygon stipple fix from trunk 2007-07-30 08:12:29 -06:00
Brian
55c2178ad4 fix bug 11754 2007-07-29 18:28:09 -06:00
Jan Dvorak
3e3d392e1c fix glPointParameteriv bug 11754 2007-07-29 18:26:55 -06:00
Julien Cristau
593de57fa2 Prepare changelog for upload. 2007-07-27 20:18:21 +02:00
Julien Cristau
04b0e43ea6 New upstream release candidate. 2007-07-27 19:59:38 +02:00
Julien Cristau
04eee290c8 Merge branch 'mesa_7_0_branch' of git://anongit.freedesktop.org/git/mesa/mesa into debian-experimental 2007-07-27 19:58:30 +02:00
Brian
756a7a4e4b minor tweaks 2007-07-27 11:44:55 -06:00
Brian
121b4ac220 More Mingw32 fixes from Zhang (zxpmyth@yahoo.com.cn) 2007-07-27 11:12:21 -06:00
Brian
cdbd5db3af release candidate 2 2007-07-27 11:10:00 -06:00
Brian
b2240f6ad4 fix bug 11731 2007-07-26 15:33:39 -06:00
Brian
33814a55f8 Fix function call bug 11731. Also, fix up IR_CALL/IR_FUNC confusion. 2007-07-26 15:32:34 -06:00
Brian
a57c5a417b generate error upon writing to varying var in fragment program (bug 11733) 2007-07-26 11:39:37 -06:00
Brian
ff1a28de17 clamp float colors 2007-07-26 08:19:40 -06:00
Brian
772f57f99b call ctx->Driver.NewProgram() instead of _mesa_new_program() 2007-07-24 09:56:54 -06:00
Brian
dacee32b8b fix logic error, typos 2007-07-24 09:19:44 -06:00
Brian
fa1a3eb06d fix GLX_STEREO bug 2007-07-23 16:54:35 -06:00
Brian
bd4817ca54 fix GLX_STEREO handling (bug 11705) 2007-07-23 16:51:03 -06:00
Julien Cristau
d3a160e217 New upstream release candidate. 2007-07-23 16:39:48 +02:00
Julien Cristau
c5837f2791 Merge branch 'mesa_7_0_branch' of git://anongit.freedesktop.org/git/mesa/mesa into debian-experimental 2007-07-23 16:28:56 +02:00
Julien Cristau
490bd43f18 Merge branch 'debian-unstable' of git+ssh://git.debian.org/git/pkg-xorg/lib/mesa into debian-experimental
Conflicts:

	debian/changelog
2007-07-23 16:28:10 +02:00
Brian
005eea249c Fix a number of MINGW32 issues (Zhang <zxpmyth@yahoo.com.cn>) 2007-07-21 11:27:22 -06:00
Brian
9747de8ec6 drop VC6 and VC7 project files until updated 2007-07-21 10:03:30 -06:00
Brian
849a9799d0 fix bug 11588 2007-07-13 16:37:18 -06:00
Jan Dvorak
e32ae4fe33 fix shader/info string length queries (bug 11588) 2007-07-13 16:35:19 -06:00
Brian
4595389c4c fix width/depth mix-up (bug 11577) 2007-07-12 21:43:39 -06:00
Brian
e8ccc7cc49 Merge branch 'mesa_7_0_branch' of git+ssh://brianp@git.freedesktop.org/git/mesa/mesa into mesa_7_0_branch 2007-07-12 14:49:56 -06:00
Brian
673d21047a fix swizzle-related bug 11534 2007-07-12 14:49:24 -06:00
Julien Cristau
6186261589 Prepare changelog for upload. 2007-07-11 05:51:34 +02:00
Julien Cristau
45310e219c Relax libgl1-mesa-dev dependency on libgl1-mesa-glx.
Change the >= ${source:Version} dependency to >= ${source:Upstream-Version}.
This way libgl1-mesa-dev stays installable after a minor revision bump on
architectures where mesa isn't built yet.
2007-07-11 05:45:30 +02:00
Julien Cristau
250f6b2c88 Replace ${Source-Version} with ${source:Version} in one remaining spot. 2007-07-11 05:34:30 +02:00
Michel Dänzer
fdefc2bbda i915tex: Better procedure for dropping batchbuffer on virtual resolution change.
The previous procedure would often result in a GPU lockup.
2007-07-10 11:02:18 +02:00
Michel Dänzer
2079df8527 i915tex: Only wait for vblank when really necessary.
This avoids superfluous waits for vblank timing out under some circumstances.
2007-07-10 10:54:51 +02:00
Michel Dänzer
b53659452c Clear pointers to freed cliprects.
Not doing this could lead to double frees under rare circumstances.
2007-07-10 10:49:28 +02:00
Michel Dänzer
46f1d6653e Remove dubious compile-time test for pre-2.4 Linux kernels.
LINUX_VERSION_CODE shouldn't be used by userspace code, it can be defined empty
these days.

If anybody still cares about 2.2 kernels, they should reinstate this as a
proper runtime test.
2007-07-10 10:34:10 +02:00
Brian
c1938a60f7 Fix zero-size texture checking in _mesa_test_proxy_teximage(), bug 11309 2007-07-08 10:04:14 -06:00
Brian
d65110f352 Check if 'indices' is NULL, bug 11314 2007-07-08 09:21:21 -06:00
Brian
9fa3bbcb5a check depthScale value for optimized ushort->uint case (fixes bug 11474) 2007-07-08 08:53:09 -06:00
Brice Goglin
19e51ecbe6 libgl1-mesa-dev does not need to depend on libgl1-mesa-dri, libgl1-mesa-glx is enough.
libgl1-mesa-glx was included in libgl1-mesa-dri before 6.4.1-0.1,
so libgl1-mesa-dev had to depend on libgl1-mesa-dri at this point.
Since libgl1-mesa-dri only contains the DRI modules now, it is not
required anymore for libgl1-mesa-dev.
2007-07-07 22:17:35 +02:00
Brian
99d62f2922 fix i915 polygon stipple bug 2007-07-06 16:53:28 -06:00
Brian
284743cafe add GL_QUADS to i915_reduced_primitive_state() to fix redbook/polys demo 2007-07-06 16:52:34 -06:00
Xavier Bachelot
08d7307b2a call glutInit(), bug 11486 2007-07-06 12:54:40 -06:00
Brian
ef6a64abe6 fix a syntax error (missing right-paren) 2007-07-05 16:04:10 -06:00
Brian
18bfa52ef7 fix bug 11475 2007-07-05 09:42:07 -06:00
Brian
d62be2652c Copy from Mesa master. Includes fixes for bugs 11475 and 11448. 2007-07-05 09:40:37 -06:00
Julien Cristau
31f3433635 Prepare changelog for upload. 2007-07-05 00:56:56 +02:00
Samuel Thibault
639eaceee7 Fix build on hurd-i386.
Build libgl1-mesa-glx without direct rendering support on that arch, and
don't build any dri driver.
2007-07-05 00:48:30 +02:00
Eric Anholt
ea53ff80af fix LogicOp/bitmap problem, bug 11133 2007-07-04 07:37:28 -06:00
Brian
feeca1bcbc add fbdev/ to DEMO_FILES 2007-07-03 15:46:48 -06:00
Brian
12e7278c08 document GLSL fixes 2007-07-03 12:21:11 -06:00
Brian
45b5c44eb9 bring over Roland's DOT3_RGBA fix from master 2007-07-03 12:20:52 -06:00
Brian
e3456c1028 added vec2(vec4) constructor, bug 11404 2007-07-03 11:42:03 -06:00
Brian
327fb38573 add code for stpq, rgba writemasks in make_writemask(), bug 11404 2007-07-03 11:41:07 -06:00
Brian
1d25d9e15f Bump version to 7.0.1 2007-07-03 10:04:41 -06:00
Brian
cc7cee3f48 Revert the version of libOSMesa.so to 6.5.3 to avoid linking issues that were caused by bumping to 7.0 2007-07-03 10:03:01 -06:00
Brian
d7062710cd use _mesa_unpack_stencil_span() in draw_stencil_pixels(), bug 11457 2007-07-03 08:58:03 -06:00
Julien Cristau
3e21f52796 Make libgl1-mesa-swx11 depend on libosmesa6
libgl1-mesa-swx11 used to contain libOSMesa.so.6, so programs linked against
it don't necessarily depend on libosmesa6; their dependencies were broken
since mesa 6.5.2-1.
2007-07-03 05:34:07 +02:00
Brian
9bfba734d8 add const to wglSetPixelFormat() to match .h declaration 2007-07-02 10:15:39 -06:00
Julien Cristau
0511d9a9d2 Fix merge and delete symlinks which aren't in the tarball. 2007-07-01 02:55:59 +02:00
Brian
aaebf2f47e regenerated 2007-06-29 07:51:49 -06:00
Brian
23f8d77b38 Add a few missing GL 2.0 entrypoints, regenerate related files.
Specifically:
  glVertexAttrib4bv
  glVertexAttrib4iv
  glVertexAttrib4ubv
  glVertexAttrib4uiv
  glVertexAttrib4usv
2007-06-28 16:38:48 -06:00
Samuel Thibault
498b4dbba4 Fix build on hurd-i386.
Build libgl1-mesa-glx without direct rendering support on that arch, and
don't build any dri driver.
2007-06-28 22:33:05 +01:00
Julien Cristau
ecc42e79ae Merge unreleased changelog entries 2007-06-28 22:01:05 +01:00
Julien Cristau
0bf8ed523d * Add a shlibs file for libgl1-mesa-swx11-i686. 2007-06-28 21:58:42 +01:00
Brian
87d22ee0fe initial 7.0.1 relnotes 2007-06-28 08:11:36 -06:00
zhang
52e25f63d4 a variety of fixes for MingW 2007-06-28 08:10:09 -06:00
Brian
f3fb67972b remove obsolete t_save_api.c 2007-06-28 07:43:32 -06:00
Brian
6400756364 remove obsolete sources 2007-06-28 07:21:59 -06:00
David Nusinow
d71d04bf6f Bite the bullet and add myself to uploaders 2007-06-27 22:54:52 -04:00
David Nusinow
af90259e09 Merge remote branch 'origin/debian-experimental' into debian-experimental
Conflicts:

	debian/changelog
	src/mesa/drivers/dri/r300/radeon_lock.c
2007-06-27 22:53:04 -04:00
David Nusinow
7c9762f698 Changelog bump 2007-06-27 21:32:51 -04:00
David Nusinow
b2e67fdb7c Merge branch 'upstream-experimental' into debian-experimental
Conflicts:

	.gitignore
	progs/miniglx/miniglxtest.c
	src/glx/mini/Makefile
	src/glx/mini/miniglx.c
	src/mesa/drivers/dri/r300/.gitignore
2007-06-27 21:29:16 -04:00
Brian
d59f0314bd md5 sums for 7.0 2007-06-22 16:50:24 -06:00
Brian
131baefac3 fix date for 7.0 release 2007-06-22 16:41:36 -06:00
Brian
a450078b67 update version 2007-06-22 16:40:17 -06:00
Brian
f6b041bf6c bring in Eric's FreeBSD fixes for -pthread 2007-06-22 15:40:46 -06:00
Brian
4f340d181a set tentative 7.0 release date 2007-06-20 19:59:15 -06:00
Julien Cristau
74a11701f3 Shorten the one-line synopsis of various packages.
They're cut off in .changes files if they're too long.
Thanks, Marc 'HE' Brockschmidt!
2007-06-13 19:36:49 +02:00
Brian
b58e38e936 fix TEXTREL problem (bug 7459) 2007-06-12 09:52:05 -06:00
Brian
8713cb48a8 Fix TEXREL issues when using GLX_USE_TLS (see bug 7459). 2007-06-12 09:46:12 -06:00
Brian
277c5e57ed fix GLX_USE_TLS breakage 2007-06-12 08:57:39 -06:00
Brian
b3d62d5af5 disable depthBits check in check_compatible(), see bug 11161 2007-06-08 12:36:00 -06:00
Brian
9c0f0c8d81 remove old comment about DEFAULT_SOFTWARE_DEPTH_BITS 2007-06-08 12:35:37 -06:00
Brian
18a0a2a7ac document bug 11049 fix 2007-05-23 16:50:22 -06:00
Brian
8b99d9e33c restore GL_TEXTURE_LOD_BIAS in _mesa_PopAttrib(), bug 11049 2007-05-23 16:49:19 -06:00
Brian
01e7e153e3 document point attentuation fix 2007-05-23 08:59:02 -06:00
Brian
0ad4ca24d2 Fix point attentuation problem (bug 11042)
ctx->Point._Attentuation was computed in wrong place and the VB->Eye coord Z
array wasn't indexed correctly in run_point_stage().
2007-05-23 08:56:45 -06:00
Brian
724a155552 if light position is local, treat it as a homogeneous coord and divide by W (see bug 11009) 2007-05-21 10:55:15 -06:00
Julien Cristau
e1b0715dd6 Prepare changelog for upload. 2007-05-21 11:35:28 +02:00
Julien Cristau
a5c6598966 Merge remote branch 'origin/debian-unstable' into debian-experimental
Conflicts:

	debian/changelog
2007-05-21 11:33:42 +02:00
Roland Scheidegger
d38b74a316 fix miptree layout (i915) for small compressed mipmaps
This seems to work now. Also fix i945 set_level_info, need to match i915
behaviour for storing mip height, as it's assumed to be the mip width
(in texels) elsewhere and the division by 4 is done later (untested).
2007-05-19 04:43:50 +02:00
Roland Scheidegger
54cab4b47b fix copy & paste bug of previous commit, breaking dxt5 formats 2007-05-19 03:56:06 +02:00
Roland Scheidegger
c093666bc5 fix miptree comparison with compressed textures
TexelBytes is always 0 with compressed textures, thus would never match
mt->cpp. This caused constant blitting around of textures, and it fixes at
least the horrible performance of Q3 if compressed textures are enabled.
2007-05-19 01:39:54 +02:00
Roland Scheidegger
04972f6761 fix small s3tc mipmaps (#10968)
make sure that always whole blocks are uploaded.
(May still not work correctly if the top mip map is not at least a full block,
that is 4 pixels wide - not sure, but probably doesn't happen in real world)
2007-05-19 01:39:16 +02:00
Brian
67f8234622 set version to 7.0 2007-05-18 09:41:34 -06:00
Brian
201d6dbd9c fix STATE_HALF_VECTOR value (bug 10987) 2007-05-18 09:35:18 -06:00
Julien Cristau
1865ef6fd4 Prepare changelog for upload. 2007-05-18 13:36:42 +02:00
Ian Romanick
fbcac5aa83 Refactor determining whether a texture target can use compressed format 2007-05-17 14:45:25 -07:00
Brian
2b72ab8f8f document glXDestroyPbuffer fix 2007-05-17 15:30:39 -06:00
Brian
0ea97b9408 In DestroyPbuffer(), use GetReq() intead of GetReqExtra(). See bug 10983. 2007-05-17 15:26:39 -06:00
Brian
28683ac7c0 version 7.0, not 7.1 2007-05-17 09:07:25 -06:00
Brian
c72e3e210f version should be 7.0 2007-05-17 09:04:19 -06:00
Julien Cristau
a8c856d43c Cherry-pick commmit 65faf023 by Michel Dänzer to fix r300 crash.
r300: Don't crash in radeonUpdatePageFlipping when !radeon->glCtx->DrawBuffer.

This feels like a kludge, maybe there's a better solution.
2007-05-09 15:09:12 +02:00
David Nusinow
1953cfc954 Update changelog 2007-04-30 00:08:11 -04:00
David Nusinow
8e7bac950e Merge branch 'upstream-experimental' into debian-experimental 2007-04-29 23:23:00 -04:00
Julien Cristau
03cdacfb6a Prepare changelog for upload. 2007-04-25 10:37:10 +02:00
Julien Cristau
30f3c3dfad Update changelog. 2007-04-25 08:42:02 +02:00
Julien Cristau
dee1b0d5bb Merge remote branch 'upstream/master' into debian-experimental 2007-04-25 08:40:39 +02:00
Julien Cristau
6f2b0fe463 New upstream release candidate.
Refresh a couple patches.
2007-04-25 01:48:33 +02:00
Julien Cristau
0c69176498 Merge tag 'mesa_6_5_3_rc3' into debian-experimental 2007-04-25 01:41:05 +02:00
Julien Cristau
4e7a0385b5 Merge tag 'mesa_6_5_3_rc2' into debian-experimental 2007-04-25 01:40:50 +02:00
Julien Cristau
4adbd94b10 Only install stuff in mesa-swx11-source if we're building arch:all packages. 2007-04-23 11:00:09 +02:00
Julien Cristau
4a2905b645 Delete obsolete file. 2007-04-22 18:08:58 +02:00
Julien Cristau
0638c6b530 Add generated files from the tarball so they're included in mesa-swx11-source. 2007-04-22 18:08:35 +02:00
Julien Cristau
7dd35ce013 Delete .gitignore files which do more harm than good in a debian package tree. 2007-04-22 18:07:52 +02:00
Julien Cristau
c8629c3178 Resync debian/scripts/install-source.sh. 2007-04-22 00:51:10 +02:00
Julien Cristau
77ccf51cb3 New upstream release candidate. 2007-04-22 00:50:40 +02:00
Julien Cristau
01197f0c77 Merge branch 'upstream-experimental' into debian-experimental 2007-04-22 00:34:30 +02:00
Julien Cristau
69c86ff4fd Remove leftover file. 2007-04-22 00:33:38 +02:00
Julien Cristau
9a42ffad81 Add build-dependencies on libxdamage-dev and libxfixes-dev. 2007-04-21 21:23:21 +02:00
Julien Cristau
0d8633bf8c Delete autogenerated files, and files not included in the tarball. 2007-04-21 21:20:37 +02:00
Julien Cristau
d79e80a3d0 New upstream release candidate.
Drop patches included upstream.
2007-04-21 20:47:01 +02:00
Julien Cristau
d890ebdd25 Merge branch 'upstream-experimental' into debian-experimental
Conflicts:

	doxygen/Makefile
	doxygen/common.doxy
	doxygen/doxy.bat
	doxygen/glapi.doxy
	doxygen/header.html
	doxygen/main.doxy
	doxygen/math.doxy
	doxygen/shader.doxy
	doxygen/swrast.doxy
	doxygen/swrast_setup.doxy
	doxygen/tnl.doxy
	doxygen/tnl_dd.doxy
	progs/tests/Makefile
	progs/tests/fbotest1.c
	progs/tests/fbotest2.c
	progs/tests/fbotexture.c
	progs/tests/mipmap_limits.c
	progs/tests/sharedtex.c
	progs/tools/trace/gltrace_support.cc
	progs/trivial/Makefile
	src/egl/docs/EGL_MESA_screen_surface
	src/egl/main/egllog.c
	src/glx/mini/Makefile
	src/glx/mini/driver.h
	src/mesa/drivers/allegro/amesa.c
	src/mesa/drivers/windows/gldirect/dx7/gld_driver_dx7.c
	src/mesa/drivers/windows/gldirect/dx7/gld_ext_dx7.c
	src/mesa/drivers/windows/gldirect/dx7/gld_primitive_dx7.c
	src/mesa/drivers/windows/gldirect/dx8/gld_driver_dx8.c
	src/mesa/drivers/windows/gldirect/dx8/gld_ext_dx8.c
	src/mesa/drivers/windows/gldirect/dx8/gld_primitive_dx8.c
	src/mesa/drivers/windows/gldirect/dx9/gld_driver_dx9.c
	src/mesa/drivers/windows/gldirect/dx9/gld_ext_dx9.c
	src/mesa/drivers/windows/gldirect/dx9/gld_primitive_dx9.c
	src/mesa/drivers/windows/gldirect/mesasw/gld_wgl_mesasw.c
2007-04-21 20:27:55 +02:00
Brice Goglin
5ee9b3ce72 Fix conflicts for libGLw packages.
libglw1-mesa does not have to conflict with earlier libgl1-mesa-swx11
(libGLw was only shipped as development libs/headers within swx11-dev).

libglw1-mesa-dev needs to conflicts with libglw-dev.
2007-04-21 20:20:03 +02:00
Brice Goglin
031b539a09 Split out libGLw libs and headers from libgl1-mesa-swx11.
Ship both static and shared libraries for libGLw, creating libglw1-mesa and
libglw1-mesa-dev (closes: #374904).
2007-04-21 20:19:38 +02:00
Brice Goglin
47c3c706e8 Add 09_i915_always_enable_pixel_fog.patch 2007-04-21 18:00:12 +02:00
Brice Goglin
0d830a616c Add 08_r300_update_window_state_when_bound_but_stamp_changed.patch 2007-04-20 18:53:47 +02:00
Brice Goglin
e219bf8338 Add 07_call_radeonSetCliprects_from_radeonMakeCurrent.patch 2007-04-20 18:44:59 +02:00
Julien Cristau
6c0fba2480 Prepare changelog for upload. 2007-04-20 05:58:00 +02:00
Julien Cristau
f4cc159f53 Revert " * Split out libGLw libs and headers from libgl1-mesa-swx11 and ship both"
This reverts commit 856ae782c7.

Conflicts:

	debian/changelog
2007-04-20 05:55:04 +02:00
Julien Cristau
04c002abc2 Revert "Fix conflicts for libGLw packages."
This reverts commit 048144074b.
2007-04-20 05:53:59 +02:00
Julien Cristau
78fd17907e Merge branch 'debian-experimental' into debian-unstable 2007-04-20 05:52:20 +02:00
Julien Cristau
47edc83080 Merge branch 'debian-experimental' into debian-unstable
Conflicts:

	configs/debian-osmesa16
	configs/debian-osmesa16-static
	configs/debian-osmesa32
	configs/debian-osmesa32-static
	debian/changelog
	debian/compat
	debian/control
	debian/copyright
	debian/libgl1-mesa-dev.install
	debian/libgl1-mesa-swx11-dev.install
	debian/libgl1-mesa-swx11.shlibs
	debian/libglu1-mesa-dev.install
	debian/mesa-common-dev.docs
	debian/mesa-common-dev.install
	debian/rules
	src/mesa/x86-64/matypes.h
	src/mesa/x86/matypes.h
2007-04-20 05:44:24 +02:00
Julien Cristau
33e34f5bf4 Merge tag 'mesa_6_5_1' into debian-unstable
Conflicts:

	progs/util/README
	progs/util/glstate.c
	progs/util/glstate.h
	progs/util/sampleMakefile
	src/glu/sgi/libnurbs/interface/bezierEval.h
	src/glu/sgi/libnurbs/interface/bezierPatch.cc
	src/glu/sgi/libnurbs/interface/bezierPatch.h
	src/glu/sgi/libnurbs/interface/bezierPatchMesh.cc
	src/glu/sgi/libnurbs/interface/bezierPatchMesh.h
	src/glu/sgi/libnurbs/interface/glcurveval.cc
	src/glu/sgi/libnurbs/interface/glimports.h
	src/glu/sgi/libnurbs/interface/glinterface.cc
	src/glu/sgi/libnurbs/interface/glrenderer.h
	src/glu/sgi/libnurbs/interface/incurveeval.cc
	src/glu/sgi/libnurbs/interface/insurfeval.cc
	src/glu/sgi/libnurbs/interface/mystdio.h
	src/glu/sgi/libnurbs/interface/mystdlib.h
	src/glu/sgi/libnurbs/internals/arc.h
	src/glu/sgi/libnurbs/internals/arcsorter.cc
	src/glu/sgi/libnurbs/internals/arcsorter.h
	src/glu/sgi/libnurbs/internals/arctess.h
	src/glu/sgi/libnurbs/internals/backend.cc
	src/glu/sgi/libnurbs/internals/backend.h
	src/glu/sgi/libnurbs/internals/basiccrveval.h
	src/glu/sgi/libnurbs/internals/basicsurfeval.h
	src/glu/sgi/libnurbs/internals/bezierarc.h
	src/glu/sgi/libnurbs/internals/bin.cc
	src/glu/sgi/libnurbs/internals/bin.h
	src/glu/sgi/libnurbs/internals/bufpool.cc
	src/glu/sgi/libnurbs/internals/bufpool.h
	src/glu/sgi/libnurbs/internals/cachingeval.cc
	src/glu/sgi/libnurbs/internals/cachingeval.h
	src/glu/sgi/libnurbs/internals/ccw.cc
	src/glu/sgi/libnurbs/internals/coveandtiler.h
	src/glu/sgi/libnurbs/internals/curve.cc
	src/glu/sgi/libnurbs/internals/curve.h
	src/glu/sgi/libnurbs/internals/curvelist.cc
	src/glu/sgi/libnurbs/internals/curvelist.h
	src/glu/sgi/libnurbs/internals/curvesub.cc
	src/glu/sgi/libnurbs/internals/dataTransform.cc
	src/glu/sgi/libnurbs/internals/dataTransform.h
	src/glu/sgi/libnurbs/internals/defines.h
	src/glu/sgi/libnurbs/internals/displaylist.cc
	src/glu/sgi/libnurbs/internals/displaylist.h
	src/glu/sgi/libnurbs/internals/displaymode.h
	src/glu/sgi/libnurbs/internals/flist.cc
	src/glu/sgi/libnurbs/internals/flist.h
	src/glu/sgi/libnurbs/internals/flistsorter.cc
	src/glu/sgi/libnurbs/internals/flistsorter.h
	src/glu/sgi/libnurbs/internals/gridline.h
	src/glu/sgi/libnurbs/internals/gridtrimvertex.h
	src/glu/sgi/libnurbs/internals/gridvertex.h
	src/glu/sgi/libnurbs/internals/hull.cc
	src/glu/sgi/libnurbs/internals/hull.h
	src/glu/sgi/libnurbs/internals/intersect.cc
	src/glu/sgi/libnurbs/internals/jarcloc.h
	src/glu/sgi/libnurbs/internals/knotvector.h
	src/glu/sgi/libnurbs/internals/mapdesc.cc
	src/glu/sgi/libnurbs/internals/mapdesc.h
	src/glu/sgi/libnurbs/internals/mapdescv.cc
	src/glu/sgi/libnurbs/internals/maplist.cc
	src/glu/sgi/libnurbs/internals/maplist.h
	src/glu/sgi/libnurbs/internals/mesher.cc
	src/glu/sgi/libnurbs/internals/mesher.h
	src/glu/sgi/libnurbs/internals/monoTriangulationBackend.cc
	src/glu/sgi/libnurbs/internals/monotonizer.cc
	src/glu/sgi/libnurbs/internals/monotonizer.h
	src/glu/sgi/libnurbs/internals/myassert.h
	src/glu/sgi/libnurbs/internals/mycode.cc
	src/glu/sgi/libnurbs/internals/mystring.h
	src/glu/sgi/libnurbs/internals/nurbsconsts.h
	src/glu/sgi/libnurbs/internals/nurbstess.cc
	src/glu/sgi/libnurbs/internals/patch.cc
	src/glu/sgi/libnurbs/internals/patch.h
	src/glu/sgi/libnurbs/internals/patchlist.cc
	src/glu/sgi/libnurbs/internals/patchlist.h
	src/glu/sgi/libnurbs/internals/pwlarc.h
	src/glu/sgi/libnurbs/internals/quilt.cc
	src/glu/sgi/libnurbs/internals/quilt.h
	src/glu/sgi/libnurbs/internals/reader.cc
	src/glu/sgi/libnurbs/internals/reader.h
	src/glu/sgi/libnurbs/internals/renderhints.cc
	src/glu/sgi/libnurbs/internals/renderhints.h
	src/glu/sgi/libnurbs/internals/simplemath.h
	src/glu/sgi/libnurbs/internals/slicer.cc
	src/glu/sgi/libnurbs/internals/slicer.h
	src/glu/sgi/libnurbs/internals/sorter.cc
	src/glu/sgi/libnurbs/internals/sorter.h
	src/glu/sgi/libnurbs/internals/splitarcs.cc
	src/glu/sgi/libnurbs/internals/subdivider.h
	src/glu/sgi/libnurbs/internals/tobezier.cc
	src/glu/sgi/libnurbs/internals/trimline.cc
	src/glu/sgi/libnurbs/internals/trimline.h
	src/glu/sgi/libnurbs/internals/trimregion.cc
	src/glu/sgi/libnurbs/internals/trimregion.h
	src/glu/sgi/libnurbs/internals/trimvertex.h
	src/glu/sgi/libnurbs/internals/trimvertpool.cc
	src/glu/sgi/libnurbs/internals/trimvertpool.h
	src/glu/sgi/libnurbs/internals/types.h
	src/glu/sgi/libnurbs/internals/uarray.cc
	src/glu/sgi/libnurbs/internals/uarray.h
	src/glu/sgi/libnurbs/internals/varray.cc
	src/glu/sgi/libnurbs/internals/varray.h
	src/glu/sgi/libnurbs/nurbtess/definitions.h
	src/glu/sgi/libnurbs/nurbtess/directedLine.h
	src/glu/sgi/libnurbs/nurbtess/glimports.h
	src/glu/sgi/libnurbs/nurbtess/gridWrap.cc
	src/glu/sgi/libnurbs/nurbtess/gridWrap.h
	src/glu/sgi/libnurbs/nurbtess/monoChain.cc
	src/glu/sgi/libnurbs/nurbtess/monoChain.h
	src/glu/sgi/libnurbs/nurbtess/monoTriangulation.cc
	src/glu/sgi/libnurbs/nurbtess/monoTriangulation.h
	src/glu/sgi/libnurbs/nurbtess/mystdio.h
	src/glu/sgi/libnurbs/nurbtess/mystdlib.h
	src/glu/sgi/libnurbs/nurbtess/partitionX.cc
	src/glu/sgi/libnurbs/nurbtess/partitionX.h
	src/glu/sgi/libnurbs/nurbtess/partitionY.cc
	src/glu/sgi/libnurbs/nurbtess/partitionY.h
	src/glu/sgi/libnurbs/nurbtess/polyDBG.h
	src/glu/sgi/libnurbs/nurbtess/polyUtil.cc
	src/glu/sgi/libnurbs/nurbtess/polyUtil.h
	src/glu/sgi/libnurbs/nurbtess/primitiveStream.cc
	src/glu/sgi/libnurbs/nurbtess/primitiveStream.h
	src/glu/sgi/libnurbs/nurbtess/quicksort.cc
	src/glu/sgi/libnurbs/nurbtess/quicksort.h
	src/glu/sgi/libnurbs/nurbtess/rectBlock.cc
	src/glu/sgi/libnurbs/nurbtess/rectBlock.h
	src/glu/sgi/libnurbs/nurbtess/sampleComp.cc
	src/glu/sgi/libnurbs/nurbtess/sampleComp.h
	src/glu/sgi/libnurbs/nurbtess/sampleCompBot.cc
	src/glu/sgi/libnurbs/nurbtess/sampleCompBot.h
	src/glu/sgi/libnurbs/nurbtess/sampleCompRight.cc
	src/glu/sgi/libnurbs/nurbtess/sampleCompRight.h
	src/glu/sgi/libnurbs/nurbtess/sampleCompTop.cc
	src/glu/sgi/libnurbs/nurbtess/sampleCompTop.h
	src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.cc
	src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.h
	src/glu/sgi/libnurbs/nurbtess/sampledLine.cc
	src/glu/sgi/libnurbs/nurbtess/sampledLine.h
	src/glu/sgi/libnurbs/nurbtess/searchTree.cc
	src/glu/sgi/libnurbs/nurbtess/searchTree.h
	src/glu/sgi/libnurbs/nurbtess/zlassert.h
	src/glu/sgi/libtess/README
	src/glu/sgi/libtess/alg-outline
	src/glu/sgi/libtess/dict-list.h
	src/glu/sgi/libtess/dict.c
	src/glu/sgi/libtess/dict.h
	src/glu/sgi/libtess/geom.c
	src/glu/sgi/libtess/memalloc.c
	src/glu/sgi/libtess/memalloc.h
	src/glu/sgi/libtess/mesh.c
	src/glu/sgi/libtess/mesh.h
	src/glu/sgi/libtess/normal.h
	src/glu/sgi/libtess/priorityq-heap.c
	src/glu/sgi/libtess/priorityq-heap.h
	src/glu/sgi/libtess/priorityq-sort.h
	src/glu/sgi/libtess/priorityq.c
	src/glu/sgi/libtess/priorityq.h
	src/glu/sgi/libtess/render.c
	src/glu/sgi/libtess/render.h
	src/glu/sgi/libtess/sweep.h
	src/glu/sgi/libtess/tess.h
	src/glu/sgi/libtess/tessmono.c
	src/glu/sgi/libtess/tessmono.h
	src/glu/sgi/libutil/error.c
	src/glu/sgi/libutil/glue.c
	src/glu/sgi/libutil/gluint.h
	src/glu/sgi/libutil/project.c
	src/glu/sgi/libutil/registry.c
	src/glx/x11/glxext.c
	src/mesa/main/imports.h
	src/mesa/tnl/t_vb_cliptmp.h
2007-04-20 05:37:11 +02:00
Brice Goglin
3832ecadae Add 06_fix_texture_data_corruption.patch (closes: #412346) 2007-04-08 18:52:31 +02:00
Brice Goglin
285ed128ab Add a .shlibs file for libglw1-mesa. 2007-04-01 00:44:29 +02:00
Brice Goglin
048144074b Fix conflicts for libGLw packages.
libglw1-mesa does not have to conflict with earlier libgl1-mesa-swx11
(libGLw was only shipped as development libs/headers within swx11-dev).

libglw1-mesa-dev needs to conflicts with libglw-dev.
2007-04-01 00:43:20 +02:00
Brice Goglin
856ae782c7 * Split out libGLw libs and headers from libgl1-mesa-swx11 and ship both
static and shared libraries, creating libglw1-mesa and libglw1-mesa-dev
    (closes: #374904).
2007-03-31 03:28:32 +02:00
Julien Cristau
12e3f97541 Fix explanation about libglide3 in libgl1-mesa-dri's description.
Thanks to Michel Dänzer for his help.
2007-03-30 17:20:02 +02:00
Julien Cristau
30f6fe0710 Have libgl1-mesa-dri suggest libglide3.
Add explanation for this in the package description.  Closes: #387339.
2007-03-30 14:10:24 +02:00
Cyril Brulebois
0aa8f1df3c * Non-maintainer upload.
* Backport a fix from mesa 6.5.2 to mesa 6.5.1 which:
   - fixes braces around the ASSERT macro;
   - fixes a clipping problem, which leads to systematic segfaults of the
     X server (Closes: #405803).
2007-02-23 00:48:40 +01:00
Julien Cristau
d39147a8a1 Fix FTBFS on amd64.
Set LIB_DIR and EXTRA_LIB_PATH in configs/debian-default to override
settings in configs/linux-x86-64. This fixes a FTBFS on amd64, thanks to
Marc 'HE' Brockschmidt for the report (closes: #410118).
2007-02-07 23:13:59 +01:00
Julien Cristau
7991f7e936 * Add myself to Uploaders. 2007-02-04 21:17:18 +01:00
Julien Cristau
10011efcd7 Add bug closer for #409638. 2007-02-04 17:21:57 +01:00
Julien Cristau
0058815c8f Re-add src/glut/mini/ which was deleted by mistake. 2007-02-04 15:21:46 +01:00
Julien Cristau
02048984b7 Delete directories not included in the mesa tarballs. 2007-02-04 15:15:43 +01:00
Julien Cristau
544601e9f4 Fix FTBFS on non-i386 archs.
Build architecture-independant debs in binary-indep, and use the debhelper -s
option for commands in binary-arch, because architectures other than i386
don't have to build libgl1-mesa-swx11-i686.
2007-02-04 14:05:23 +01:00
Julien Cristau
2634f06c20 Merge branch 'upstream-experimental' into debian-experimental
Conflicts:

	progs/util/README
	progs/util/glstate.c
	progs/util/glstate.h
	progs/util/sampleMakefile
	src/glu/sgi/libnurbs/interface/bezierEval.h
	src/glu/sgi/libnurbs/interface/bezierPatch.cc
	src/glu/sgi/libnurbs/interface/bezierPatch.h
	src/glu/sgi/libnurbs/interface/bezierPatchMesh.cc
	src/glu/sgi/libnurbs/interface/bezierPatchMesh.h
	src/glu/sgi/libnurbs/interface/glcurveval.cc
	src/glu/sgi/libnurbs/interface/glimports.h
	src/glu/sgi/libnurbs/interface/glinterface.cc
	src/glu/sgi/libnurbs/interface/glrenderer.h
	src/glu/sgi/libnurbs/interface/incurveeval.cc
	src/glu/sgi/libnurbs/interface/insurfeval.cc
	src/glu/sgi/libnurbs/interface/mystdio.h
	src/glu/sgi/libnurbs/interface/mystdlib.h
	src/glu/sgi/libnurbs/internals/arc.h
	src/glu/sgi/libnurbs/internals/arcsorter.cc
	src/glu/sgi/libnurbs/internals/arcsorter.h
	src/glu/sgi/libnurbs/internals/arctess.h
	src/glu/sgi/libnurbs/internals/backend.cc
	src/glu/sgi/libnurbs/internals/backend.h
	src/glu/sgi/libnurbs/internals/basiccrveval.h
	src/glu/sgi/libnurbs/internals/basicsurfeval.h
	src/glu/sgi/libnurbs/internals/bezierarc.h
	src/glu/sgi/libnurbs/internals/bin.cc
	src/glu/sgi/libnurbs/internals/bin.h
	src/glu/sgi/libnurbs/internals/bufpool.cc
	src/glu/sgi/libnurbs/internals/bufpool.h
	src/glu/sgi/libnurbs/internals/cachingeval.cc
	src/glu/sgi/libnurbs/internals/cachingeval.h
	src/glu/sgi/libnurbs/internals/ccw.cc
	src/glu/sgi/libnurbs/internals/coveandtiler.h
	src/glu/sgi/libnurbs/internals/curve.cc
	src/glu/sgi/libnurbs/internals/curve.h
	src/glu/sgi/libnurbs/internals/curvelist.cc
	src/glu/sgi/libnurbs/internals/curvelist.h
	src/glu/sgi/libnurbs/internals/curvesub.cc
	src/glu/sgi/libnurbs/internals/dataTransform.cc
	src/glu/sgi/libnurbs/internals/dataTransform.h
	src/glu/sgi/libnurbs/internals/defines.h
	src/glu/sgi/libnurbs/internals/displaylist.cc
	src/glu/sgi/libnurbs/internals/displaylist.h
	src/glu/sgi/libnurbs/internals/displaymode.h
	src/glu/sgi/libnurbs/internals/flist.cc
	src/glu/sgi/libnurbs/internals/flist.h
	src/glu/sgi/libnurbs/internals/flistsorter.cc
	src/glu/sgi/libnurbs/internals/flistsorter.h
	src/glu/sgi/libnurbs/internals/gridline.h
	src/glu/sgi/libnurbs/internals/gridtrimvertex.h
	src/glu/sgi/libnurbs/internals/gridvertex.h
	src/glu/sgi/libnurbs/internals/hull.cc
	src/glu/sgi/libnurbs/internals/hull.h
	src/glu/sgi/libnurbs/internals/intersect.cc
	src/glu/sgi/libnurbs/internals/jarcloc.h
	src/glu/sgi/libnurbs/internals/knotvector.h
	src/glu/sgi/libnurbs/internals/mapdesc.cc
	src/glu/sgi/libnurbs/internals/mapdesc.h
	src/glu/sgi/libnurbs/internals/mapdescv.cc
	src/glu/sgi/libnurbs/internals/maplist.cc
	src/glu/sgi/libnurbs/internals/maplist.h
	src/glu/sgi/libnurbs/internals/mesher.cc
	src/glu/sgi/libnurbs/internals/mesher.h
	src/glu/sgi/libnurbs/internals/monoTriangulationBackend.cc
	src/glu/sgi/libnurbs/internals/monotonizer.cc
	src/glu/sgi/libnurbs/internals/monotonizer.h
	src/glu/sgi/libnurbs/internals/myassert.h
	src/glu/sgi/libnurbs/internals/mycode.cc
	src/glu/sgi/libnurbs/internals/mystring.h
	src/glu/sgi/libnurbs/internals/nurbsconsts.h
	src/glu/sgi/libnurbs/internals/nurbstess.cc
	src/glu/sgi/libnurbs/internals/patch.cc
	src/glu/sgi/libnurbs/internals/patch.h
	src/glu/sgi/libnurbs/internals/patchlist.cc
	src/glu/sgi/libnurbs/internals/patchlist.h
	src/glu/sgi/libnurbs/internals/pwlarc.h
	src/glu/sgi/libnurbs/internals/quilt.cc
	src/glu/sgi/libnurbs/internals/quilt.h
	src/glu/sgi/libnurbs/internals/reader.cc
	src/glu/sgi/libnurbs/internals/reader.h
	src/glu/sgi/libnurbs/internals/renderhints.cc
	src/glu/sgi/libnurbs/internals/renderhints.h
	src/glu/sgi/libnurbs/internals/simplemath.h
	src/glu/sgi/libnurbs/internals/slicer.cc
	src/glu/sgi/libnurbs/internals/slicer.h
	src/glu/sgi/libnurbs/internals/sorter.cc
	src/glu/sgi/libnurbs/internals/sorter.h
	src/glu/sgi/libnurbs/internals/splitarcs.cc
	src/glu/sgi/libnurbs/internals/subdivider.h
	src/glu/sgi/libnurbs/internals/tobezier.cc
	src/glu/sgi/libnurbs/internals/trimline.cc
	src/glu/sgi/libnurbs/internals/trimline.h
	src/glu/sgi/libnurbs/internals/trimregion.cc
	src/glu/sgi/libnurbs/internals/trimregion.h
	src/glu/sgi/libnurbs/internals/trimvertex.h
	src/glu/sgi/libnurbs/internals/trimvertpool.cc
	src/glu/sgi/libnurbs/internals/trimvertpool.h
	src/glu/sgi/libnurbs/internals/types.h
	src/glu/sgi/libnurbs/internals/uarray.cc
	src/glu/sgi/libnurbs/internals/uarray.h
	src/glu/sgi/libnurbs/internals/varray.cc
	src/glu/sgi/libnurbs/internals/varray.h
	src/glu/sgi/libnurbs/nurbtess/definitions.h
	src/glu/sgi/libnurbs/nurbtess/directedLine.h
	src/glu/sgi/libnurbs/nurbtess/glimports.h
	src/glu/sgi/libnurbs/nurbtess/gridWrap.cc
	src/glu/sgi/libnurbs/nurbtess/gridWrap.h
	src/glu/sgi/libnurbs/nurbtess/monoChain.cc
	src/glu/sgi/libnurbs/nurbtess/monoChain.h
	src/glu/sgi/libnurbs/nurbtess/monoTriangulation.cc
	src/glu/sgi/libnurbs/nurbtess/monoTriangulation.h
	src/glu/sgi/libnurbs/nurbtess/mystdio.h
	src/glu/sgi/libnurbs/nurbtess/mystdlib.h
	src/glu/sgi/libnurbs/nurbtess/partitionX.cc
	src/glu/sgi/libnurbs/nurbtess/partitionX.h
	src/glu/sgi/libnurbs/nurbtess/partitionY.cc
	src/glu/sgi/libnurbs/nurbtess/partitionY.h
	src/glu/sgi/libnurbs/nurbtess/polyDBG.h
	src/glu/sgi/libnurbs/nurbtess/polyUtil.cc
	src/glu/sgi/libnurbs/nurbtess/polyUtil.h
	src/glu/sgi/libnurbs/nurbtess/primitiveStream.cc
	src/glu/sgi/libnurbs/nurbtess/primitiveStream.h
	src/glu/sgi/libnurbs/nurbtess/quicksort.cc
	src/glu/sgi/libnurbs/nurbtess/quicksort.h
	src/glu/sgi/libnurbs/nurbtess/rectBlock.cc
	src/glu/sgi/libnurbs/nurbtess/rectBlock.h
	src/glu/sgi/libnurbs/nurbtess/sampleComp.cc
	src/glu/sgi/libnurbs/nurbtess/sampleComp.h
	src/glu/sgi/libnurbs/nurbtess/sampleCompBot.cc
	src/glu/sgi/libnurbs/nurbtess/sampleCompBot.h
	src/glu/sgi/libnurbs/nurbtess/sampleCompRight.cc
	src/glu/sgi/libnurbs/nurbtess/sampleCompRight.h
	src/glu/sgi/libnurbs/nurbtess/sampleCompTop.cc
	src/glu/sgi/libnurbs/nurbtess/sampleCompTop.h
	src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.cc
	src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.h
	src/glu/sgi/libnurbs/nurbtess/sampledLine.cc
	src/glu/sgi/libnurbs/nurbtess/sampledLine.h
	src/glu/sgi/libnurbs/nurbtess/searchTree.cc
	src/glu/sgi/libnurbs/nurbtess/searchTree.h
	src/glu/sgi/libnurbs/nurbtess/zlassert.h
	src/glu/sgi/libtess/README
	src/glu/sgi/libtess/alg-outline
	src/glu/sgi/libtess/dict-list.h
	src/glu/sgi/libtess/dict.c
	src/glu/sgi/libtess/dict.h
	src/glu/sgi/libtess/geom.c
	src/glu/sgi/libtess/memalloc.c
	src/glu/sgi/libtess/memalloc.h
	src/glu/sgi/libtess/mesh.c
	src/glu/sgi/libtess/mesh.h
	src/glu/sgi/libtess/normal.h
	src/glu/sgi/libtess/priorityq-heap.c
	src/glu/sgi/libtess/priorityq-heap.h
	src/glu/sgi/libtess/priorityq-sort.h
	src/glu/sgi/libtess/priorityq.c
	src/glu/sgi/libtess/priorityq.h
	src/glu/sgi/libtess/render.c
	src/glu/sgi/libtess/render.h
	src/glu/sgi/libtess/sweep.h
	src/glu/sgi/libtess/tess.h
	src/glu/sgi/libtess/tessmono.c
	src/glu/sgi/libtess/tessmono.h
	src/glu/sgi/libutil/error.c
	src/glu/sgi/libutil/glue.c
	src/glu/sgi/libutil/gluint.h
	src/glu/sgi/libutil/project.c
	src/glu/sgi/libutil/registry.c
2007-02-01 11:50:36 +01:00
Julien Cristau
7549426a16 Sync Section and Priority for all packages with the override. 2007-01-28 18:18:38 +01:00
Thierry Reding
6dcb9a3434 Give credit where credit is due. 2007-01-11 15:09:23 +01:00
Thierry Reding
e5a31c00ec libosmesa6{,-dev} replace libgl1-mesa-swx11{,-dev} and mesa-common-dev.
libosmesa6 and libosmesa6-dev are now the only packages to contain OSMesa
libraries and header files so they can be installed independent of which libGL
is installed. They statically link in the software rasterization code.
2007-01-11 15:06:42 +01:00
Thierry Reding
00295242fd mesa-common-dev needs to replace libgl1-mesa-swx11-dev and libgl1-mesa-dev.
The GLX headers were previously shipped in both packages and have been moved
to mesa-common-dev.
2007-01-11 14:56:48 +01:00
Thierry Reding
21b6ed7c29 Build the DRI modules with the default optimization flags. 2007-01-11 14:40:10 +01:00
Thierry Reding
01894cbf10 Revert the previous changes to the libgl1-mesa-{glx,swx11} shlibs. 2007-01-10 15:23:29 +01:00
Thierry Reding
28cad2b9d9 Bump libgl1-mesa-glx, libgl1-mesa-swx11 and libosmesa6 shlibs files. 2007-01-10 13:55:19 +01:00
Thierry Reding
71d7b7dbe7 Drop noop line. 2007-01-08 13:36:25 +01:00
Thierry Reding
4563723db1 Make sure all files in the mesa-swx11-source package have permissions 0644. 2007-01-08 13:36:16 +01:00
Thierry Reding
0bce6a1899 Compile with -O2 optimization instead of -O3 which might lead to problems. 2007-01-08 11:43:25 +01:00
Thierry Reding
e71d6dbd9c Make debugging symbol packages depend on the corresponding binary package and
put them into the libdevel section.
2007-01-08 11:41:02 +01:00
Thierry Reding
132ecd19f3 Do not build any linux*-static configuration with -fPIC. 2007-01-08 10:07:08 +01:00
Thierry Reding
a404143f4c Add patches 04_cleanup-osmesa-configs and 05_static-nonpic.
04_cleanup-osmesa-configs makes the OSMesa configurations behave as expected.
That is respect the OPT_FLAGS, PIC_FLAGS, ARCH_FLAGS and DEFINES variables.
The patch also makes the files more consistent by inheriting from more general
configurations.

05_static-nonpic fixes the linux-static configuration to not use -fPIC for
compiling code because it would violate Debian policy.
2007-01-08 08:35:42 +01:00
Julien Cristau
44467ca45e * Drop obsolete depends on xlibs. 2007-01-05 15:44:51 +01:00
Julien Cristau
f70ea0747d Import changelog entry from the 6.5.1-0.5 NMU. 2007-01-04 21:30:49 +01:00
Thierry Reding
c619abf18a Hijack the package (set XSF as maintainer, add myself to uploaders). \o/ 2007-01-04 16:35:14 +01:00
Julien Cristau
6da1323437 * Non-maintainer upload.
* Build with -fno-strict-aliasing to fix misbuild of i965_dri.so
  (closes: #394311).  Thanks to Michel Dänzer for the fix, and to Ryan
  Richter for the report and testing.
2007-01-03 16:59:06 +01:00
Julien Cristau
1dd29785cf Import changes from the mesa 6.5.1-0.4 NMU. 2007-01-03 13:43:46 +01:00
Julien Cristau
5681987ee4 Import changes from the mesa 6.5.1-0.3 NMU. 2007-01-03 13:41:57 +01:00
Thierry Reding
6eeb18fc68 Build the i915tex DRI module on the i386 and amd64 architectures. 2006-12-05 00:45:42 +00:00
Thierry Reding
01c90575b4 Add missing changelog entry and bug closer. 2006-12-04 07:23:14 +00:00
Thierry Reding
32e9cb0275 Update to new upstream release (6.5.2). 2006-12-02 23:46:07 +00:00
Thierry Reding
017bade93c Update to latest upstream release candidate (6.5.2 RC3). 2006-12-01 00:16:33 +00:00
Thierry Reding
c9c79e7cae Add manpages to the mesa-utils package. 2006-11-29 18:07:26 +00:00
Thierry Reding
777d41dd07 Mark the latest changelog entries as NMUs. 2006-11-26 02:40:01 +00:00
Thierry Reding
6238c30913 Revert maintainer and uploaders fields. Integrate latest NMUs into the
changelog and be a little more verbose in the debian/rules rewrite
changelog entries.
2006-11-26 02:38:31 +00:00
Thierry Reding
db164ab514 Update to latest upstream release candidate. 2006-11-22 19:50:34 +00:00
Thierry Reding
c72ef17731 Add libOSMesa16 and libOSMesa32 entries to libosmesa6.shlibs so packages
linking against those libraries will get the correct dependencies.
2006-11-22 19:47:56 +00:00
Thierry Reding
8dbee7867f Use the new upstream minstall utility to install files and directories. Using
/usr/bin/install would result in a symlink's target being copied instead of
the symlink.
2006-11-18 21:28:07 +00:00
Thierry Reding
f403108f5f Fix typo in changelog. libdrm2-dev is not a package. 2006-11-18 21:22:52 +00:00
Thierry Reding
223a97f92a Bump build-dependency on libdrm-dev (>= 2.2.0). 2006-11-18 21:21:18 +00:00
Thierry Reding
bb44a8ae1f Update to latest upstream release candidate.
Update patches.
2006-11-18 17:59:25 +00:00
Thierry Reding
b5a5062176 Target the mesa package at experimental until etch is released. 2006-11-18 17:50:44 +00:00
Thierry Reding
50faa32ce3 Move the code to choose which configurations to build to a separate script in
order to keep debian/rules cleaner.
2006-11-10 09:00:00 +00:00
Thierry Reding
b6caed527c Also add release notes of version 6.5.1 and the release notes index. 2006-11-10 08:50:35 +00:00
Thierry Reding
d5ef77353b Build Mesa utility programs (glxdemo, glxgears, glxheads, glxinfo) together
with the DRI/GLX-enabled libGL. Don't build the utilities on CPU-optimized
configurations.
2006-11-10 08:40:03 +00:00
Thierry Reding
336beba81b Update Debian changelog. 2006-11-02 21:20:33 +00:00
Thierry Reding
5d23a7905c Add code to provide a mesa-utils package since those utilities are shipped in
the MesaDemos tarball.
2006-11-02 21:05:29 +00:00
Thierry Reding
143dfcc904 Make mesa-common-dev depend on libx11-dev to provide Xlib.h and Xutil.h needed
by the GLX headers.
2006-11-01 07:54:40 +00:00
Thierry Reding
e076cd42f0 Bug #387706 should also be closed because we move libOSMesa to libosmesa6 and
statically link in the software rasterization code.
2006-10-25 00:17:42 +00:00
Thierry Reding
5bed38974e Close 392715 because we now ship the contents of the three Mesa tarballs in
the original source.
2006-10-24 14:45:18 +00:00
Thierry Reding
35bc4b82ff Since the original tarball is repackaged to include the three upstream
tarballs (MesaDemos, MesaGLUT and MesaLib), remove files that are not supposed
to be there.

Note that when importing initially, some files were not even added to the SVN
repository because SVN ignored them. These were configs/diffs~ and
docs/RELNOTES-6.1~. I removed those from the tarball as well.
2006-10-24 14:33:30 +00:00
Thierry Reding
4e5d870f72 Make libosmesa6-dev binNMU-safe again (mesa-common-dev is Architecture: all). 2006-10-24 14:29:11 +00:00
Thierry Reding
83def94db5 Make libgl1-mesa-dev Architecture: all, because all we ship with it is a
symbolic link. Make it binNMU-safe by making it depend on libgl1-mesa-glx and
libgl1-mesa-dri both >= ${Source-Version} instead of exact versions.

Add packages containing debugging symbols for libgl1-mesa-swx11,
libgl1-mesa-glx and libgl1-mesa-dri.
2006-10-24 12:16:16 +00:00
Thierry Reding
9d74c1ef2a -fno-strict-aliasing actually *does* fix #394311 according to the submitter. 2006-10-24 10:31:28 +00:00
Thierry Reding
6023d4bdb5 Build with -fno-strict-aliasing, which should fix bug #394311. 2006-10-24 10:29:21 +00:00
Thierry Reding
5e38f566f2 Provide libgl-dev as alternative to the mesa-common-dev dependency of the
libosmesa6-dev package.
2006-10-23 16:45:00 +00:00
Thierry Reding
b57341a78b Move the glx*.h headers from libgl1-mesa(-swx11)-dev into mesa-common-dev
because both packages provide identical files.
2006-10-23 16:43:41 +00:00
Thierry Reding
910c32c0e9 Install the osmesa.h header in the libosmesa6-dev package where it belongs,
now that all OSMesa libraries have been split off into libosmesa6{,-dev}.

Don't make libosmesa6-dev depend on libgl1-mesa-swx11-dev anymore because it
no longer needs a libGL, only the gl.h header provided by mesa-common-dev.
2006-10-23 16:02:22 +00:00
Thierry Reding
e49456d8d8 Don't force -fPIC everywhere, because it seems only unused on x86 which we
build with assembler optimizations by default, resulting in non-PIC libraries
anyway.
2006-10-23 14:40:10 +00:00
Thierry Reding
c46becc9b3 Move the libOSMesa shlibs entry from libgl1-mesa-swx11 to libosmesa6 because
that's where libOSMesa is now installed.
2006-10-23 08:30:53 +00:00
Thierry Reding
b6e637106f Add the static libGLw and the corresponding headers to the
libgl1-mesa-swx11-dev package again.
2006-10-23 08:23:27 +00:00
Thierry Reding
787cffe3d0 Always force -fPIC. 2006-10-23 08:22:25 +00:00
Thierry Reding
9d914e6809 Make sure the install-source.sh script is executable before trying to run it. 2006-10-20 20:56:41 +00:00
Thierry Reding
4e183c66e9 Add comments to patches and enable the previously disabled patches. 2006-10-20 19:41:00 +00:00
Thierry Reding
b1630fcbe8 Add build-dependency on lesstif2-dev needed to build the GLw libraries. 2006-10-20 19:17:34 +00:00
Thierry Reding
cd44f730cc Enable building the GLw libraries. 2006-10-20 19:07:36 +00:00
Thierry Reding
ce5a39559e Install several documents from the docs subdirectory into the mesa-common-dev
package.
2006-10-20 17:51:36 +00:00
Thierry Reding
ccffaef603 Build architecture-specific static libraries where available. 2006-10-20 12:15:29 +00:00
Thierry Reding
ae41f3a3ee Don't make libgl1-mesa-swx11-dev depend on lesstif2-dev anymore because we
don't ship anything related to LessTif in that package.
2006-10-20 12:06:20 +00:00
Thierry Reding
c7e576d6bf No longer install the default build of libOSMesa in the libgl1-mesa-swx11
package, but in the libosmesa6 package.

Modify the 01_fix-makefile patch to not build libOSMesa on stand-alone builds,
so that it is only created when building OSMesa explicitly.

Build libOSMesa with 8 bits per color channel (the default) in dynamic and
static versions separately from the software rasterization libGL with the
software rasterization code linked in statically so that libOSMesa can run in
parallel with any libGL. This should fix the problem Yann Dirson mentioned a
while ago.

Use the install-source.sh script to install the Mesa sources needed for the
mesa-swx11-source package instead of doing it in the debian/rules file itself.
2006-10-20 07:56:11 +00:00
Thierry Reding
f069b2812e Add a set of files to enable an i686 optimized build of the DRI/GLX-enabled
libGL and the DRI drivers. Disabled for now.
2006-10-20 07:47:37 +00:00
Thierry Reding
f20ff6213e Add a shell script to install the Mesa sources for the mesa-swx11-source
package.
2006-10-20 07:45:39 +00:00
Thierry Reding
24ff74bdcb Add configurations to build static versions of the default OSMesa library.
In all Debian-specific configurations, include the Debian defaults
configuration after the Mesa configurations and drop the 'override' for all
variables because it is no longer needed.
2006-10-20 07:43:50 +00:00
Thierry Reding
230e79916f Merge in the old Debian changelog entries and the old copyright file. 2006-10-17 19:35:35 +00:00
Thierry Reding
9f14b4db35 Use -march in favor of the deprecated -mcpu. 2006-10-17 19:13:27 +00:00
Thierry Reding
ec916398e7 Don't install libOSMesa development files in the libgl1-mesa-swx11 package. 2006-10-16 14:43:43 +00:00
Thierry Reding
6befad112e Actually do rename debian-static to debian-swx11+glu-static. 2006-10-16 13:54:24 +00:00
Thierry Reding
55ce23b8db Beautify IEEE floating point patch. 2006-10-16 13:34:57 +00:00
Thierry Reding
1292ec1ecf Fix typo in the filename of the IEEE FP on s390 and m68k patch. 2006-10-16 13:11:51 +00:00
Thierry Reding
65a324062f Add patches extracted from older Debian diffs but not applied yet because it's
not certain yet that they are needed.
2006-10-16 13:05:42 +00:00
Thierry Reding
c9db617e0b Make the debian-static a subclass of debian-swx11+glu-default, because that's
what it actually is. Rename it accordingly and add it to SWX11_GLU_CONFIGS.

Install the libOSMesa.so symlink and the libOSMesa static library in the
libgl1-mesa-swx11-dev package.

Add .shlibs files for the libgl1-mesa-swx11, libgl1-mesa-glx and libglu1-mesa
packages.
2006-10-16 13:04:29 +00:00
Thierry Reding
b43137d0cc Build libGLU by default for swx11+glu configurations but not in the
configurations targetting specific CPU's because it is unlikely to result in
an increase in performance.
2006-10-16 11:53:06 +00:00
Thierry Reding
eeca642778 Add versioned build-dependency on dpkg-dev (>= 1.13.19) to make sure the
binary:Version and source:Version substitution variables can be used.
2006-10-16 11:49:46 +00:00
Thierry Reding
5cef6ca36a Move the detection of architecture-specific configurations to the debian/rules
file.

Add the configs target to debian/rules for checking whether the correct
configurations will be built.
2006-10-16 10:03:32 +00:00
Thierry Reding
be2b518f7b Also build a static version of libGLU. 2006-10-16 09:53:30 +00:00
Thierry Reding
1b0d29afbc Rename the CPU optimization configurations to make it clear that they only
build swx11 and GLU.

Build architecture-optimized swx11 and GLU where possible.
2006-10-16 09:39:59 +00:00
Thierry Reding
55cf480c0b Drop the libgl1-mesa-swx11-dbg package until there's a decision as to whether
it is really needed.

Allow more than one type of optimization libraries to be built for any given
architecture. Currently optimization configurations are provided for i386
[i686], alpha [ev5], amd64, powerpc [603], ppc64 and sparc [ultrasparc].
However, only i686 and amd64 are enabled for now for safety.

Add the libgl1-mesa-swx11-i686 for i686 optimized libraries.

Drop the debian-common configuration because it is no longer used.

Don't build libGLU in all configurations, only when needed.
2006-10-16 08:58:05 +00:00
Thierry Reding
84db6912f0 Add missing build-dependencies. 2006-10-15 18:02:33 +00:00
Thierry Reding
7495cc28a0 Only build the i810, i915, i965, sis and unichrome DRI drivers on i386 and
amd64.

Only build the ffb DRI driver on sparc.
2006-10-15 16:17:53 +00:00
Thierry Reding
87744f786b Use STAMP_DIR consistently throughout the debian/rules file.
Make the BUILD_STAMPS targets depend on patch so that when they are built
separately the patches will also be applied. Thanks to Michel Dänzer for
catching this.

Make symlinking the source tree idempotent by adding the -f option to cp.
Thanks again Michel Dänzer.
2006-10-15 14:41:12 +00:00
Thierry Reding
5bcfa4c859 Build only optimized versions of the DRI drivers, only using no optimizations
when not supported.

Add configuration to build the DRI drivers on amd64.
2006-10-15 13:30:22 +00:00
Thierry Reding
8ef731bcd1 Add a patch (00_create-libdir) that fixes the upstream build system to make
sure the LIB_DIR is created or bail out.

Update the 01_fix-makefile patch to only install libGL/libOSMesa if they
exist. Don't make installation dependent on which drivers are built.

Build optimized versions of the swx11 libraries in addition to those that
should work on the least-capable supported processor for the given
architecture.

Have most configurations include debian-default instead of debian-common so
that INSTALL_DIR is correctly defined. debian-common can probably be dropped
anyway.
2006-10-15 13:15:56 +00:00
Thierry Reding
8d02f3c68a Add patch to fix upstream build system to correctly install libOSMesa and
variants. This patch also fixes the build system not to install libGL if only
the OSMesa library is built.

Update *.install files to install more files. Pretty much everything except
debugging and optimized libraries is now built and installed.

Enable building static libraries for inclusion in the -dev packages.
2006-10-15 00:49:41 +00:00
Thierry Reding
b1f8b49e8b Add build-dependency on quilt.
Remove shlibs:Depends substitution variable from -dev packages, which doesn't
make sense.
2006-10-15 00:42:25 +00:00
David Nusinow
75733e4237 Commit diff of 6.5.1-0.2 so we've got a record of it here. 2006-10-14 22:42:57 +00:00
Thierry Reding
6e318e2cd1 Base the Debian OSMesa configurations on linux-osmesa* provided upstream.
Add a configuration for building a static version of OSMesa with 32 bits per
color channel.
2006-10-14 17:04:02 +00:00
Thierry Reding
01e6b84b14 Fix some small inconsistencies involving configuration names. 2006-10-14 16:32:25 +00:00
Thierry Reding
69705d22be Rename the debian-dri-common configuration to debian-dri-default, to make it
consistent with the naming scheme of debian-default.
2006-10-14 16:29:32 +00:00
Thierry Reding
b16d1dcff5 Add a default Debian-specific configuration which overrides settings from the
default Mesa configuration.
2006-10-14 16:28:45 +00:00
Thierry Reding
10c5b5d5ba Comment the Debian-specific configurations. 2006-10-14 16:25:30 +00:00
Thierry Reding
d9c5c170f6 Rename the -default configurations to -any, which is a more appropriate name. 2006-10-14 15:44:15 +00:00
Thierry Reding
32c7138d86 Move the debian/debian-dri configurations to debian-default/debian-dri-default
respectively, and use debian/debian-dri to choose an architecture specific
configuration.
2006-10-14 15:42:59 +00:00
Thierry Reding
d29244d872 Add OSMesa configurations and made fixed several issues here and there. 2006-10-14 15:11:31 +00:00
Thierry Reding
0fca6eda1e Initial version of a new build system for Mesa. 2006-10-14 04:33:41 +00:00
Thierry Reding
1ddf606332 Import Mesa 6.5.1 (MesaLib, MesaDemos, MesaGLUT). 2006-10-14 03:46:41 +00:00
David Nusinow
bc8084da74 Fix goofed patch from before 2006-09-26 01:36:37 +00:00
David Nusinow
5eed400862 Prepare changelog for release 2006-09-26 01:21:59 +00:00
David Nusinow
a37a0959ac * Add patch from Cyril Brulebois to allow package to build on HURD, which
lacks DRI and directfb. This includes not using lib-directfb in the
  build-depends for hurd-i386. It also creates a new debian config,
  debian-indirect, which is used when building for HURD. This config is
  invoked in the debian-dri config on hurd-i386. Thanks to Cyril Brulebois
  for the patch, Michael Banck, Michel Dänzer, and Samuel Thibault for
  input on an appropriate fix. (closes: #358065)
2006-09-26 00:46:14 +00:00
David Nusinow
53845c52e5 * Re-add s390 and m68k to the USE_IEEE test in src/mesa/main/imports.h. This
package seriously needs to store patches somewhere that are easy to find
  and re-apply.
2006-09-26 00:32:06 +00:00
David Nusinow
d429f0b14f * Make sure that libGl looks for the dri drivers in the proper location. Do
this by setting the appropriate variables in the debian config
2006-09-25 02:57:24 +00:00
David Nusinow
02339187ad * Stuff not in the upstream tarballs
* Bump libdrm-dev build-dep to >= 2.0.2
* Add libdrm cflags to the debian-dri config. This allows the build system
  to find drm.h
2006-09-24 22:55:41 +00:00
David Nusinow
827f778525 * Stuff not in the upstream tarballs
+ os2 glut stuff
  + docs/gears.png
2006-09-24 21:54:25 +00:00
David Nusinow
d3fc85eea9 Remove os2 glut stuff. It's not in the tarballs 2006-09-24 21:50:01 +00:00
David Nusinow
9a62963129 Add glut 2006-09-24 21:40:02 +00:00
David Nusinow
a0b2543ba1 Add mesa demos 2006-09-24 21:29:21 +00:00
David Nusinow
387acaac69 * New upstream version 2006-09-24 21:21:15 +00:00
David Nusinow
952b775dbe Rename mesa dir 2006-09-24 21:18:17 +00:00
David Nusinow
eadb76b3f8 Bump to latest mesa in Debian 2006-09-24 21:11:46 +00:00
Steve Langasek
b3f7313ae4 Nuke the directory for an obsolete version of mesa -- no reason to merge
it anywhere, it's already superseded
2006-09-18 23:49:49 +00:00
David Nusinow
0c97d48027 * Install the glx sources with the rest in the sources package. This will
allow building of Xgl
2006-04-08 18:28:29 +00:00
David Nusinow
c4a678de9e Update source package install file, change version number to match reality, and note NMU in changelog 2006-04-07 06:36:53 +00:00
David Nusinow
2c834f4d29 * Don't build now non-existant i830 driver in debian dri configs. Fixes
FTBFS.
2006-04-07 03:11:47 +00:00
David Nusinow
b93d290c9f * Remove set_buffer function from idirectfbgl_mesa.c in directfb driver.
Also remove the line that sets SetBuffer to it. Fixes FTBFS.
2006-04-07 02:22:22 +00:00
David Nusinow
32266bb21a * Re-Add s390 and m68k to the USE_IEEE test in src/mesa/main/imports.h.
I need to submit this upstream.
2006-04-07 01:50:23 +00:00
David Nusinow
cab39103b7 * Increment libdrm-dev build-dep to 2.0.1 2006-04-07 00:38:00 +00:00
David Nusinow
5c56a80ac9 Copy over Debian packaging from 6.4.1 2006-04-07 00:35:30 +00:00
David Nusinow
d0bac31721 Copy vendor drop of Mesa 6.5 over to working branch 2006-04-07 00:30:49 +00:00
David Nusinow
9258e54cfa Move incorrect vendor drop of Mesa 6.5 2006-04-07 00:29:08 +00:00
David Nusinow
ccb68495e0 Vendor drop of Mesa 6.5 2006-04-07 00:24:21 +00:00
David Nusinow
db4236fe0b * Add versioned conflict between libgl1-mesa-dri and xlibmesa-dri so that
the xlibmesa-dri transitional upgrade package works
2006-03-07 02:48:44 +00:00
David Nusinow
a4e43427f8 * Move compatibility packages to the xorg source package. The versioning on
these packages will be too low without an epoch and they definitely fit
  with the xorg package anyway.
2006-02-24 05:43:01 +00:00
David Nusinow
829190abdd * Provide compatibility packages for the Xorg 6.9 mesa packages. This
package will be the only source of mesa packages in Debian for the
  present, and these packages will provide for smooth upgrades and
  compatibility.
2006-02-22 03:22:26 +00:00
David Nusinow
99688cd051 Add m68k to previous fix to fix its FTBFS also 2006-02-11 23:00:27 +00:00
David Nusinow
1ba0a92702 * Add s390 to the USE_IEEE test in src/mesa/main/imports.h.
(closes: #349437)
2006-02-09 01:24:52 +00:00
David Nusinow
065d5a8d17 * Remove makedepend from build-depends. Now we'll just build-dep on xutils
to get the app, which will translate over to our own xorg 7.0 plans.
2006-02-01 00:22:24 +00:00
David Nusinow
3b53c0ac19 * Re-add dh_installdirs call to binary-indep target so that we get
arch-specific dirs for the mesa-swx11-source package
2006-01-30 04:02:11 +00:00
David Nusinow
ed56fe4e82 * mesa-swrast-src.install stop looking for the swx11 dir and look for swrast 2006-01-22 19:50:19 +00:00
David Nusinow
1fbbe807ed Make libglu1-mesa default to depending on libgl1-mesa-glx. Thanks Michel Dänzer for catching this one. 2006-01-22 00:07:07 +00:00
David Nusinow
c3dccfa05b Use appropriate version number for an NMU. Thanks Julien for catching this one 2006-01-21 23:40:34 +00:00
David Nusinow
7703d9293f Incorporate other NMU for xlibs-dev transition 2006-01-21 23:32:52 +00:00
David Nusinow
bcf560e4b8 * Change libgl1-mesa to be named libgl1-mesa-glx 2006-01-19 23:45:36 +00:00
David Nusinow
9d944b501a * Change libgl1-mesa-swrast to be named libgl1-mesa-swx11 2006-01-16 22:19:03 +00:00
David Nusinow
cf013a5384 Add more closers 2006-01-11 04:10:39 +00:00
David Nusinow
2f367491c4 Add closer 2006-01-11 04:00:15 +00:00
David Nusinow
e7d93b62ec * Change libgl1-mesa-swrast Depends on libx11-6-dev to libx11-dev.
(closes: #347205)
* Add closer for packaging new upstream
2006-01-11 03:48:31 +00:00
David Nusinow
a5b309c0c9 Document that we'll be NMU'ing this for modular work 2006-01-06 03:09:12 +00:00
David Nusinow
df46b96ab0 Re-add mesa-6.4.1 which was accidentally deleted 2006-01-03 05:15:27 +00:00
David Nusinow
bda1e332ce Update libs to 7.0 release with packaging 2005-12-30 20:12:45 +00:00
David Nusinow
53b2ad5fd0 Rename mesa lib dir to appropriate version 2005-12-16 04:04:38 +00:00
David Nusinow
b44d9c657d Changelog version bump 2005-12-16 04:03:27 +00:00
David Nusinow
92ef7527d1 * New upstream version (6.4.1)
* Merge changes from Ubuntu version 6.4.1-0ubuntu1
  + Add new files required by xorg-server GL build to mesa-swrast-source.
2005-12-14 01:43:13 +00:00
David Nusinow
c37d6b4ca8 Commit Mesa 6.4 sources and packaging 2005-11-09 02:46:07 +00:00
2195 changed files with 354849 additions and 256207 deletions

184239
ChangeLog Normal file

File diff suppressed because it is too large Load Diff

View File

@@ -182,7 +182,7 @@ ultrix-gcc:
# Rules for making release tarballs
VERSION=7.5.2
VERSION=7.6.1
DIRECTORY = Mesa-$(VERSION)
LIB_NAME = MesaLib-$(VERSION)
DEMO_NAME = MesaDemos-$(VERSION)
@@ -237,7 +237,8 @@ MAIN_FILES = \
$(DIRECTORY)/src/mesa/glapi/*.[chS] \
$(DIRECTORY)/src/mesa/math/*.[ch] \
$(DIRECTORY)/src/mesa/math/descrip.mms \
$(DIRECTORY)/src/mesa/shader/*.[ch] \
$(DIRECTORY)/src/mesa/shader/*.[chly] \
$(DIRECTORY)/src/mesa/shader/Makefile \
$(DIRECTORY)/src/mesa/shader/descrip.mms \
$(DIRECTORY)/src/mesa/shader/grammar/*.[ch] \
$(DIRECTORY)/src/mesa/shader/slang/*.[ch] \
@@ -324,6 +325,7 @@ GALLIUM_FILES = \
$(DIRECTORY)/src/gallium/*/*/SConscript \
$(DIRECTORY)/src/gallium/*/*/*.[ch] \
$(DIRECTORY)/src/gallium/*/*/*.py \
$(DIRECTORY)/src/gallium/*/*/*.csv \
$(DIRECTORY)/src/gallium/*/*/*/Makefile \
$(DIRECTORY)/src/gallium/*/*/*/SConscript \
$(DIRECTORY)/src/gallium/*/*/*/*.[ch] \
@@ -345,7 +347,9 @@ DRI_FILES = \
$(DIRECTORY)/src/mesa/drivers/dri/common/xmlpool/*.[ch] \
$(DIRECTORY)/src/mesa/drivers/dri/common/xmlpool/*.po \
$(DIRECTORY)/src/mesa/drivers/dri/*/*.[chS] \
$(DIRECTORY)/src/mesa/drivers/dri/*/*/*.[chS] \
$(DIRECTORY)/src/mesa/drivers/dri/*/Makefile \
$(DIRECTORY)/src/mesa/drivers/dri/*/*/Makefile \
$(DIRECTORY)/src/mesa/drivers/dri/*/Doxyfile \
$(DIRECTORY)/src/mesa/drivers/dri/*/server/*.[ch]
@@ -425,11 +429,11 @@ DEMO_FILES = \
$(DIRECTORY)/progs/glsl/*.c \
$(DIRECTORY)/progs/glsl/*.frag \
$(DIRECTORY)/progs/glsl/*.vert \
$(DIRECTORY)/progs/glsl/*.shtest \
$(DIRECTORY)/progs/windml/Makefile.ugl \
$(DIRECTORY)/progs/windml/*.c \
$(DIRECTORY)/progs/windml/*.bmp \
$(DIRECTORY)/progs/ggi/*.c \
$(DIRECTORY)/windows/VC7/progs/progs.sln
$(DIRECTORY)/progs/ggi/*.c
GLUT_FILES = \
$(DIRECTORY)/include/GL/glut.h \
@@ -452,9 +456,7 @@ GLUT_FILES = \
$(DIRECTORY)/src/glut/mini/glut.pc.in \
$(DIRECTORY)/src/glut/directfb/Makefile \
$(DIRECTORY)/src/glut/directfb/NOTES \
$(DIRECTORY)/src/glut/directfb/*[ch] \
$(DIRECTORY)/windows/VC6/progs/glut/glut.dsp \
$(DIRECTORY)/windows/VC7/progs/glut/glut.vcproj
$(DIRECTORY)/src/glut/directfb/*[ch]
DEPEND_FILES = \
$(TOP)/src/mesa/depend \

View File

@@ -32,10 +32,10 @@ import common
default_statetrackers = 'mesa'
if common.default_platform in ('linux', 'freebsd', 'darwin'):
default_drivers = 'softpipe,failover,i915simple,trace'
default_drivers = 'softpipe,failover,i915simple,trace,identity,llvmpipe'
default_winsys = 'xlib'
elif common.default_platform in ('winddk',):
default_drivers = 'softpipe,i915simple,trace'
default_drivers = 'softpipe,i915simple,trace,identity'
default_winsys = 'all'
else:
default_drivers = 'all'
@@ -44,9 +44,9 @@ else:
opts = Variables('config.py')
common.AddOptions(opts)
opts.Add(ListVariable('statetrackers', 'state trackers to build', default_statetrackers,
['mesa', 'python']))
['mesa', 'python', 'xorg']))
opts.Add(ListVariable('drivers', 'pipe drivers to build', default_drivers,
['softpipe', 'failover', 'i915simple', 'i965simple', 'cell', 'trace', 'r300']))
['softpipe', 'failover', 'i915simple', 'i965simple', 'cell', 'trace', 'r300', 'identity', 'llvmpipe']))
opts.Add(ListVariable('winsys', 'winsys drivers to build', default_winsys,
['xlib', 'intel', 'gdi', 'radeon']))

View File

@@ -59,7 +59,7 @@ def AddOptions(opts):
opts.Add(EnumOption('machine', 'use machine-specific assembly code', default_machine,
allowed_values=('generic', 'ppc', 'x86', 'x86_64')))
opts.Add(EnumOption('platform', 'target platform', default_platform,
allowed_values=('linux', 'cell', 'windows', 'winddk', 'wince')))
allowed_values=('linux', 'cell', 'windows', 'winddk', 'wince', 'darwin')))
opts.Add(EnumOption('toolchain', 'compiler toolchain', 'default',
allowed_values=('default', 'crossmingw', 'winsdk', 'winddk')))
opts.Add(BoolOption('llvm', 'use LLVM', 'no'))

View File

@@ -20,6 +20,8 @@ CXXFLAGS = @CPPFLAGS@ @CXXFLAGS@ \
$(OPT_FLAGS) $(PIC_FLAGS) $(ARCH_FLAGS) $(DEFINES)
LDFLAGS = @LDFLAGS@
EXTRA_LIB_PATH = @EXTRA_LIB_PATH@
RADEON_CFLAGS = @RADEON_CFLAGS@
RADEON_LDFLAGS = @RADEON_LDFLAGS@
# Assembler
MESA_ASM_SOURCES = @MESA_ASM_SOURCES@
@@ -31,6 +33,7 @@ SHELL = @SHELL@
MKLIB_OPTIONS = @MKLIB_OPTIONS@
MKDEP = @MKDEP@
MKDEP_OPTIONS = @MKDEP_OPTIONS@
INSTALL = @INSTALL@
# Python and flags (generally only needed by the developers)
PYTHON2 = python
@@ -121,7 +124,7 @@ INSTALL_INC_DIR = $(includedir)
DRI_DRIVER_INSTALL_DIR = @DRI_DRIVER_INSTALL_DIR@
# Where libGL will look for DRI hardware drivers
DRI_DRIVER_SEARCH_DIR = $(DRI_DRIVER_INSTALL_DIR)
DRI_DRIVER_SEARCH_DIR = @DRI_DRIVER_SEARCH_DIR@
# Xorg driver install directory (for xorg state-tracker)
XORG_DRIVER_INSTALL_DIR = @XORG_DRIVER_INSTALL_DIR@

View File

@@ -10,7 +10,7 @@ X11_DIR = $(INSTALL_DIR)
# Compiler and flags
CC = gcc
CXX = gcc
CXX = g++
PIC_FLAGS = -fPIC
DEFINES = -D_DARWIN_C_SOURCE -D_POSIX_SOURCE -D_POSIX_C_SOURCE=199309L \
-D_BSD_SOURCE -D_SVID_SOURCE -D_GNU_SOURCE -DPTHREADS \

View File

@@ -9,8 +9,8 @@ CONFIG_NAME = default
# Version info
MESA_MAJOR=7
MESA_MINOR=5
MESA_TINY=2
MESA_MINOR=6
MESA_TINY=1
MESA_VERSION = $(MESA_MAJOR).$(MESA_MINOR).$(MESA_TINY)
# external projects. This should be useless now that we use libdrm.
@@ -37,7 +37,10 @@ MKLIB_OPTIONS =
MKDEP = makedepend
MKDEP_OPTIONS = -fdepend
MAKE = make
INSTALL = $(SHELL) $(TOP)/bin/minstall
# Use MINSTALL for installing libraries, INSTALL for everything else
MINSTALL = $(SHELL) $(TOP)/bin/minstall
INSTALL = $(MINSTALL)
# Tools for regenerating glapi (generally only needed by the developers)
PYTHON2 = python
@@ -91,9 +94,9 @@ EGL_DRIVERS_DIRS = demo
# Gallium directories and
GALLIUM_DIRS = auxiliary drivers state_trackers
GALLIUM_AUXILIARY_DIRS = draw translate cso_cache pipebuffer tgsi sct rtasm util indices
GALLIUM_AUXILIARY_DIRS = rbug draw translate cso_cache pipebuffer tgsi sct rtasm util indices
GALLIUM_AUXILIARIES = $(foreach DIR,$(GALLIUM_AUXILIARY_DIRS),$(TOP)/src/gallium/auxiliary/$(DIR)/lib$(DIR).a)
GALLIUM_DRIVERS_DIRS = softpipe i915simple failover trace
GALLIUM_DRIVERS_DIRS = softpipe i915simple failover trace identity
GALLIUM_DRIVERS = $(foreach DIR,$(GALLIUM_DRIVERS_DIRS),$(TOP)/src/gallium/drivers/$(DIR)/lib$(DIR).a)
GALLIUM_WINSYS_DIRS = xlib egl_xlib
GALLIUM_WINSYS_DRM_DIRS =
@@ -103,7 +106,7 @@ GALLIUM_STATE_TRACKERS_DIRS = glx
# Library dependencies
#EXTRA_LIB_PATH ?=
GL_LIB_DEPS = $(EXTRA_LIB_PATH) -lX11 -lXext -lm -lpthread
EGL_LIB_DEPS = $(EXTRA_LIB_PATH) -lX11 -ldl
EGL_LIB_DEPS = $(EXTRA_LIB_PATH) -ldl -lpthread
OSMESA_LIB_DEPS = $(EXTRA_LIB_PATH) -L$(TOP)/$(LIB_DIR) -l$(GL_LIB)
GLU_LIB_DEPS = $(EXTRA_LIB_PATH) -L$(TOP)/$(LIB_DIR) -l$(GL_LIB) -lm
GLUT_LIB_DEPS = $(EXTRA_LIB_PATH) -L$(TOP)/$(LIB_DIR) -l$(GLU_LIB) -l$(GL_LIB) -lX11 -lXmu -lXi -lm

View File

@@ -1,14 +1,21 @@
# -*-makefile-*-
# Configuration for Linux and LLVM with debugging info
# Builds the llvmpipe gallium driver
include $(TOP)/configs/linux
CONFIG_NAME = linux-llvm
GALLIUM_AUXILIARY_DIRS += gallivm
#GALLIUM_AUXILIARY_DIRS += gallivm
# Add llvmpipe driver
GALLIUM_DRIVERS_DIRS += llvmpipe
OPT_FLAGS = -g -ansi -pedantic
DEFINES += -DDEBUG -DDEBUG_MATH -DMESA_LLVM=1
DEFINES += -DDEBUG -DDEBUG_MATH -DGALLIUM_LLVMPIPE -DHAVE_UDIS86
# override -std=c99
CFLAGS += -std=gnu99
LLVM_VERSION := $(shell llvm-config --version)
@@ -17,14 +24,14 @@ ifeq ($(LLVM_VERSION),)
MESA_LLVM=0
else
MESA_LLVM=1
$(info Using LLVM version: $(LLVM_VERSION))
# $(info Using LLVM version: $(LLVM_VERSION))
endif
ifeq ($(MESA_LLVM),1)
# LLVM_CFLAGS=`llvm-config --cflags`
LLVM_CXXFLAGS=`llvm-config --cxxflags backend bitreader engine ipo interpreter instrumentation` -Wno-long-long
LLVM_LDFLAGS=`llvm-config --ldflags backend bitreader engine ipo interpreter instrumentation`
LLVM_LIBS=`llvm-config --libs backend bitreader engine ipo interpreter instrumentation`
LLVM_LDFLAGS = $(shell llvm-config --ldflags backend bitreader engine ipo interpreter instrumentation)
LLVM_LIBS = $(shell llvm-config --libs backend bitreader engine ipo interpreter instrumentation)
MKLIB_OPTIONS=-cplusplus
else
LLVM_CFLAGS=
@@ -32,4 +39,4 @@ else
endif
LD = g++
GL_LIB_DEPS = $(LLVM_LDFLAGS) $(LLVM_LIBS) $(EXTRA_LIB_PATH) -lX11 -lXext -lm -lpthread -lstdc++
GL_LIB_DEPS = $(LLVM_LDFLAGS) $(LLVM_LIBS) $(EXTRA_LIB_PATH) -lX11 -lXext -lm -lpthread -lstdc++ -ludis86

View File

@@ -4,4 +4,5 @@ include $(TOP)/configs/linux-x86-64
CONFIG_NAME = linux-x86-64-debug
OPT_FLAGS = -g
DEFINES += -DDEBUG -DDEBUG_MATH

View File

@@ -29,6 +29,11 @@ AC_CHECK_PROGS([MAKE], [gmake make])
AC_PATH_PROG([MKDEP], [makedepend])
AC_PATH_PROG([SED], [sed])
dnl Our fallback install-sh is a symlink to minstall. Use the existing
dnl configuration in that case.
AC_PROG_INSTALL
test "x$INSTALL" = "x$ac_install_sh" && INSTALL='$(MINSTALL)'
dnl We need a POSIX shell for parts of the build. Assume we have one
dnl in most cases.
case "$host_os" in
@@ -225,6 +230,8 @@ else
LIB_EXTENSION='dylib' ;;
cygwin* )
LIB_EXTENSION='dll' ;;
aix* )
LIB_EXTENSION='a' ;;
* )
LIB_EXTENSION='so' ;;
esac
@@ -412,8 +419,8 @@ WINDOW_SYSTEM=""
GALLIUM_DIRS="auxiliary drivers state_trackers"
GALLIUM_WINSYS_DIRS=""
GALLIUM_WINSYS_DRM_DIRS=""
GALLIUM_AUXILIARY_DIRS="draw translate cso_cache pipebuffer tgsi sct rtasm util indices"
GALLIUM_DRIVERS_DIRS="softpipe failover trace"
GALLIUM_AUXILIARY_DIRS="rbug draw translate cso_cache pipebuffer tgsi sct rtasm util indices"
GALLIUM_DRIVERS_DIRS="softpipe failover trace identity"
GALLIUM_STATE_TRACKERS_DIRS=""
case "$mesa_driver" in
@@ -441,6 +448,8 @@ AC_SUBST([GALLIUM_WINSYS_DRM_DIRS])
AC_SUBST([GALLIUM_DRIVERS_DIRS])
AC_SUBST([GALLIUM_AUXILIARY_DIRS])
AC_SUBST([GALLIUM_STATE_TRACKERS_DIRS])
AC_SUBST([RADEON_CFLAGS])
AC_SUBST([RADEON_LDFLAGS])
dnl
dnl User supplied program configuration
@@ -568,6 +577,13 @@ dri)
GL_PC_REQ_PRIV="libdrm >= $LIBDRM_REQUIRED dri2proto >= $DRI2PROTO_REQUIRED"
DRI_PC_REQ_PRIV="libdrm >= $LIBDRM_REQUIRED"
PKG_CHECK_MODULES([LIBDRM_RADEON], [libdrm_radeon], HAVE_LIBDRM_RADEON=yes, HAVE_LIBDRM_RADEON=no)
if test "$HAVE_LIBDRM_RADEON" = yes; then
RADEON_CFLAGS="-DHAVE_LIBDRM_RADEON=1 $LIBDRM_RADEON_CFLAGS"
RADEON_LDFLAGS=$LIBDRM_RADEON_LIBS
fi
# find the DRI deps for libGL
if test "$x11_pkgconfig" = yes; then
# add xcb modules if necessary
@@ -633,6 +649,13 @@ AC_ARG_WITH([dri-driverdir],
[DRI_DRIVER_INSTALL_DIR="$withval"],
[DRI_DRIVER_INSTALL_DIR='${libdir}/dri'])
AC_SUBST([DRI_DRIVER_INSTALL_DIR])
dnl Extra search path for DRI drivers
AC_ARG_WITH([dri-searchpath],
[AS_HELP_STRING([--with-dri-searchpath=DIRS...],
[semicolon delimited DRI driver search directories @<:@${libdir}/dri@:>@])],
[DRI_DRIVER_SEARCH_DIR="$withval"],
[DRI_DRIVER_SEARCH_DIR='${DRI_DRIVER_INSTALL_DIR}'])
AC_SUBST([DRI_DRIVER_SEARCH_DIR])
dnl Direct rendering or just indirect rendering
AC_ARG_ENABLE([driglx-direct],
[AS_HELP_STRING([--disable-driglx-direct],
@@ -700,7 +723,7 @@ if test "$mesa_driver" = dri; then
# because there is no x86-64 system where they could *ever*
# be used.
if test "x$DRI_DIRS" = "xyes"; then
DRI_DIRS="i915 i965 mach64 mga r128 r200 r300 radeon \
DRI_DIRS="i915 i965 mach64 mga r128 r200 r300 r600 radeon \
savage tdfx unichrome swrast"
fi
;;
@@ -708,13 +731,13 @@ if test "$mesa_driver" = dri; then
# Build only the drivers for cards that exist on PowerPC.
# At some point MGA will be added, but not yet.
if test "x$DRI_DIRS" = "xyes"; then
DRI_DIRS="mach64 r128 r200 r300 radeon tdfx swrast"
DRI_DIRS="mach64 r128 r200 r300 r600 radeon tdfx swrast"
fi
;;
sparc*)
# Build only the drivers for cards that exist on sparc`
if test "x$DRI_DIRS" = "xyes"; then
DRI_DIRS="mach64 r128 r200 r300 radeon ffb swrast"
DRI_DIRS="mach64 r128 r200 r300 r600 radeon ffb swrast"
fi
;;
esac
@@ -733,7 +756,7 @@ if test "$mesa_driver" = dri; then
# ffb and gamma are missing because they have not been converted
# to use the new interface.
if test "x$DRI_DIRS" = "xyes"; then
DRI_DIRS="i810 i915 i965 mach64 mga r128 r200 r300 radeon tdfx \
DRI_DIRS="i810 i915 i965 mach64 mga r128 r200 r300 r600 radeon tdfx \
unichrome savage sis swrast"
fi
;;
@@ -752,7 +775,7 @@ if test "$mesa_driver" = dri; then
# default drivers
if test "x$DRI_DIRS" = "xyes"; then
DRI_DIRS="i810 i915 i965 mach64 mga r128 r200 r300 radeon s3v \
DRI_DIRS="i810 i915 i965 mach64 mga r128 r200 r300 r600 radeon s3v \
savage sis tdfx trident unichrome ffb swrast"
fi
@@ -1134,6 +1157,11 @@ yes)
if test "$tracker" = egl && test "x$enable_egl" != xyes; then
AC_MSG_ERROR([cannot build egl state tracker without EGL library])
fi
if test "$tracker" = xorg; then
PKG_CHECK_MODULES(XEXT, [xextproto >= 7.0.99.1],
HAVE_XEXTPROTO_71="yes"; DEFINES="$DEFINES -DHAVE_XEXTPROTO_71",
HAVE_XEXTPROTO_71="no")
fi
done
GALLIUM_STATE_TRACKERS_DIRS="$state_trackers"
;;
@@ -1197,7 +1225,7 @@ AC_ARG_ENABLE([gallium-nouveau],
[enable_gallium_nouveau=no])
if test "x$enable_gallium_nouveau" = xyes; then
GALLIUM_WINSYS_DRM_DIRS="$GALLIUM_WINSYS_DRM_DIRS nouveau"
GALLIUM_DRIVERS_DIRS="$GALLIUM_DRIVERS_DIRS nv04 nv10 nv20 nv30 nv40 nv50"
GALLIUM_DRIVERS_DIRS="$GALLIUM_DRIVERS_DIRS nouveau nv04 nv10 nv20 nv30 nv40 nv50"
fi

39
debian/README.source vendored Normal file
View File

@@ -0,0 +1,39 @@
------------------------------------------------------
Quick Guide To Patching This Package For The Impatient
------------------------------------------------------
1. Make sure you have quilt installed
2. Unpack the package as usual with "dpkg-source -x"
3. Run the "patch" target in debian/rules
4. Create a new patch with "quilt new" (see quilt(1))
5. Edit all the files you want to include in the patch with "quilt edit"
(see quilt(1)).
6. Write the patch with "quilt refresh" (see quilt(1))
7. Run the "clean" target in debian/rules
Alternatively, instead of using quilt directly, you can drop the patch in to
debian/patches and add the name of the patch to debian/patches/series.
The X Strike Force team maintains X packages in git repositories on
git.debian.org in the pkg-xorg subdirectory. Most upstream packages
are actually maintained in git repositories as well, so they often
just need to be pulled into git.debian.org in a "upstream-*" branch.
The .orig.tar.gz upstream source file could be generated this
"upstream-*" branch in the Debian git repository but it is actually
generated from upstream tarballs directly.
Upstream ships Mesa as 3 different tarballs (MesaLib, MesaGLUT and
MesaDemos) which are re-bundled together into a single .orig.tar.gz.
The Debian packaging is added by creating the "debian-*" git branch
which contains the aforementioned "upstream-*" branch plus the debian/
repository files.
When a patch has to be applied to the Debian package, two solutions
are involved:
* If the patch is available in one of the upstream branches, it
may be git'cherry-picked into the Debian repository. In this
case, it appears directly in the .diff.gz.
* Otherwise, the patch is added to debian/patches/ which is managed
with quilt as documented in /usr/share/doc/quilt/README.source.
Thus, the patching system requires a build dependency on quilt.

1468
debian/changelog vendored Normal file

File diff suppressed because it is too large Load Diff

1
debian/compat vendored Normal file
View File

@@ -0,0 +1 @@
5

355
debian/control vendored Normal file
View File

@@ -0,0 +1,355 @@
Source: mesa
Section: graphics
Priority: optional
Maintainer: Debian X Strike Force <debian-x@lists.debian.org>
Uploaders: Thierry Reding <thierry@gilfi.de>, Julien Cristau <jcristau@debian.org>, David Nusinow <dnusinow@debian.org>, Brice Goglin <bgoglin@debian.org>
Standards-Version: 3.8.3
Build-Depends: debhelper (>= 6.0.7), quilt (>= 0.40), pkg-config,
libdrm-dev (>= 2.4.3) [!hurd-i386], libx11-dev, xutils-dev,
x11proto-gl-dev (>= 1.4.8), libxxf86vm-dev,
libexpat1-dev, lesstif2-dev, dpkg-dev (>= 1.13.19), libxfixes-dev,
libxdamage-dev, libxext-dev, autoconf, automake, x11proto-dri2-dev (>= 1.99.3),
linux-libc-dev (>= 2.6.29) [!hurd-i386 !kfreebsd-amd64 !kfreebsd-i386]
Vcs-Git: git://git.debian.org/git/pkg-xorg/lib/mesa
Vcs-Browser: http://git.debian.org/?p=pkg-xorg/lib/mesa.git
Homepage: http://mesa3d.sourceforge.net/
Package: libgl1-mesa-swx11
Section: libs
Priority: extra
Architecture: any
Depends: ${shlibs:Depends}, libosmesa6 (>= 6.5.2-1)
Conflicts: mesag3-glide, mesag3-glide2, mesag3+ggi, libgl1, nvidia-glx, mesag3, libgl1-mesa-swrast
Provides: libgl1, mesag3, libgl1-mesa-swrast
Replaces: libgl1, mesag3, libgl1-mesa-swrast
Description: A free implementation of the OpenGL API -- runtime
Mesa is a 3-D graphics library with an API which is very similar to
that of OpenGL. To the extent that Mesa utilizes the OpenGL command
syntax or state machine, it is being used with authorization from
Silicon Graphics, Inc. However, the author makes no claim that Mesa
is in any way a compatible replacement for OpenGL or associated with
Silicon Graphics, Inc.
.
This library provides a pure software rasteriser; it does not provide
a direct rendering-capable library, or one which uses GLX. For that,
please see libgl1-mesa-glx.
.
On Linux, this library is also known as libGL or libGL.so.1.
Package: libgl1-mesa-swx11-dbg
Section: debug
Priority: extra
Architecture: any
Depends: libgl1-mesa-swx11 (= ${binary:Version})
Conflicts: libgl1-mesa-swrast-dbg
Provides: libgl1-mesa-swrast-dbg
Replaces: libgl1-mesa-swrast-dbg
Description: A free implementation of the OpenGL API -- debugging symbols
Mesa is a 3-D graphics library with an API which is very similar to
that of OpenGL. To the extent that Mesa utilizes the OpenGL command
syntax or state machine, it is being used with authorization from
Silicon Graphics, Inc. However, the author makes no claim that Mesa
is in any way a compatible replacement for OpenGL or associated with
Silicon Graphics, Inc.
.
This library provides a pure software rasteriser; it does not provide
a direct rendering-capable library, or one which uses GLX. For that,
please see libgl1-mesa-glx.
.
On Linux, this library is also known as libGL or libGL.so.1.
.
This package contains debugging symbols for the software rasterization GL
library.
Package: libgl1-mesa-swx11-i686
Section: libs
Priority: extra
Architecture: i386 kfreebsd-i386 hurd-i386
Depends: libgl1-mesa-swx11 (= ${binary:Version}), ${shlibs:Depends}
Description: Mesa OpenGL runtime [i686 optimized]
Mesa is a 3-D graphics library with an API which is very similar to
that of OpenGL. To the extent that Mesa utilizes the OpenGL command
syntax or state machine, it is being used with authorization from
Silicon Graphics, Inc. However, the author makes no claim that Mesa
is in any way a compatible replacement for OpenGL or associated with
Silicon Graphics, Inc.
.
This library provides a pure software rasteriser; it does not provide
a direct rendering-capable library, or one which uses GLX. For that,
please see libgl1-mesa-glx.
.
On Linux, this library is also known as libGL or libGL.so.1.
.
This set of libraries is optimized for i686 machines and will only be used if
you are running a 2.6 kernel on an i686 class CPU. This includes Pentium Pro,
Pentium II/II/IV, Celeron CPU's and similar class CPU's (including clones
such as AMD Athlon/Opteron, VIA C3 Nehemiah, but not VIA C3 Ezla).
Package: libgl1-mesa-swx11-dev
Section: libdevel
Priority: extra
Architecture: any
Depends: libgl1-mesa-swx11 (= ${binary:Version}), libc6-dev, libx11-dev, libxext6, mesa-common-dev (= ${binary:Version})
Provides: libgl-dev, mesag-dev, libgl1-mesa-swrast-dev
Conflicts: mesa-dev, libgl-dev, mesag3 (<< 3.1-1), nvidia-glx-dev, mesag-dev, libgl1-mesa-swrast-dev
Replaces: libgl-dev, mesag-dev, libgl1-mesa-swrast-dev
Description: A free implementation of the OpenGL API -- development files
This package provides the development environment required for
compiling programs with Mesa. For a complete description of Mesa,
please look at the libgl1-mesa-swx11 package.
.
This library provides a pure software rasteriser; it does not provide
a direct rendering-capable library, or one which uses GLX. For that,
please see libgl1-mesa-dev.
Package: libgl1-mesa-glx
Section: libs
Architecture: any
Depends: ${shlibs:Depends}
Recommends: libgl1-mesa-dri (>= 7.2)
Conflicts: libgl1, libgl1-mesa-dri (<< 6.4.0)
Replaces: libgl1, libgl1-mesa-dri (<< 6.4.0)
Provides: libgl1
Description: A free implementation of the OpenGL API -- GLX runtime
This version of Mesa provides GLX and DRI capabilities: it is capable of
both direct and indirect rendering. For direct rendering, it can use DRI
modules from the libgl1-mesa-dri package to accelerate drawing.
.
This package does not include the modules themselves: these can be found
in the libgl1-mesa-dri package.
.
For a complete description of Mesa, please look at the
libgl1-mesa-swx11 package.
Package: libgl1-mesa-glx-dbg
Section: debug
Priority: extra
Architecture: any
Depends: libgl1-mesa-glx (= ${binary:Version})
Description: Debugging symbols for the Mesa GLX runtime
This version of Mesa provides GLX and DRI capabilities: it is capable of
both direct and indirect rendering. For direct rendering, it can use DRI
modules from the libgl1-mesa-dri package to accelerate drawing.
.
This package does not include the modules themselves: these can be found
in the libgl1-mesa-dri package.
.
For a complete description of Mesa, please look at the
libgl1-mesa-swx11 package.
.
This package contains debugging symbols for the GL library with GLX and DRI
capabilities.
#Package: libgl1-mesa-glx-i686
#Section: libs
#Priority: extra
#Architecture: i386 kfreebsd-i386 hurd-i386
#Pre-Depends: libgl1-mesa-glx
#Description: A free implementation of the OpenGL API -- GLX runtime [i686 optimized]
# This version of Mesa provides GLX and DRI capabilities: it is capable of
# both direct and indirect rendering. For direct rendering, it can use DRI
# modules from the libgl1-mesa-dri package to accelerate drawing.
# .
# This package does not include the modules themselves: these can be found
# in the libgl1-mesa-dri package.
# .
# For a complete description of Mesa, please look at the
# libgl1-mesa-swx11 package.
# .
# This set of libraries is optimized for i686 machines and will only be used if
# you are running a 2.6 kernel on an i686 class CPU. This includes Pentium Pro,
# Pentium II/II/IV, Celeron CPU's and similar class CPU's (including clones
# such as AMD Athlon/Opteron, VIA C3 Nehemiah, but not VIA C3 Ezla).
Package: libgl1-mesa-dri
Section: libs
Priority: optional
Architecture: any
Depends: ${shlibs:Depends}
Suggests: libglide3
Conflicts: xlibmesa-dri (<< 1:7.0.0)
Replaces: xlibmesa-dri (<< 1:7.0.0)
Breaks: xserver-xorg-core (<< 2:1.5), libgl1-mesa-glx (<< 7.2)
Description: A free implementation of the OpenGL API -- DRI modules
This version of Mesa provides GLX and DRI capabilities: it is capable of
both direct and indirect rendering. For direct rendering, it can use DRI
modules from the libgl1-mesa-dri package to accelerate drawing.
.
This package does not include the OpenGL library itself, only the DRI
modules for accelerating direct rendering.
.
For a complete description of Mesa, please look at the
libgl1-mesa-swx11 package.
.
The tdfx DRI module needs libglide3 to enable direct rendering.
Package: libgl1-mesa-dri-dbg
Section: debug
Priority: extra
Architecture: any
Depends: libgl1-mesa-dri (= ${binary:Version})
Description: Debugging symbols for the Mesa DRI modules
This version of Mesa provides GLX and DRI capabilities: it is capable of
both direct and indirect rendering. For direct rendering, it can use DRI
modules from the libgl1-mesa-dri package to accelerate drawing.
.
This package does not include the OpenGL library itself, only the DRI
modules for accelerating direct rendering.
.
For a complete description of Mesa, please look at the
libgl1-mesa-swx11 package.
.
This package contains debugging symbols for the DRI modules.
#Package: libgl1-mesa-dri-i686
#Section: libs
#Priority: extra
#Architecture: i386 kfreebsd-i386 hurd-i386
#Pre-Depends: libgl1-mesa-dri
#Description: A free implementation of the OpenGL API -- DRI modules [i686 optimized]
# This version of Mesa provides GLX and DRI capabilities: it is capable of
# both direct and indirect rendering. For direct rendering, it can use DRI
# modules from the libgl1-mesa-dri package to accelerate drawing.
# .
# This package does not include the OpenGL library itself, only the DRI
# modules for accelerating direct rendering.
# .
# For a complete description of Mesa, please look at the
# libgl1-mesa-swx11 package.
# .
# This set of libraries is optimized for i686 machines and will only be used if
# you are running a 2.6 kernel on an i686 class CPU. This includes Pentium Pro,
# Pentium II/II/IV, Celeron CPU's and similar class CPU's (including clones
# such as AMD Athlon/Opteron, VIA C3 Nehemiah, but not VIA C3 Ezla).
Package: libgl1-mesa-dev
Section: libdevel
Architecture: any
Depends: libc6-dev, mesa-common-dev (= ${binary:Version}), libgl1-mesa-glx (= ${binary:Version})
Conflicts: libgl-dev, libgl1-mesa-dri-dev
Replaces: libgl-dev, libgl1-mesa-dri-dev
Provides: libgl-dev, libgl1-mesa-dri-dev
Description: A free implementation of the OpenGL API -- GLX development files
This version of Mesa provides GLX and DRI capabilities: it is capable of
both direct and indirect rendering. For direct rendering, it can use DRI
modules from the libgl1-mesa-dri package to accelerate drawing.
.
This package includes headers and static libraries for compiling
programs with Mesa.
.
For a complete description of Mesa, please look at the libgl1-mesa-swx11
package.
Package: mesa-common-dev
Section: libdevel
Architecture: any
Replaces: xlibmesa-gl-dev (<< 1:7), xlibosmesa-dev, libgl1-mesa-swx11-dev (<< 6.5.2), libgl1-mesa-dev (<< 7.5~rc4-2)
Depends: libx11-dev
Description: Developer documentation for Mesa
This package includes the specifications for the Mesa-specific OpenGL
extensions, the complete set of release notes and the development header
files common to all Mesa packages.
Package: libosmesa6
Section: libs
Architecture: any
Depends: ${shlibs:Depends}
Replaces: libgl1-mesa-swx11 (<< 6.5.2)
Description: Mesa Off-screen rendering extension
OSmesa is a Mesa extension that allows programs to render to an
off-screen buffer using the OpenGL API without having to create a
rendering context on an X Server. It uses a pure software renderer.
.
This package provides both 16-bit and 32-bit versions of the off-screen
renderer which do not require external libraries to work.
Package: libosmesa6-dev
Section: libdevel
Architecture: any
Depends: libosmesa6 (= ${binary:Version}), mesa-common-dev (= ${binary:Version}) | libgl-dev
Conflicts: xlibosmesa-dev, libosmesa4-dev, libosmesa-dev
Replaces: xlibosmesa-dev, libosmesa-dev, libgl1-mesa-swx11-dev (<< 6.5.2), mesa-common-dev (<< 6.5.2)
Provides: xlibosmesa-dev, libosmesa-dev
Description: Mesa Off-screen rendering extension -- development files
This package provides the required environment for developing programs
that use the off-screen rendering extension of Mesa.
.
For more information on OSmesa see the libosmesa6 package.
Package: libglu1-mesa
Section: libs
Architecture: any
Depends: ${shlibs:Depends}, libgl1-mesa-glx | libgl1
Provides: libglu1
Conflicts: mesag3 (<< 5.0.0-1), xlibmesa3, libglu1
Replaces: libglu1
Description: The OpenGL utility library (GLU)
GLU offers simple interfaces for building mipmaps; checking for the
presence of extensions in the OpenGL (or other libraries which follow
the same conventions for advertising extensions); drawing
piecewise-linear curves, NURBS, quadrics and other primitives
(including, but not limited to, teapots); tesselating surfaces; setting
up projection matrices and unprojecting screen coordinates to world
coordinates.
.
On Linux, this library is also known as libGLU or libGLU.so.1.
.
This package provides the SGI implementation of GLU shipped with the
Mesa package (ergo the "-mesa" suffix).
Package: libglu1-mesa-dev
Section: libdevel
Architecture: any
Depends: libglu1-mesa (= ${binary:Version}), libgl1-mesa-dev | libgl-dev
Provides: libglu-dev, xlibmesa-glu-dev
Conflicts: mesag-dev (<< 5.0.0-1), mesa-glide2-dev (<< 5.0.0-1), mesag3+ggi-dev (<< 5.0.0-1), xlibmesa-dev
Replaces: libglu-dev
Description: The OpenGL utility library -- development files
Includes headers and static libraries for compiling programs with GLU.
.
For a complete description of GLU, please look at the libglu1-mesa
package.
Package: libglw1-mesa
Section: libs
Architecture: any
Depends: ${shlibs:Depends}
Provides: libglw1
Description: A free implementation of the OpenGL API -- runtime
Mesa is a 3-D graphics library with an API which is very similar to
that of OpenGL. To the extent that Mesa utilizes the OpenGL command
syntax or state machine, it is being used with authorization from
Silicon Graphics, Inc. However, the author makes no claim that Mesa
is in any way a compatible replacement for OpenGL or associated with
Silicon Graphics, Inc.
.
This package provides a simple widgets library, libGLw, which
allows Motif-based applications to embed an OpenGL drawing context.
.
On Linux, this library is also known as libGLw or libGLw.so.1.
Package: libglw1-mesa-dev
Section: libdevel
Architecture: any
Depends: libglw1-mesa (= ${binary:Version}), libc6-dev, libx11-dev, libxext6, mesa-common-dev (= ${binary:Version})
Provides: mesag3-widgets, mesag-widgets-dev, libglw-dev
Conflicts: libglw-dev, libgl1-mesa-swx11-dev (<< 6.5.2-4)
Replaces: libglw-dev
Description: A free implementation of the OpenGL API -- development files
This package provides the development environment required for
compiling programs with the Mesa widgets library, libGLw, which
allows Motif-based applications to embed an OpenGL drawing context.
The headers and static libraries for compiling programs that use this
library are included.
Package: mesa-utils
Section: x11
Priority: optional
Architecture: any
Depends: ${shlibs:Depends}
Replaces: xbase-clients (<< 6.8.2-38)
Description: Miscellaneous Mesa GL utilities
This package provides several basic GL utilities built by Mesa, including
glxinfo and glxgears.
# vim: tw=0

193
debian/copyright vendored Normal file
View File

@@ -0,0 +1,193 @@
This package was debianized by James A. Treacy treacy@debian.org on Thu,
6 Jan 2000 01:11:34 -0500. It was newly debianized by Marcelo E.
Magallon <mmagallo@debian.org> on Sat, 25 Dec 2004 14:50:02 -0600. It was
again debianized by Thierry Reding <thierry@gilfi.de> on Sat, 14 Oct 2006
02:01:12 +0200.
It was downloaded from http://www.mesa3d.org/download.html
For more information see:
http://www.mesa3d.org/
Copyright:
Upstream Author: Brian Paul <brian.paul@tungstengraphics.com>
License:
License / Copyright Information
The Mesa distribution consists of several components. Different
copyrights and licenses apply to different components. For
example, GLUT is copyrighted by Mark Kilgard, some demo programs
are copyrighted by SGI, some of the Mesa device drivers are
copyrighted by their authors. See below for a list of Mesa's
components and the copyright/license for each.
The core Mesa library is licensed according to the terms of the
XFree86 copyright (an MIT-style license). This allows integration
with the XFree86/DRI project. Unless otherwise stated, the Mesa
source code and documentation is licensed as follows:
Copyright (C) 1999-2003 Brian Paul All Rights Reserved.
Permission is hereby granted, free of charge, to any person obtaining a
copy of this software and associated documentation files (the "Software"),
to deal in the Software without restriction, including without limitation
the rights to use, copy, modify, merge, publish, distribute, sublicense,
and/or sell copies of the Software, and to permit persons to whom the
Software is furnished to do so, subject to the following conditions:
The above copyright notice and this permission notice shall be included
in all copies or substantial portions of the Software.
THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL
BRIAN PAUL BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN
AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN
CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
Attention, Contributors
When contributing to the Mesa project you must agree to relinquish
your work to the holder of the copyright for the particular
component you're contributing to. That is, you can't put your own
copyright on the code, unless it's a modular piece that can be
omitted from Mesa (like a new device driver). If for example, you
contribute a bug fix to Mesa's texture mapping code, your code
will become a part of the body of work which is copyrighted by
Brian Paul and licensed by the above terms.
----------------------------------------------------------------------
Some files, as listed below, are made available under the SGI Free B
license. This license is as follows:
SGI FREE SOFTWARE LICENSE B (Version 2.0, Sept. 18, 2008)
Copyright (C) [dates of first publication] Silicon Graphics, Inc. All Rights
Reserved.
Permission is hereby granted, free of charge, to any person obtaining a copy of
this software and associated documentation files (the "Software"), to deal in
the Software without restriction, including without limitation the rights to
use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies
of the Software, and to permit persons to whom the Software is furnished to do
so, subject to the following conditions:
The above copyright notice including the dates of first publication and either
this permission notice or a reference to http://oss.sgi.com/projects/FreeB/
shall be included in all copies or substantial portions of the Software.
THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES
OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND
NONINFRINGEMENT. IN NO EVENT SHALL SILICON GRAPHICS, INC. BE
LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN
ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR
IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS
IN THE SOFTWARE.
Except as contained in this notice, the name of Silicon Graphics, Inc. shall
not be used in advertising or otherwise to promote the sale, use or other
dealings in this Software without prior written authorization from Silicon
Graphics, Inc.
--------------------------------------------------------------------------
Some other files listed below are made available from Silicon Graphics,
Inc. under a more liberal, MIT-style license, as follows:
Permission to use, copy, modify, and distribute this software for
any purpose and without fee is hereby granted, provided that the above
copyright notice appear in all copies and that both the copyright notice
and this permission notice appear in supporting documentation, and that
the name of Silicon Graphics, Inc. not be used in advertising
or publicity pertaining to distribution of the software without specific,
written prior permission.
THE MATERIAL EMBODIED ON THIS SOFTWARE IS PROVIDED TO YOU "AS-IS"
AND WITHOUT WARRANTY OF ANY KIND, EXPRESS, IMPLIED OR OTHERWISE
INCLUDING WITHOUT LIMITATION, ANY WARRANTY OF MERCHANTABILITY OR
FITNESS FOR A PARTICULAR PURPOSE. IN NO EVENT SHALL SILICON
GRAPHICS, INC. BE LIABLE TO YOU OR ANYONE ELSE FOR ANY DIRECT,
SPECIAL, INCIDENTAL, INDIRECT OR CONSEQUENTIAL DAMAGES OF ANY
KIND, OR ANY DAMAGES WHATSOEVER, INCLUDING WITHOUT LIMITATION,
LOSS OF PROFIT, LOSS OF USE, SAVINGS OR REVENUE, OR THE CLAIMS OF
THIRD PARTIES, WHETHER OR NOT SILICON GRAPHICS, INC. HAS BEEN
ADVISED OF THE POSSIBILITY OF SUCH LOSS, HOWEVER CAUSED AND ON
ANY THEORY OF LIABILITY, ARISING OUT OF OR IN CONNECTION WITH THE
POSSESSION, USE OR PERFORMANCE OF THIS SOFTWARE.
US Government Users Restricted Rights
Use, duplication, or disclosure by the Government is subject to
restrictions set forth in FAR 52.227.19(c)(2) or subparagraph
(c)(1)(ii) of the Rights in Technical Data and Computer Software
clause at DFARS 252.227-7013 and/or in similar or successor
clauses in the FAR or the DOD or NASA FAR Supplement.
Unpublished-- rights reserved under the copyright laws of the
United States. Contractor/manufacturer is Silicon Graphics,
Inc., 2011 N. Shoreline Blvd., Mountain View, CA 94039-7311.
--------------------------------------------------------------------------
Mesa Component Licenses:
Component Files Primary Author License
----------------------------------------------------------------------------
core Mesa code src/*.[ch] Brian Paul Mesa
include/GL/gl.h
GLX driver src/X/* Brian Paul Mesa
include/GL/glx.h
include/GL/xmesa.h
OS/Mesa driver src/OSmesa/* Brian Paul Mesa
include/GL/osmesa.h
3Dfx driver src/FX/* David Bucciarelli Mesa
include/GL/fxmesa.h
BeOS R4 driver mesa/drivers/beos/ Brian Paul Mesa
MGL driver include/GL/mglmesa.h SciTech, Inc GNU LGPL
Windows driver mesa/drivers/windows/ Li Wei GNU LGPL
include/GL/wmesa.h
SVGA driver mesa/drivers/svga/ Brian Paul GNU LGPL
include/GL/svgamesa.h
DOS driver mesa/drivers/dos/ Charlie Wallace GNU LGPL
include/GL/dosmesa.h
GGI driver mesa/drivers/ggi/ Uwe Maurer GNU LGPL
include/GL/ggimesa.h
GLUT src/glut/* Mark Kilgard Mark's copyright
include/GL/*glut*.h
GLU library src/glu/* Brian Paul GNU LGPL
SGI GLU library src/glu/sgi/* SGI SGI Free B
include/GL/glu.h
Ext registry include/GL/glext.h SGI SGI Free B
include/GL/glxext.h
demo programs progs/demos/* various see source files
X demos progs/xdemos/* Brian Paul see source files
SGI demos progs/samples/* SGI SGI MIT-style
RedBook demos progs/redbook/* SGI SGI MIT-style
On Debian systems the full text of the GNU LGPL license is found in
/usr/share/common-licenses/LGPL.
------------------------------------------------------------------------------
The Debian packaging is (C) 2006, Thierry Reding <thierry@gilfi.de> and
is licensed under the GPL, see `/usr/share/common-licenses/GPL'.

15
debian/glxdemo.1 vendored Normal file
View File

@@ -0,0 +1,15 @@
.TH glxdemo 1 "2006-11-29"
.SH NAME
glxdemo \- a demonstration of the GLX functions
.SH SYNOPSIS
.B glxdemo
.SH DESCRIPTION
The \fIglxdemo\fP program shows how to use the GLX functions in order to
create an OpenGL program running on top of an X server. This program is most
useful when studied in its source code form.
.SH AUTHOR
glxdemo was written by Brian Paul <brian.paul@tungstengraphics.com>.
.PP
This manual page was written by Thierry Reding <thierry@gilfi.de>, for the
Debian project (but may be used by others).

29
debian/glxgears.1 vendored Normal file
View File

@@ -0,0 +1,29 @@
.TH glxgears 1 "2006-11-29"
.SH NAME
glxgears \- ``gears'' demo for GLX
.SH SYNOPSIS
.B glxgears
.RI [ options ]
.SH DESCRIPTION
The \fIglxgears\fP program is a port of the ``gears'' demo to GLX. It displays
a set of rotating gears and prints out the frame rate at regular intervals. It
has become quite popular as basic benchmarking tool.
.SH OPTIONS
.TP 8
.B \-display \fIdisplay\fP
Specify which X display to run on.
.TP 8
.B \-info
Display OpenGL renderer information.
.TP 8
.B \-stereo
Use a stereo enabled GLX visual.
.TP 8
.B \-fullscreen
Run in fullscreen mode.
.SH AUTHOR
glxgears was written by Brian Paul <brian.paul@tungstengraphics.com>.
.PP
This manual page was written by Thierry Reding <thierry@gilfi.de>, for the
Debian project (but may be used by others).

30
debian/glxheads.1 vendored Normal file
View File

@@ -0,0 +1,30 @@
.TH glxheads 1 "2006-11-29"
.SH NAME
glxheads \- exercise multiple GLX connections
.SH SYNOPSIS
.B glxheads
[\fIdisplay\fP ...]
.SH DESCRIPTION
The \fIglxheads\fP program will try to open GLX connections on multiple X
displays as specified on the command-line. If a connection can be made it will
try to create a direct GLX context (and fallback to using indirect contexts if
that fails) and open a window displaying a spinning green triangle.
.PP
If no display names are specified, \fIglxheads\fP will default to opening a
single local connection on display 0.
.SH EXAMPLE
To open a local connection on display 0 and two remote connections to the
hosts \fImars\fP (display 0) and \fIvenus\fP (display 1), run glxheads with
the following command-line:
.PP
.RS 3n
.nf
$ glxheads :0 mars:0 venus:1
.fi
.RE
.SH AUTHOR
glxheads was written by Brian Paul <brian.paul@tungstengraphics.com>.
.PP
This manual page was written by Thierry Reding <thierry@gilfi.de> for the
Debian project (but may be used by others).

41
debian/glxinfo.1 vendored Normal file
View File

@@ -0,0 +1,41 @@
.TH glxinfo 1 "2006-11-29"
.SH NAME
glxinfo \- show information about the GLX implementation
.SH SYNOPSIS
.B glxinfo
.RI [ options ]
.SH DESCRIPTION
The \fIglxinfo\fP program shows information about the OpenGL and GLX
implementations running on a given X display.
.PP
The information includes details about the server- and client-side GLX
implementation, the OpenGL and GLU implementations as well as a list
of available GLX visuals.
.SH OPTIONS
.TP 8
.B \-v
Print visuals info in verbose form.
.TP 8
.B \-t
Print verbose table.
.TP 8
.B \-display \fIdisplay\fP
Specify the X display to interrogate.
.TP 8
.B \-h
Print usage information.
.TP 8
.B \-i
Force an indirect rendering context.
.TP 8
.B \-b
Find the "best" visual and print its number.
.TP 8
.B \-l
Print interesting OpenGL limits.
.SH AUTHOR
glxinfo was written by Brian Paul <brian.paul@tungstengraphics.com>.
.PP
This manual page was written by Thierry Reding <thierry@gilfi.de>, for the
Debian project (but may be used by others).

2
debian/libgl1-mesa-dev.install vendored Normal file
View File

@@ -0,0 +1,2 @@
usr/lib/libGL.so
usr/lib/pkgconfig/gl.pc

1
debian/libgl1-mesa-dri-i686.install vendored Normal file
View File

@@ -0,0 +1 @@
usr/lib/dri/i686/cmov/*.so

1
debian/libgl1-mesa-dri.install vendored Normal file
View File

@@ -0,0 +1 @@
usr/lib/dri/*.so

1
debian/libgl1-mesa-glx-i686.install vendored Normal file
View File

@@ -0,0 +1 @@
usr/lib/glx/i686/cmov/libGL.so.* usr/lib/i686/cmov

1
debian/libgl1-mesa-glx.install vendored Normal file
View File

@@ -0,0 +1 @@
usr/lib/glx/libGL.so.* usr/lib

View File

@@ -0,0 +1 @@
package-name-doesnt-match-sonames libGL1

1
debian/libgl1-mesa-glx.shlibs vendored Normal file
View File

@@ -0,0 +1 @@
libGL 1 libgl1-mesa-glx | libgl1

2
debian/libgl1-mesa-swx11-dev.install vendored Normal file
View File

@@ -0,0 +1,2 @@
usr/lib/libGL.a
usr/lib/libGL.so

1
debian/libgl1-mesa-swx11-i686.install vendored Normal file
View File

@@ -0,0 +1 @@
usr/lib/i686/cmov/libGL.so.*

1
debian/libgl1-mesa-swx11-i686.shlibs vendored Normal file
View File

@@ -0,0 +1 @@
libGL 1 libgl1-mesa-glx | libgl1

1
debian/libgl1-mesa-swx11.install vendored Normal file
View File

@@ -0,0 +1 @@
usr/lib/libGL.so.*

View File

@@ -0,0 +1 @@
package-name-doesnt-match-sonames libGL1

1
debian/libgl1-mesa-swx11.shlibs vendored Normal file
View File

@@ -0,0 +1 @@
libGL 1 libgl1-mesa-glx | libgl1

5
debian/libglu1-mesa-dev.install vendored Normal file
View File

@@ -0,0 +1,5 @@
usr/include/GL/glu.h
usr/include/GL/glu_mangle.h
usr/lib/libGLU.a
usr/lib/libGLU.so
usr/lib/pkgconfig/glu.pc

1
debian/libglu1-mesa.install vendored Normal file
View File

@@ -0,0 +1 @@
usr/lib/libGLU.so.*

1
debian/libglu1-mesa.lintian-overrides vendored Normal file
View File

@@ -0,0 +1 @@
package-name-doesnt-match-sonames libGLU1

1
debian/libglu1-mesa.shlibs vendored Normal file
View File

@@ -0,0 +1 @@
libGLU 1 libglu1-mesa | libglu1

4
debian/libglw1-mesa-dev.install vendored Normal file
View File

@@ -0,0 +1,4 @@
usr/include/GL/GLw*A.h
usr/lib/libGLw.a
usr/lib/libGLw.so
usr/lib/pkgconfig/glw.pc

1
debian/libglw1-mesa.install vendored Normal file
View File

@@ -0,0 +1 @@
usr/lib/libGLw.so.*

1
debian/libglw1-mesa.lintian-overrides vendored Normal file
View File

@@ -0,0 +1 @@
package-name-doesnt-match-sonames libGLw1

1
debian/libglw1-mesa.shlibs vendored Normal file
View File

@@ -0,0 +1 @@
libGLw 1 libglw1-mesa | libglw1

8
debian/libosmesa6-dev.install vendored Normal file
View File

@@ -0,0 +1,8 @@
usr/include/GL/osmesa.h
usr/lib/libOSMesa.a
usr/lib/libOSMesa.so
usr/lib/libOSMesa16.a
usr/lib/libOSMesa16.so
usr/lib/libOSMesa32.a
usr/lib/libOSMesa32.so
usr/lib/pkgconfig/osmesa.pc

3
debian/libosmesa6.install vendored Normal file
View File

@@ -0,0 +1,3 @@
usr/lib/libOSMesa.so.*
usr/lib/libOSMesa16.so.*
usr/lib/libOSMesa32.so.*

3
debian/libosmesa6.shlibs vendored Normal file
View File

@@ -0,0 +1,3 @@
libOSMesa 6 libosmesa6 (>= 6.5.2-1) | libgl1-mesa-glide3
libOSMesa16 6 libosmesa6 (>= 6.5.2-1)
libOSMesa32 6 libosmesa6 (>= 6.5.2-1)

8
debian/mesa-common-dev.docs vendored Normal file
View File

@@ -0,0 +1,8 @@
docs/bugs.html
docs/debugging.html
docs/envvars.html
docs/faq.html
docs/osmesa.html
docs/RELNOTES-*
docs/relnotes*
docs/*.spec

8
debian/mesa-common-dev.install vendored Normal file
View File

@@ -0,0 +1,8 @@
usr/include/GL/gl.h
usr/include/GL/glext.h
usr/include/GL/gl_mangle.h
usr/include/GL/glx.h
usr/include/GL/glxext.h
usr/include/GL/glx_mangle.h
usr/include/GL/internal/dri_interface.h
usr/lib/glx/pkgconfig/dri.pc usr/lib/pkgconfig/

4
debian/mesa-utils.install vendored Normal file
View File

@@ -0,0 +1,4 @@
usr/bin/glxdemo
usr/bin/glxgears
usr/bin/glxheads
usr/bin/glxinfo

4
debian/mesa-utils.manpages vendored Normal file
View File

@@ -0,0 +1,4 @@
debian/glxdemo.1
debian/glxgears.1
debian/glxheads.1
debian/glxinfo.1

View File

@@ -0,0 +1,19 @@
Patch that fixes Debian bug #349437.
This patch by David Nusinow.
Index: mesa/src/mesa/main/compiler.h
===================================================================
--- mesa.orig/src/mesa/main/compiler.h
+++ mesa/src/mesa/main/compiler.h
@@ -347,8 +347,9 @@
* USE_IEEE: Determine if we're using IEEE floating point
*/
#if defined(__i386__) || defined(__386__) || defined(__sparc__) || \
- defined(__s390x__) || defined(__powerpc__) || \
+ defined(__s390__) || defined(__s390x__) || defined(__powerpc__) || \
defined(__x86_64__) || \
+ defined(__m68k__) || \
defined(ia64) || defined(__ia64__) || \
defined(__hppa__) || defined(hpux) || \
defined(__mips) || defined(_MIPS_ARCH) || \

View File

@@ -0,0 +1,55 @@
Allow the programs that are to be built to be defined in the build
configuration.
Provide an install target for installing the programs in $(INSTALL_DIR)/bin.
This patch by Thierry Reding.
Not submitted to Mesa.
--
Also remove references to GLU library since it is not required
and we don't actually build it at this point.
Index: mesa/progs/xdemos/Makefile
===================================================================
--- mesa.orig/progs/xdemos/Makefile
+++ mesa/progs/xdemos/Makefile
@@ -10,7 +10,7 @@
LIBS = -L$(TOP)/$(LIB_DIR) -l$(GL_LIB) $(APP_LIB_DEPS)
-PROGS = \
+PROGS ?= \
corender \
glsync \
glthreads \
@@ -63,6 +63,11 @@
extra: $(EXTRA_PROGS)
+install: $(PROGS)
+ $(INSTALL) -d $(DESTDIR)$(INSTALL_DIR)/bin
+ $(INSTALL) -m 755 $(PROGS) $(DESTDIR)$(INSTALL_DIR)/bin
+
+
clean:
-rm -f $(PROGS) $(EXTRA_PROGS)
-rm -f *.o *~
Index: mesa/progs/Makefile
===================================================================
--- mesa.orig/progs/Makefile
+++ mesa/progs/Makefile
@@ -21,8 +21,12 @@
fi \
done
-# Dummy install target
install:
+ @for dir in $(SUBDIRS) ; do \
+ if [ -d $$dir ] ; then \
+ (cd $$dir ; $(MAKE) install) ; \
+ fi \
+ done
clean:
-@for dir in $(SUBDIRS) tests ; do \

13
debian/patches/04_osmesa_version.diff vendored Normal file
View File

@@ -0,0 +1,13 @@
Index: mesa/src/mesa/drivers/osmesa/Makefile
===================================================================
--- mesa.orig/src/mesa/drivers/osmesa/Makefile
+++ mesa/src/mesa/drivers/osmesa/Makefile
@@ -39,7 +39,7 @@
# -DCHAN_BITS=16/32.
$(TOP)/$(LIB_DIR)/$(OSMESA_LIB_NAME): $(OBJECTS) $(CORE_MESA)
$(MKLIB) -o $(OSMESA_LIB) -linker '$(CC)' -ldflags '$(LDFLAGS)' \
- -major $(MESA_MAJOR) -minor $(MESA_MINOR) -patch $(MESA_TINY) \
+ -major 6 -minor 5 -patch 3 \
-install $(TOP)/$(LIB_DIR) $(MKLIB_OPTIONS) \
-id $(INSTALL_LIB_DIR)/lib$(OSMESA_LIB).$(MESA_MAJOR).dylib \
$(OSMESA_LIB_DEPS) $(OBJECTS) $(CORE_MESA)

75
debian/patches/05_hurd-ftbfs.diff vendored Normal file
View File

@@ -0,0 +1,75 @@
From: Samuel Thibault <samuel.thibault@ens-lyon.org>
Subject: Fix build on GNU/Hurd
---
configure.ac | 25 ++++++++++++++-----------
src/glx/x11/dri2.c | 2 ++
2 files changed, 16 insertions(+), 11 deletions(-)
Index: mesa-7.6.1~rc2/src/glx/x11/dri2.c
===================================================================
--- mesa-7.6.1~rc2.orig/src/glx/x11/dri2.c 2009-12-05 23:51:01.000000000 +0100
+++ mesa-7.6.1~rc2/src/glx/x11/dri2.c 2009-12-06 00:10:10.000000000 +0100
@@ -30,6 +30,7 @@
* Kristian Høgsberg (krh@redhat.com)
*/
+#ifdef GLX_DIRECT_RENDERING
#define NEED_REPLIES
#include <X11/Xlibint.h>
@@ -377,3 +378,4 @@
UnlockDisplay(dpy);
SyncHandle();
}
+#endif
Index: mesa-7.6.1~rc2/configure.ac
===================================================================
--- mesa-7.6.1~rc2.orig/configure.ac 2009-12-05 23:50:57.000000000 +0100
+++ mesa-7.6.1~rc2/configure.ac 2009-12-06 00:10:27.000000000 +0100
@@ -538,6 +538,13 @@
enable_xcb=no
fi
+dnl Direct rendering or just indirect rendering
+AC_ARG_ENABLE([driglx-direct],
+ [AS_HELP_STRING([--disable-driglx-direct],
+ [enable direct rendering in GLX for DRI @<:@default=enabled@:>@])],
+ [driglx_direct="$enableval"],
+ [driglx_direct="yes"])
+
dnl
dnl libGL configuration per driver
dnl
@@ -571,11 +578,13 @@
AC_MSG_ERROR([Can't use static libraries for DRI drivers])
fi
- # Check for libdrm
- PKG_CHECK_MODULES([LIBDRM], [libdrm >= $LIBDRM_REQUIRED])
- PKG_CHECK_MODULES([DRI2PROTO], [dri2proto >= $DRI2PROTO_REQUIRED])
- GL_PC_REQ_PRIV="libdrm >= $LIBDRM_REQUIRED dri2proto >= $DRI2PROTO_REQUIRED"
- DRI_PC_REQ_PRIV="libdrm >= $LIBDRM_REQUIRED"
+ if test x"$driglx_direct" = xyes; then
+ # Check for libdrm
+ PKG_CHECK_MODULES([LIBDRM], [libdrm >= $LIBDRM_REQUIRED])
+ PKG_CHECK_MODULES([DRI2PROTO], [dri2proto >= $DRI2PROTO_REQUIRED])
+ GL_PC_REQ_PRIV="libdrm >= $LIBDRM_REQUIRED dri2proto >= $DRI2PROTO_REQUIRED"
+ DRI_PC_REQ_PRIV="libdrm >= $LIBDRM_REQUIRED"
+ fi
PKG_CHECK_MODULES([LIBDRM_RADEON], [libdrm_radeon], HAVE_LIBDRM_RADEON=yes, HAVE_LIBDRM_RADEON=no)
@@ -656,12 +665,6 @@
[DRI_DRIVER_SEARCH_DIR="$withval"],
[DRI_DRIVER_SEARCH_DIR='${DRI_DRIVER_INSTALL_DIR}'])
AC_SUBST([DRI_DRIVER_SEARCH_DIR])
-dnl Direct rendering or just indirect rendering
-AC_ARG_ENABLE([driglx-direct],
- [AS_HELP_STRING([--disable-driglx-direct],
- [enable direct rendering in GLX for DRI @<:@default=enabled@:>@])],
- [driglx_direct="$enableval"],
- [driglx_direct="yes"])
dnl Which drivers to build - default is chosen by platform
AC_ARG_WITH([dri-drivers],
[AS_HELP_STRING([--with-dri-drivers@<:@=DIRS...@:>@],

23
debian/patches/06_kfreebsd-ftbfs.diff vendored Normal file
View File

@@ -0,0 +1,23 @@
From: Aurelien Jarno <aurel32@debian.org>
mesa fails to build on GNU/kFreeBSD, since some parts are not enabled.
http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=524690
---
configure.ac | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
Index: mesa-7.6.1~rc2/configure.ac
===================================================================
--- mesa-7.6.1~rc2.orig/configure.ac 2009-12-06 00:10:10.000000000 +0100
+++ mesa-7.6.1~rc2/configure.ac 2009-12-06 00:10:10.000000000 +0100
@@ -745,7 +745,7 @@
;;
esac
;;
- freebsd* | dragonfly*)
+ freebsd* | dragonfly* | kfreebsd*-gnu*)
DEFINES="$DEFINES -DPTHREADS -DUSE_EXTERNAL_DXTN_LIB=1"
DEFINES="$DEFINES -DIN_DRI_DRIVER -DHAVE_ALIAS"
DEFINES="$DEFINES -DGLX_INDIRECT_RENDERING"

5
debian/patches/series vendored Normal file
View File

@@ -0,0 +1,5 @@
02_use-ieee-fp-on-s390-and-m68k.patch
03_optional-progs-and-install.patch
04_osmesa_version.diff
05_hurd-ftbfs.diff
06_kfreebsd-ftbfs.diff

245
debian/rules vendored Executable file
View File

@@ -0,0 +1,245 @@
#!/usr/bin/make -f
# debian/rules for the Debian mesa package
# Copyright © 2006 Thierry Reding <thierry@gilfi.de>
# Uncomment this to turn on verbose mode.
#export DH_VERBOSE=1
CFLAGS = -Wall -g
ifneq (,$(filter noopt,$(DEB_BUILD_OPTIONS)))
CFLAGS += -O0
else
CFLAGS += -O2
endif
ifneq (,$(filter parallel=%,$(DEB_BUILD_OPTIONS)))
NUMJOBS = $(patsubst parallel=%,%,$(filter parallel=%,$(DEB_BUILD_OPTIONS)))
MAKEFLAGS += -j$(NUMJOBS)
endif
DEB_BUILD_ARCH ?= $(shell dpkg-architecture -qDEB_BUILD_ARCH)
DEB_HOST_ARCH ?= $(shell dpkg-architecture -qDEB_HOST_ARCH)
DEB_HOST_ARCH_OS ?= $(shell dpkg-architecture -qDEB_HOST_ARCH_OS)
DEB_HOST_GNU_TYPE ?= $(shell dpkg-architecture -qDEB_HOST_GNU_TYPE)
DEB_BUILD_GNU_TYPE ?= $(shell dpkg-architecture -qDEB_BUILD_GNU_TYPE)
DEB_HOST_GNU_CPU ?= $(shell dpkg-architecture -qDEB_HOST_GNU_CPU)
DEB_BUILD_DIR ?= $(CURDIR)/obj-$(DEB_BUILD_GNU_TYPE)
ifeq ($(DEB_BUILD_GNU_TYPE), $(DEB_HOST_GNU_TYPE))
confflags += --build=$(DEB_HOST_GNU_TYPE)
else
confflags += --build=$(DEB_BUILD_GNU_TYPE) --host=$(DEB_HOST_GNU_TYPE)
endif
# choose which configurations to build
include debian/scripts/choose-configs
# build the following configurations by default
CONFIGS = $(SWX11_GLU_CONFIGS) \
dri \
osmesa \
osmesa-static \
osmesa16 \
osmesa16-static \
osmesa32 \
osmesa32-static
STAMP_DIR = debian/stamp
STAMP = $(STAMP_DIR)/$(DEB_BUILD_GNU_TYPE)
BUILD_STAMPS = $(addprefix $(STAMP)-build-, $(CONFIGS))
QUILT_STAMPFN = $(STAMP_DIR)/patch
include /usr/share/quilt/quilt.make
# temporary until we figure out what to build
confflags += --disable-gallium
confflags-common = \
--disable-egl \
--disable-glu \
--disable-glut \
--disable-glw \
CFLAGS="$(CFLAGS)"
DRI_DRIVERS = swrast
# hurd doesn't do direct rendering
ifeq ($(DEB_HOST_ARCH_OS), hurd)
DIRECT_RENDERING = --disable-driglx-direct
else
DIRECT_RENDERING = --enable-driglx-direct
ifeq ($(DEB_HOST_ARCH), lpia)
DRI_DRIVERS += i915 i965
else ifneq ($(DEB_HOST_ARCH), s390)
DRI_DRIVERS += mach64 mga r128 r200 r300 radeon s3v savage tdfx trident
ifeq ($(DEB_HOST_GNU_CPU), i486)
DRI_DRIVERS += i810 i915 i965 sis unichrome
else ifeq ($(DEB_HOST_GNU_CPU), x86_64)
DRI_DRIVERS += i915 i965 sis unichrome
else ifeq ($(DEB_HOST_ARCH), sparc)
DRI_DRIVERS += ffb
endif
endif
endif
confflags-dri = \
--with-driver=dri \
--with-dri-drivers="$(DRI_DRIVERS)" \
--with-demos=xdemos \
--libdir=/usr/lib/glx \
--with-dri-driverdir=/usr/lib/dri \
--enable-glx-tls \
$(DIRECT_RENDERING) \
$(confflags-common)
confflags-osmesa = \
--with-driver=osmesa \
--with-demos= \
$(confflags-common)
confflags-osmesa-static = \
--with-driver=osmesa \
--enable-static \
--with-demos= \
$(confflags-common)
confflags-osmesa16 = \
--with-driver=osmesa \
--with-osmesa-bits=16 \
--with-demos= \
$(confflags-common)
confflags-osmesa16-static = \
--with-driver=osmesa \
--with-osmesa-bits=16 \
--enable-static \
--with-demos= \
$(confflags-common)
confflags-osmesa32 = \
--with-driver=osmesa \
--with-osmesa-bits=32 \
--with-demos= \
$(confflags-common)
confflags-osmesa32-static = \
--with-driver=osmesa \
--with-osmesa-bits=32 \
--enable-static \
--with-demos= \
$(confflags-common)
confflags-swx11+glu = \
--with-driver=xlib \
--disable-gl-osmesa \
--with-demos= \
--disable-egl \
--disable-glut \
--enable-motif \
CFLAGS="$(CFLAGS)"
confflags-swx11+glu-static = \
--with-driver=xlib \
--disable-gl-osmesa \
--enable-static \
--with-demos= \
--disable-egl \
--disable-glut \
--enable-motif \
CFLAGS="$(CFLAGS)"
confflags-swx11+glu-i386-i686 = \
--with-driver=xlib \
--disable-gl-osmesa \
--with-demos= \
--disable-glut \
--disable-egl \
--enable-motif \
--libdir=/usr/lib/i686/cmov \
CFLAGS="$(CFLAGS) -march=i686"
configure: $(QUILT_STAMPFN) configure.ac
autoreconf -vfi
# list the configurations that will built
configs:
@echo Building the following configurations: $(CONFIGS)
$(STAMP_DIR)/stamp:
dh_testdir
mkdir -p $(STAMP_DIR)
>$@
$(QUILT_STAMPFN): $(STAMP_DIR)/stamp
build: $(BUILD_STAMPS)
$(STAMP)-build-%: configure
dh_testdir
mkdir -p $(DEB_BUILD_DIR)/$*
find $(CURDIR)/* -maxdepth 0 -not -path '$(DEB_BUILD_DIR)*' | \
xargs cp -rlf -t $(DEB_BUILD_DIR)/$*
cd $(DEB_BUILD_DIR)/$* && \
../../configure --prefix=/usr --mandir=\$${prefix}/share/man \
--infodir=\$${prefix}/share/info --sysconfdir=/etc \
--localstatedir=/var $(confflags) $(confflags-$*)
cd $(DEB_BUILD_DIR)/$* && $(MAKE)
touch $@
install: build
# Add here commands to install the package into debian/tmp
dh_testdir
dh_testroot
dh_clean -k
dh_installdirs
set -e; for config in $(CONFIGS); do \
$(MAKE) -C $(DEB_BUILD_DIR)/$$config DESTDIR=$(CURDIR)/debian/tmp install; \
done
clean: unpatch
dh_testdir
dh_testroot
rm -rf .pc
rm -f config.cache config.log config.status
rm -f */config.cache */config.log */config.status
rm -f conftest* */conftest*
rm -rf autom4te.cache */autom4te.cache
rm -rf obj-*
rm -rf configure config.guess config.sub config.h.in
rm -rf $$(find -name Makefile.in)
rm -rf aclocal.m4 missing depcomp install-sh ltmain.sh
rm -rf $(STAMP_DIR)
dh_clean
# Build architecture-independent files here.
binary-indep: install
# Build architecture-dependent files here.
binary-arch: install
dh_testdir
dh_testroot
dh_installchangelogs -s
dh_installchangelogs -pmesa-common-dev ChangeLog
dh_installdocs -s
dh_installexamples -s
dh_install -s --sourcedir=debian/tmp --list-missing
dh_installman -s
dh_lintian -s
dh_link -s
dh_strip -plibgl1-mesa-swx11 --dbg-package=libgl1-mesa-swx11-dbg
dh_strip -plibgl1-mesa-glx --dbg-package=libgl1-mesa-glx-dbg
dh_strip -plibgl1-mesa-dri --dbg-package=libgl1-mesa-dri-dbg
dh_strip -s
dh_compress -s
dh_fixperms -s
dh_makeshlibs -s
dh_installdeb -s
dh_shlibdeps -s
dh_gencontrol -s
dh_md5sums -s
dh_builddeb -s
binary: binary-indep binary-arch
.PHONY: configs build clean binary-indep binary-arch binary install

58
debian/scripts/choose-configs vendored Normal file
View File

@@ -0,0 +1,58 @@
# Script to choose which configurations are to be built depending on the value
# of the DEB_BUILD_ARCH variable.
#
# Copyright © 2006 Thierry Reding <thierry@gilfi.de>
##############################################################################
## architecture-specific configurations ######################################
# choose an architecture-specific build of swx11 and GLU if a matching
# configuration exists
#ifneq ($(wildcard configs/debian-swx11+glu-$(DEB_BUILD_ARCH)),)
# SWX11_GLU_CONFIGS := debian-swx11+glu-$(DEB_BUILD_ARCH)
#else
# SWX11_GLU_CONFIGS := debian-swx11+glu-any
#endif
# same for static builds
#ifneq ($(wildcard configs/debian-swx11+glu-static-$(DEB_BUILD_ARCH)),)
# SWX11_GLU_CONFIGS += debian-swx11+glu-static-$(DEB_BUILD_ARCH)
#else
# SWX11_GLU_CONFIGS += debian-swx11+glu-static-any
#endif
SWX11_GLU_CONFIGS := swx11+glu swx11+glu-static
# and for the GLX/DRI-enabled libGL
ifneq ($(wildcard configs/debian-indirect-$(DEB_BUILD_ARCH)),)
DRI_CONFIGS := debian-indirect-$(DEB_BUILD_ARCH)
else
ifneq ($(wildcard configs/debian-dri-$(DEB_BUILD_ARCH)),)
DRI_CONFIGS := debian-dri-$(DEB_BUILD_ARCH)
else
DRI_CONFIGS := debian-dri-any
endif
endif
##############################################################################
## CPU-optimized configurations ##############################################
ifneq (,$(filter $(DEB_BUILD_ARCH), i386 kfreebsd-i386 hurd-i386))
SWX11_GLU_CONFIGS += swx11+glu-i386-i686
# DRI_CONFIGS += debian-dri-i386-i686
endif
#ifeq ($(DEB_BUILD_ARCH), alpha)
# SWX11_GLU_CONFIGS += debian-swx11+glu-alpha-ev5
#endif
#ifeq ($(DEB_BUILD_ARCH), powerpc)
# SWX11_GLU_CONFIGS += debian-swx11+glu-powerpc-603
#endif
#ifeq ($(DEB_BUILD_ARCH), sparc)
# SWX11_GLU_CONFIGS += debian-swx11+glu-sparc-ultrasparc
#endif
# vim: ft=make

3
debian/watch vendored Normal file
View File

@@ -0,0 +1,3 @@
version=3
opts="uversionmangle=s/-rc/~rc/" \
http://sf.net/mesa3d/MesaLib-(.*)\.tar\.gz

View File

@@ -1,230 +0,0 @@
Name
MESA_packed_depth_stencil
Name Strings
GL_MESA_packed_depth_stencil
Contact
Keith Whitwell, VA Linux Systems Inc. (keithw 'at' valinux.com)
Brian Paul, VA Linux Systems Inc. (brianp 'at' valinux.com)
Status
Obsolete.
Version
Number
???
Dependencies
EXT_abgr affects the definition of this extension
SGIS_texture4D affects the definition of this extension
EXT_cmyka affects the definition of this extension
ARB_packed_pixels affects the definition of this extension
Overview
Provides a mechanism for DrawPixels and ReadPixels to efficiently
transfer depth and stencil image data. Specifically, we defined new
packed pixel formats and types which pack both stencil and depth
into one value.
Issues:
1. Is this the right way to distinguish between 24/8 and 8/24
pixel formats? Should we instead provide both:
GL_DEPTH_STENCIL_MESA
GL_STENCIL_DEPTH_MESA
And perhaps just use GL_UNSIGNED_INT, GL_UNSIGNED_SHORT ?
2. If not, is it correct to use _REV to indicate that stencil
preceeds depth in the 1_15 and 8_24 formats?
3. Do we really want the GL_UNSIGNED_SHORT formats?
New Procedures and Functions
None.
New Tokens
Accepted by the <format> parameter of ReadPixels and DrawPixels:
GL_DEPTH_STENCIL_MESA 0x8750
Accepted by the <type> parameter of ReadPixels and DrawPixels:
GL_UNSIGNED_INT_24_8_MESA 0x8751
GL_UNSIGNED_INT_8_24_REV_MESA 0x8752
GL_UNSIGNED_SHORT_15_1_MESA 0x8753
GL_UNSIGNED_SHORT_1_15_REV_MESA 0x8754
Additions to Chapter 2 of the 1.1 Specification (OpenGL Operation)
None
Additions to Chapter 3 of the 1.1 Specification (Rasterization)
One entry is added to table 3.5 (DrawPixels and ReadPixels formats).
The new table is:
Target
Format Name Buffer Element Meaning and Order
----------- ------ -------------------------
COLOR_INDEX Color Color index
STENCIL_INDEX Stencil Stencil index
DEPTH_COMPONENT Depth Depth component
RED Color R component
GREEN Color G component
BLUE Color B component
ALPHA Color A component
RGB Color R, G, B components
RGBA Color R, G, B, A components
BGRA Color B, G, R, A components
ABGR_EXT Color A, B, G, R components
CMYK_EXT Color Cyan, Magenta, Yellow, Black components
CMYKA_EXT Color Cyan, Magenta, Yellow, Black, A components
LUMINANCE Color Luminance component
LUMINANCE_ALPHA Color Luminance, A components
DEPTH_STENCIL Depth, Depth component, stencil index.
Stencil
Table 3.5: DrawPixels and ReadPixels formats. The third column
gives a description of and the number and order of elements in a
group.
Add to the description of packed pixel formats:
<type> Parameter Data of Matching
Token Name Type Elements Pixel Formats
---------------- ---- -------- -------------
UNSIGNED_BYTE_3_3_2 ubyte 3 RGB
UNSIGNED_BYTE_2_3_3_REV ubyte 3 RGB
UNSIGNED_SHORT_5_6_5 ushort 3 RGB
UNSIGNED_SHORT_5_6_5_REV ushort 3 RGB
UNSIGNED_SHORT_4_4_4_4 ushort 4 RGBA,BGRA,ABGR_EXT,CMYK_EXT
UNSIGNED_SHORT_4_4_4_4_REV ushort 4 RGBA,BGRA
UNSIGNED_SHORT_5_5_5_1 ushort 4 RGBA,BGRA,ABGR_EXT,CMYK_EXT
UNSIGNED_SHORT_1_5_5_5_REV ushort 4 RGBA,BGRA
UNSIGNED_INT_8_8_8_8 uint 4 RGBA,BGRA,ABGR_EXT,CMYK_EXT
UNSIGNED_INT_8_8_8_8_REV uint 4 RGBA,BGRA
UNSIGNED_INT_10_10_10_2 uint 4 RGBA,BGRA,ABGR_EXT,CMYK_EXT
UNSIGNED_INT_2_10_10_10_REV uint 4 RGBA,BGRA
UNSIGNED_SHORT_15_1_MESA ushort 2 DEPTH_STENCIL_MESA
UNSIGNED_SHORT_1_15_REV_MESA ushort 2 DEPTH_STENCIL_MESA
UNSIGNED_SHORT_24_8_MESA ushort 2 DEPTH_STENCIL_MESA
UNSIGNED_SHORT_8_24_REV_MESA ushort 2 DEPTH_STENCIL_MESA
UNSIGNED_INT_8_24:
31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0
+-----------------------+-----------------------------------------------------------------------+
| | |
+-----------------------+-----------------------------------------------------------------------+
first second
element element
UNSIGNED_INT_24_8:
31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0
+----------------------------------------------------------------------+------------------------+
| | |
+----------------------------------------------------------------------+------------------------+
first second
element element
UNSIGNED_SHORT_15_1:
15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0
+-----------------------------------------------------------+---+
| | |
+-----------------------------------------------------------+---+
first second
element element
UNSIGNED_SHORT_1_15_REV:
15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0
+---+-----------------------------------------------------------+
| | |
+---+-----------------------------------------------------------+
second first
element element
The assignment of elements to fields in the packed pixel is as
described in the table below:
First Second Third Fourth
Format Element Element Element Element
------ ------- ------- ------- -------
RGB red green blue
RGBA red green blue alpha
BGRA blue green red alpha
ABGR_EXT alpha blue green red
CMYK_EXT cyan magenta yellow black
DEPTH_STENCIL_MESA depth stencil
Additions to Chapter 4 of the 1.1 Specification (Per-Fragment Operations
and the Frame Buffer)
The new format is added to the discussion of Obtaining Pixels from the
Framebuffer. It should read " If the <format> is one of RED, GREEN,
BLUE, ALPHA, RGB, RGBA, ABGR_EXT, LUMINANCE, or LUMINANCE_ALPHA, and
the GL is in color index mode, then the color index is obtained."
The new format is added to the discussion of Index Lookup. It should
read "If <format> is one of RED, GREEN, BLUE, ALPHA, RGB, RGBA,
ABGR_EXT, LUMINANCE, or LUMINANCE_ALPHA, then the index is used to
reference 4 tables of color components: PIXEL_MAP_I_TO_R,
PIXEL_MAP_I_TO_G, PIXEL_MAP_I_TO_B, and PIXEL_MAP_I_TO_A."
Additions to Chapter 5 of the 1.1 Specification (Special Functions)
None
Additions to Chapter 6 of the 1.1 Specification (State and State Requests)
None
Additions to the GLX Specification
None
GLX Protocol
TBD
Errors
None
New State
None
Revision History
Version 1.0 - 23 Sep 2000
Keith's original version.
Version 1.1 - 3 Nov 2000
Brian's edits, assigned values to new enums.

View File

@@ -1,356 +0,0 @@
Name
MESA_program_debug
Name Strings
GL_MESA_program_debug
Contact
Brian Paul (brian.paul 'at' tungstengraphics.com)
Status
XXX - Not complete yet!!!
Version
Last Modified Date: July 20, 2003
Author Revision: 1.0
Number
TBD
Dependencies
OpenGL 1.4 is required
The extension is written against the OpenGL 1.4 specification.
ARB_vertex_program or ARB_fragment_program or NV_vertex_program
or NV_fragment_program is required.
Overview
The extension provides facilities for implementing debuggers for
vertex and fragment programs.
The concept is that vertex and fragment program debuggers will be
implemented outside of the GL as a utility package. This extension
only provides the minimal hooks required to implement a debugger.
There are facilities to do the following:
1. Have the GL call a user-specified function prior to executing
each vertex or fragment instruction.
2. Query the current program string's execution position.
3. Query the current values of intermediate program values.
The main feature is the ProgramCallbackMESA function. It allows the
user to register a callback function with the GL. The callback will
be called prior to executing each vertex or fragment program instruction.
From within the callback, the user may issue Get* commands to
query current GL state. The GetProgramRegisterfvMESA function allows
current program values to be queried (such as temporaries, input
attributes, and result registers).
There are flags for enabling/disabling the program callbacks.
The current execution position (as an offset from the start of the
program string) can be queried with
GetIntegerv(GL_FRAGMENT_PROGRAM_POSITION_MESA, &pos) or
GetIntegerv(GL_VERTEX_PROGRAM_POSITION_MESA, &pos).
IP Status
None
Issues
1. Is this the right model for a debugger?
It seems prudent to minimize the scope of this extension and leave
it up to the developer (or developer community) to write debuggers
that layer on top of this extension.
If the debugger were fully implemented within the GL it's not
clear how terminal and GUI-based interfaces would work, for
example.
2. There aren't any other extensions that register callbacks with
the GL. Isn't there another solution?
If we want to be able to single-step through vertex/fragment
programs I don't see another way to do it.
3. How do we prevent the user from doing something crazy in the
callback function, like trying to call glBegin (leading to
recursion)?
The rule is that the callback function can only issue glGet*()
functions and no other GL commands. It could be difficult to
enforce this, however. Therefore, calling any non-get GL
command from within the callback will result in undefined
results.
4. Is this extension amenable to hardware implementation?
Hopefully, but if not, the GL implementation will have to fall
back to a software path when debugging. This may be acceptable
for debugging.
5. What's the <data> parameter to ProgramCallbackMESA for?
It's a common programming practice to associate a user-supplied
value with callback functions.
6. Debuggers often allow one to modify intermediate program values,
then continue. Does this extension support that?
No.
New Procedures and Functions (and datatypes)
typedef void (*programcallbackMESA)(enum target, void *data)
void ProgramCallbackMESA(enum target, programcallbackMESA callback,
void *data)
void GetProgramRegisterfvMESA(enum target, sizei len,
const ubyte *registerName, float *v)
New Tokens
Accepted by the <cap> parameter of Enable, Disable, IsEnabled,
GetBooleanv, GetDoublev, GetFloatv and GetIntegerv:
FRAGMENT_PROGRAM_CALLBACK_MESA 0x8bb1
VERTEX_PROGRAM_CALLBACK_MESA 0x8bb4
Accepted by the <pname> parameter GetBooleanv, GetDoublev,
GetFloatv and GetIntegerv:
FRAGMENT_PROGRAM_POSITION_MESA 0x8bb0
VERTEX_PROGRAM_POSITION_MESA 0x8bb4
Accepted by the <pname> parameter of GetPointerv:
FRAGMENT_PROGRAM_CALLBACK_FUNC_MESA 0x8bb2
FRAGMENT_PROGRAM_CALLBACK_DATA_MESA 0x8bb3
VERTEX_PROGRAM_CALLBACK_FUNC_MESA 0x8bb6
VERTEX_PROGRAM_CALLBACK_DATA_MESA 0x8bb7
Additions to Chapter 2 of the OpenGL 1.4 Specification (OpenGL Operation)
None.
Additions to Chapter 3 of the OpenGL 1.4 Specification (Rasterization)
None.
Additions to Chapter 4 of the OpenGL 1.4 Specification (Per-Fragment
Operations and the Frame Buffer)
None.
Additions to Chapter 5 of the OpenGL 1.4 Specification (Special Functions)
In section 5.4 "Display Lists", page 202, add the following command
to the list of those that are not compiled into display lists:
ProgramCallbackMESA.
Add a new section 5.7 "Callback Functions"
The function
void ProgramCallbackMESA(enum target, programcallbackMESA callback,
void *data)
registers a user-defined callback function with the GL. <target>
may be FRAGMENT_PROGRAM_ARB or VERTEX_PROGRAM_ARB. The enabled
callback functions registered with these targets will be called
prior to executing each instruction in the current fragment or
vertex program, respectively. The callbacks are enabled and
disabled by calling Enable or Disable with <cap>
FRAGMENT_PROGRAM_ARB or VERTEX_PROGRAM_ARB.
The callback function's signature must match the typedef
typedef void (*programcallbackMESA)(enum target, void *data)
When the callback function is called, <target> will either be
FRAGMENT_PROGRAM_ARB or VERTEX_PROGRAM_ARB to indicate which
program is currently executing and <data> will be the value
specified when ProgramCallbackMESA was called.
From within the callback function, only the following GL commands
may be called:
GetBooleanv
GetDoublev
GetFloatv
GetIntegerv
GetProgramLocalParameter
GetProgramEnvParameter
GetProgramRegisterfvMESA
GetProgramivARB
GetProgramStringARB
GetError
Calling any other command from within the callback results in
undefined behaviour.
Additions to Chapter 6 of the OpenGL 1.4 Specification (State and
State Requests)
Add a new section 6.1.3 "Program Value Queries":
The command
void GetProgramRegisterfvMESA(enum target, sizei len,
const ubyte *registerName,
float *v)
Is used to query the value of program variables and registers
during program execution. GetProgramRegisterfvMESA may only be
called from within a callback function registered with
ProgramCallbackMESA.
<registerName> and <len> specify the name a variable, input
attribute, temporary, or result register in the program string.
The current value of the named variable is returned as four
values in <v>. If <name> doesn't exist in the program string,
the error INVALID_OPERATION is generated.
Additions to Appendix A of the OpenGL 1.4 Specification (Invariance)
None.
Additions to the AGL/GLX/WGL Specifications
None.
GLX Protocol
XXX TBD
Dependencies on NV_vertex_program and NV_fragment_program
If NV_vertex_program and/or NV_fragment_program are supported,
vertex and/or fragment programs defined by those extensions may
be debugged as well. Register queries will use the syntax used
by those extensions (i.e. "v[X]" to query vertex attributes,
"o[X]" for vertex outputs, etc.)
Errors
INVALID_OPERATION is generated if ProgramCallbackMESA is called
between Begin and End.
INVALID_ENUM is generated by ProgramCallbackMESA if <target> is not
a supported vertex or fragment program type.
Note: INVALID_OPERAION IS NOT generated by GetProgramRegisterfvMESA,
GetBooleanv, GetDoublev, GetFloatv, or GetIntegerv if called between
Begin and End when a vertex or fragment program is currently executing.
INVALID_ENUM is generated by ProgramCallbackMESA,
GetProgramRegisterfvMESA if <target> is not a program target supported
by ARB_vertex_program, ARB_fragment_program (or NV_vertex_program or
NV_fragment_program).
INVALID_VALUE is generated by GetProgramRegisterfvMESA if <registerName>
does not name a known program register or variable.
INVALID_OPERATION is generated by GetProgramRegisterfvMESA when a
register query is attempted for a program target that's not currently
being executed.
New State
XXX finish
(table 6.N, p. ###)
Initial
Get Value Type Get Command Value Description Sec. Attribute
--------- ---- ----------- ----- ----------- ---- ---------
FRAGMENT_PROGRAM_CALLBACK_MESA B IsEnabled FALSE XXX XXX enable
VERTEX_PROGRAM_CALLBACK_MESA B IsEnabled FALSE XXX XXX enable
FRAGMENT_PROGRAM_POSITION_MESA Z+ GetIntegerv -1 XXX XXX -
VERTEX_PROGRAM_POSITION_MESA Z+ GetIntegerv -1 XXX XXX -
FRAGMENT_PROGRAM_CALLBACK_FUNC_MESA P GetPointerv NULL XXX XXX -
VERTEX_PROGRAM_CALLBACK_FUNC_MESA P GetPointerv NULL XXX XXX -
FRAGMENT_PROGRAM_CALLBACK_DATA_MESA P GetPointerv NULL XXX XXX -
VERTEX_PROGRAM_CALLBACK_DATA_MESA P GetPointerv NULL XXX XXX -
XXX more?
New Implementation Dependent State
None.
Revision History
8 July 2003
Initial draft. (Brian Paul)
11 July 2003
Second draft. (Brian Paul)
20 July 2003
Third draft. Lots of fundamental changes. (Brian Paul)
23 July 2003
Added chapter 5 and 6 spec language. (Brian Paul)
Example Usage
The following is a very simple example of how this extension may
be used to print the values of R0, R1, R2 and R3 while executing
vertex programs.
/* This is called by the GL when the vertex program is executing.
* We can only make glGet* calls from within this function!
*/
void DebugCallback(GLenum target, GLvoid *data)
{
GLint pos;
GLuint i;
/* Get PC and current instruction string */
glGetIntegerv(GL_VERTEX_PROGRAM_POSITION_ARB, &pos);
printf("Current position: %d\n", pos);
printf("Current temporary registers:\n");
for (i = 0; i < 4; i++) {
GLfloat v[4];
char s[10];
sprintf(s, "R%d", i);
glGetProgramRegisterfvMESA(GL_VERTEX_PROGRAM_ARB, strlen(s), s, v);
printf("R%d = %g, %g, %g, %g\n", i, v[0], v[1], v[2], v[3]);
}
}
/*
* elsewhere...
*/
/* Register our debugger callback function */
glProgramCallbackMESA(GL_VERTEX_PROGRAM_ARB, DebugCallback, NULL);
glEnable(GL_VERTEX_PROGRAM_CALLBACK_MESA);
/* define/bind a vertex program */
glEnable(GL_VERTEX_PROGRAM);
/* render something */
glBegin(GL_POINTS);
glVertex2f(0, 0);
glEnd();

View File

@@ -1,190 +0,0 @@
Name
MESA_sprite_point
Name Strings
GL_MESA_sprite_point
Contact
Brian Paul, VA Linux Systems Inc. (brianp 'at' valinux.com)
Status
Obsolete - see GL_ARB_point_sprite.
Version
Number
???
Dependencies
GL_EXT_point_parameters effects the definition of this extension
GL_ARB_multitexture effects the definition of this extension
Overview
This extension modifies the way in which points are rendered,
specifically when they're textured. When SPRITE_POINT_MESA is enabled
a point is rendered as if it were a quadrilateral with unique texture
coordinates at each vertex. This extension effectively turns points
into sprites which may be rendered more easily and quickly than using
conventional textured quadrilaterals.
When using point size > 1 or attenuated points this extension is an
effective way to render many small sprite images for particle systems
or other effects.
Issues:
1. How are the texture coordinates computed?
The lower-left corner has texture coordinate (0,0,r,q).
The lower-right, (1,0,r,q). The upper-right, (1,1,r,q).
The upper-left, (0,1,r,q).
2. What about texgen and texture matrices?
Texgen and the texture matrix have no effect on the point's s and t
texture coordinates. The r and q coordinates may have been computed
by texgen or the texture matrix. Note that with a 3D texture and/or
texgen that the r coordinate could be used to select a slice in the
3D texture.
3. What about point smoothing?
When point smoothing is enabled, a triangle fan could be rendered
to approximate a circular point. This could be problematic to
define and implement so POINT_SMOOTH is ignored when drawing sprite
points.
Smoothed points can be approximated by using an appropriate texture
images, alpha testing and blending.
POLYGON_SMOOTH does effect the rendering of the quadrilateral, however.
4. What about sprite rotation?
There is none. Sprite points are always rendered as window-aligned
squares. One could define rotated texture images if desired. A 3D
texture and appropriate texture r coordinates could be used to
effectively specify image rotation per point.
5. What about POLYGON_MODE?
POLYGON_MODE does not effect the rasterization of the quadrilateral.
6. What about POLYGON_CULL?
TBD. Polygon culling is normally specified and implemented in the
transformation stage of OpenGL. However, some rasterization hardware
implements it later during triangle setup.
Polygon culling wouldn't be useful for sprite points since the
quadrilaterals are always defined in counter-clockwise order in
window space. For that reason, polygon culling should probably be
ignored.
7. Should sprite points be alpha-attenuated if their size is below the
point parameter's threshold size?
8. Should there be an advertisized maximum sprite point size?
No. Since we're rendering the point as a quadrilateral there's no
need to limit the size.
New Procedures and Functions
None.
New Tokens
Accepted by the <pname> parameter of Enable, Disable, IsEnabled,
GetIntegerv, GetBooleanv, GetFloatv and GetDoublev:
SPRITE_POINT_MESA 0x????
MAX_SPRITE_POINT_SIZE_MESA 0x???? (need this?)
Additions to Chapter 2 of the 1.1 Specification (OpenGL Operation)
None
Additions to Chapter 3 of the 1.1 Specification (Rasterization)
Section ???.
When SPRITE_POINT_MESA is enabled points are rasterized as screen-
aligned quadrilaterals. If the four vertices of the quadrilateral
are labeled A, B, C, and D, starting at the lower-left corner and moving
counter-clockwise around the quadrilateral, then the vertex and
texture coordinates are computed as follows:
vertex window coordinate texture coordinate
A (x-r, y-r, z, w) (0, 0, r, q)
B (x+r, y-r, z, w) (1, 0, r, q)
C (x+r, y+r, z, w) (1, 1, r, q)
D (x-r, y+r, z, w) (0, 1, r, q)
where x, y, z, w are the point's window coordinates, r and q are the
point's 3rd and 4th texture coordinates and r is half the point's
size. The other vertex attributes (such as the color and fog coordinate)
are simply duplicated from the original point vertex.
Point size may either be specified with PointSize or computed
according to the EXT_point_parameters extension.
The new texture coordinates are not effected by texgen or the texture
matrix. Note, however, that the texture r and q coordinates are passed
unchanged and may have been computed with texgen and/or the texture
matrix.
If multiple texture units are present the same texture coordinate is
used for all texture units.
The point is then rendered as if it were a quadrilateral using the
normal point sampling rules. POLYGON_MODE does not effect the
rasterization of the quadrilateral but POLYGON_SMOOTH does.
POINT_SMOOTH has no effect when SPRITE_POINT_MESA is enabled.
Additions to Chapter 4 of the 1.1 Specification (Per-Fragment Operations
and the Frame Buffer)
None.
Additions to Chapter 5 of the 1.1 Specification (Special Functions)
None
Additions to Chapter 6 of the 1.1 Specification (State and State Requests)
None
Additions to the GLX Specification
None
GLX Protocol
TBD
Errors
None
New State
Add boolean variable SPRITE_POINT_MESA to the point attribute group.
Revision History
Version 1.0 - 4 Dec 2000
Original draft.

View File

@@ -1,359 +0,0 @@
Name
MESA_trace
Name Strings
GL_MESA_trace
Contact
Bernd Kreimeier, Loki Entertainment, bk 'at' lokigames.com
Brian Paul, VA Linux Systems, Inc., brianp 'at' valinux.com
Status
Obsolete.
Version
Number
none yet
Dependencies
OpenGL 1.2 is required.
The extension is written against the OpenGL 1.2 Specification
Overview
Provides the application with means to enable and disable logging
of GL calls including parameters as readable text. The verbosity
of the generated log can be controlled. The resulting logs are
valid (but possibly incomplete) C code and can be compiled and
linked for standalone test programs. The set of calls and the
amount of static data that is logged can be controlled at runtime.
The application can add comments and enable or disable tracing of GL
operations at any time. The data flow from the application to GL
and back is unaffected except for timing.
Application-side implementation of these features raises namespace
and linkage issues. In the driver dispatch table a simple
"chain of responsibility" pattern (aka "composable piepline")
can be added.
IP Status
The extension spec is in the public domain. The current implementation
in Mesa is covered by Mesa's XFree86-style copyright by the authors above.
This extension is partially inspired by the Quake2 QGL wrapper.
Issues
(1) Is this Extension obsolete because it can
be implemented as a wrapper DLL?
RESOLVED: No. While certain operating systems (Win32) provide linkers
that facilitate this kind of solution, other operating systems
(Linux) do not support hierarchical linking, so a wrapper solution
would result in symbol collisions.
Further, IHV's might have builtin support for tracing GL execution
that enjoys privileged access, or that they do not wish to separate
the tracing code from their driver code base.
(2) Should the Trace API explicitely support the notion of "frames?
This would require hooking into glXSwapBuffers calls as well.
RESOLVED: No. The application can use NewTraceMESA/EndTraceMESA
and TraceComment along with external parsing tools to split the
trace into frames, in whatever way considered adequate.
(2a) Should GLX calls be traced?
PBuffers and other render-to-texture solutions demonstrate that
context level commands beyond SwapBuffers might have to be
traced. The GL DLL exports the entry points, so this would not
be out of the question.
(3) Should the specification mandate the actual output format?
RESOLVED: No. It is sufficient to guarantee that all data and commands
will be traced as requested by Enable/DisableTraceMESA, in the order
encountered. Whether the resulting trace is available as a readable
text file, binary metafile, compilable source code, much less which
indentation and formatting has been used, is up to the implementation.
For the same reason this specification does not enforce or prohibit
additional information added to the trace (statistics, profiling/timing,
warnings on possible error conditions).
(4) Should the comment strings associated with names and pointer (ranges)
be considered persistent state?
RESOLVED: No. The implementation is not forced to use this information
on subsequent occurences of name/pointer, and is free to consider it
transient state.
(5) Should comment commands be prohibited between Begin/End?
RESOLVED: Yes, with the exception of TraceCommentMESA. TraceCommentMESA
is transient, the other commands might cause storage of persistent
data in the context. There is no need to have the ability mark names
or pointers between Begin and End.
New Procedures and Functions
void NewTraceMESA( bitfield mask, const ubyte * traceName )
void EndTraceMESA( void )
void EnableTraceMESA( bitfield mask )
void DisableTraceMESA( bitfield mask )
void TraceAssertAttribMESA( bitfield attribMask )
void TraceCommentMESA( const ubyte* comment )
void TraceTextureMESA( uint name, const ubyte* comment )
void TraceListMESA( uint name, const ubyte* comment )
void TracePointerMESA( void* pointer, const ubyte* comment )
void TracePointerRangeMESA( const void* first,
const void* last,
const ubyte* comment )
New Tokens
Accepted by the <mask> parameter of EnableTrace and DisableTrace:
TRACE_ALL_BITS_MESA 0xFFFF
TRACE_OPERATIONS_BIT_MESA 0x0001
TRACE_PRIMITIVES_BIT_MESA 0x0002
TRACE_ARRAYS_BIT_MESA 0x0004
TRACE_TEXTURES_BIT_MESA 0x0008
TRACE_PIXELS_BIT_MESA 0x0010
TRACE_ERRORS_BIT_MESA 0x0020
Accepted by the <pname> parameter of GetIntegerv, GetBooleanv,
GetFloatv, and GetDoublev:
TRACE_MASK_MESA 0x8755
Accepted by the <pname> parameter to GetString:
TRACE_NAME_MESA 0x8756
Additions to Chapter 2 of the OpenGL 1.2.1 Specification (OpenGL Operation)
None.
Additions to Chapter 3 of the OpenGL 1.2.1 Specification (OpenGL Operation)
None.
Additions to Chapter 4 of the OpenGL 1.2.1 Specification (OpenGL Operation)
None.
Additions to Chapter 5 of the OpenGL 1.2.1 Specification (Special Functions)
Add a new section:
5.7 Tracing
The tracing facility is used to record the execution of a GL program
to a human-readable log. The log appears as a sequence of GL commands
using C syntax. The primary intention of tracing is to aid in program
debugging.
A trace is started with the command
void NewTraceMESA( bitfield mask, const GLubyte * traceName )
<mask> may be any value accepted by PushAttrib and specifies a set of
attribute groups. The state values included in those attribute groups
is written to the trace as a sequence of GL commands.
<traceName> specifies a name or label for the trace. It is expected
that <traceName> will be interpreted as a filename in most implementations.
A trace is ended by calling the command
void EndTraceMESA( void )
It is illegal to call NewTraceMESA or EndTraceMESA between Begin and End.
The commands
void EnableTraceMESA( bitfield mask )
void DisableTraceMESA( bitfield mask )
enable or disable tracing of different classes of GL commands.
<mask> may be the union of any of TRACE_OPERATIONS_BIT_MESA,
TRACE_PRIMITIVES_BIT_MESA, TRACE_ARRAYS_BIT_MESA, TRACE_TEXTURES_BIT_MESA,
and TRACE_PIXELS_BIT_MESA. The special token TRACE_ALL_BITS_MESA
indicates all classes of commands are to be logged.
TRACE_OPERATIONS_BIT_MESA controls logging of all commands outside of
Begin/End, including Begin/End.
TRACE_PRIMITIVES_BIT_MESA controls logging of all commands inside of
Begin/End, including Begin/End.
TRACE_ARRAYS_BIT_MESA controls logging of VertexPointer, NormalPointer,
ColorPointer, IndexPointer, TexCoordPointer and EdgeFlagPointer commands.
TRACE_TEXTURES_BIT_MESA controls logging of texture data dereferenced by
TexImage1D, TexImage2D, TexImage3D, TexSubImage1D, TexSubImage2D, and
TexSubImage3D commands.
TRACE_PIXELS_BIT_MESA controls logging of image data dereferenced by
Bitmap and DrawPixels commands.
TRACE_ERRORS_BIT_MESA controls logging of all errors. If this bit is
set, GetError will be executed whereever applicable, and the result will
be added to the trace as a comment. The error returns are cached and
returned to the application on its GetError calls. If the user does not
wish the additional GetError calls to be performed, this bit should not
be set.
The command
void TraceCommentMESA( const ubyte* comment )
immediately adds the <comment> string to the trace output, surrounded
by C-style comment delimiters.
The commands
void TraceTextureMESA( uint name, const ubyte* comment )
void TraceListMESA( uint name, const ubyte* comment )
associates <comment> with the texture object or display list specified
by <name>. Logged commands which reference the named texture object or
display list will be annotated with <comment>. If IsTexture(name) or
IsList(name) fail (respectively) the command is quietly ignored.
The commands
void TracePointerMESA( void* pointer, const ubyte* comment )
void TracePointerRangeMESA( const void* first,
const void* last,
const ubyte* comment )
associate <comment> with the address specified by <pointer> or with
a range of addresses specified by <first> through <last>.
Any logged commands which reference <pointer> or an address between
<first> and <last> will be annotated with <comment>.
The command
void TraceAssertAttribMESA( bitfield attribMask )
will add GL state queries and assertion statements to the log to
confirm that the current state at the time TraceAssertAttrib is
executed matches the current state when the trace log is executed
in the future.
<attribMask> is any value accepted by PushAttrib and specifies
the groups of state variables which are to be asserted.
The commands NewTraceMESA, EndTraceMESA, EnableTraceMESA, DisableTraceMESA,
TraceAssertAttribMESA, TraceCommentMESA, TraceTextureMESA, TraceListMESA,
TracePointerMESA and TracePointerRangeMESA are not compiled into display lists.
Examples:
The command NewTraceMESA(DEPTH_BUFFER_BIT, "log") will query the state
variables DEPTH_TEST, DEPTH_FUNC, DEPTH_WRITEMASK, and DEPTH_CLEAR_VALUE
to get the values <test>, <func>, <mask>, and <clear> respectively.
Statements equivalent to the following will then be logged:
glEnable(GL_DEPTH_TEST); (if <test> is true)
glDisable(GL_DEPTH_TEST); (if <test> is false)
glDepthFunc(<func>);
glDepthMask(<mask>);
glClearDepth(<clear>);
The command TraceAssertAttribMESA(DEPTH_BUFFER_BIT) will query the state
variables DEPTH_TEST, DEPTH_FUNC, DEPTH_WRITEMASK, and DEPTH_CLEAR_VALUE
to get the values <test>, <func>, <mask>, and <clear> respectively.
The resulting trace might then look will like this:
{
GLboolean b;
GLint i;
GLfloat f;
b = glIsEnabled(GL_DEPTH_TEST);
assert(b == <test>);
glGetIntegerv(GL_DEPTH_FUNC, &i);
assert(i == <func>);
glGetIntegerv(GL_DEPTH_MASK, &i);
assert(i == <mask>);
glGetFloatv(GL_DEPTH_CLEAR_VALUE, &f);
assert(f == <clear>);
}
Additions to Chapter 6 of the OpenGL 1.2.1 Specification
(State and State Requests)
Querying TRACE_MASK_MESA with GetIntegerv, GetFloatv, GetBooleanv or
GetDoublev returns the current command class trace mask.
Querying TRACE_NAME_MESA with GetString returns the current trace name.
Additions to Appendix A of the OpenGL 1.2.1 Specification (Invariance)
The MESA_trace extension can be used in a way that does not affect data
flow from application to OpenGL, as well as data flow from OpenGL to
application, except for timing, possible print I/O. TRACE_ERRORS_BIT_MESA
will add additional GetError queries. Setting a trace mask with NewTraceMESA
as well as use of TraceAssertAttribMESA might cause additional state queries.
With the possible exception of performance, OpenGL rendering should not be
affected at all by a properly chosen logging operation.
Additions to the AGL/GLX/WGL Specifications
None.
GLX Protocol
None. The logging operation is carried out client-side, by exporting
entry points to the wrapper functions that execute the logging operation.
Errors
INVALID_OPERATION is generated if any trace command except TraceCommentMESA
is called between Begin and End.
New State
The current trace name and current command class mask are stored
per-context.
New Implementation Dependent State
None.
Revision History
* Revision 0.1 - Initial draft from template (bk000415)
* Revision 0.2 - Draft (bk000906)
* Revision 0.3 - Draft (bk000913)
* Revision 0.4 - Reworked text, fixed typos (bp000914)
* Revision 0.5 - Assigned final GLenum values (bp001103)
* Revision 0.6 - TRACE_ERRORS_BIT_MESA (bk000916)
* Revision 0.7 - Added MESA postfix (bk010126)

View File

@@ -27,12 +27,6 @@ using the SDK with Visual Studio Express can be found at
http://msdn.microsoft.com/vstudio/express/visualc/usingpsdk/
If you are stuck using VC6 or VC7, you may start with these project
files, but you may need to modify them to reflect changes in the
Mesa source code tree. If you sucessfully update the project files,
please submit them to the author of this document so that they may
be included in the next distribution.
The project files to build the core Mesa library, Windows Mesa
drivers, OSMesa, and GLU are in the mesa directory. The project files
to build GLUT and some demo programs are in the progs directory.
@@ -106,23 +100,6 @@ should build all the demos.
Build System Notes
----- ------ -----
VC6 (not actively supported)
---
Visual Studio 6 does not recognize files with the .cc extension as C++
language files, without a lot of unnatural tweaking. So, the VC6
build process uses custom build steps to compile these files in the
GLU library.
Two additional configurations are provided, Debug x86 and Release x86
that activate the shader code compilation by defining SLANG_86. It is
unknown if and how this works.
VC7 (not actively supported)
---
The above-mentioned .cc problem does not exist in this version.
VC8
---

View File

@@ -198,7 +198,7 @@ few preprocessor defines.</p>
<ul>
<li>If <tt>GLX_USE_TLS</tt> is defined, method #4 is used.</li>
<li>If <tt>PTHREADS</tt> is defined, method #3 is used.</li>
<li>If any of <tt>PTHREADS</tt>, <tt>USE_XTHREADS</tt>,
<li>If any of <tt>PTHREADS</tt>,
<tt>SOLARIS_THREADS</tt>, <tt>WIN32_THREADS</tt>, or <tt>BEOS_THREADS</tt>
is defined, method #2 is used.</li>
<li>If none of the preceeding are defined, method #1 is used.</li>

View File

@@ -25,6 +25,9 @@ fragment programs (intended for developers only)
<li>MESA_TNL_PROG - if set, implement conventional vertex transformation
operations with vertex programs (intended for developers only).
Setting this variable automatically sets the MESA_TEX_PROG variable as well.
<li>MESA_EXTENSION_OVERRIDE - can be used to enable/disable extensions.
A value such as "GL_EXT_foo -GL_EXT_bar" will enable the GL_EXT_foo extension
and disable the GL_EXT_bar extension.
</ul>
<p>

Binary file not shown.

Before

Width:  |  Height:  |  Size: 1.6 KiB

View File

@@ -10,6 +10,24 @@
<H1>News</H1>
<h2>November XX, 2009</h2>
<p>
<a href="relnotes-7.6.1.html">Mesa 7.6.1</a> is released. This is a bug-fix
release fixing issues found in the 7.6 release.
</p>
<h2>September 28, 2009</h2>
<p>
<a href="relnotes-7.6.html">Mesa 7.6</a> is released. This is a new feature
release. Those especially concerned about stability may want to wait for the
follow-on 7.6.1 bug-fix release.
</p>
<p>
<a href="relnotes-7.5.2.html">Mesa 7.5.2</a> is also released.
This is a stable release fixing bugs since the 7.5.1 release.
</p>
<h2>September 3, 2009</h2>
<p>

68
docs/openvg.html Normal file
View File

@@ -0,0 +1,68 @@
<HTML>
<TITLE>Mesa Release Notes</TITLE>
<head><link rel="stylesheet" type="text/css" href="mesa.css"></head>
<BODY>
<body bgcolor="#eeeeee">
<H1>OpenVG State Tracker</H1>
<p>
The current version of the OpenVG state tracker implements OpenVG 1.0.
</p>
<p>
More informations about OpenVG can be found at
<a href="http://www.khronos.org/openvg/" target="_parent">
http://www.khronos.org/openvg/</a> .
</p>
<p>
The OpenVG state tracker depends on the Gallium architecture and a working EGL implementation.
</p>
<h2>Building the library</h2>
<ol>
<li>Build Mesa3D with Gallium3D. Any build that builds Gallium3D libraries and EGL will suffice</li>
<li>cd src/gallium/state_trackers/vega; make</li>
<li>The last step will build libOpenVG library. You can add the libdir to LD_LIBRARY_PATH or install libOpenVG</li>
</ol>
<h3>Sample build</h3>
A sample build looks as follows:
<pre>
make linux-x86-64-debug
cd src/gallium/state_trackers/vega
make
cd ../../../..
export LD_LIBRARY_PATH=$PWD/lib64
export EGL_DRIVER="egl_softpipe"
</pre>
<h2>OpenVG Demos</h2>
<p>
To build the OpenVG demos:
</p>
<pre>
cd progs/openvg
make
</pre>
<p>
To run a demo:
</p>
<pre>
cd openvg/demos
./lion
</pre>
<h2>Notes</h2>
<ul>
<li>EGL_DRIVER environmental variable: forces usage of a specific EGL driver. Unless you force egl_softpipe the implementation will look for a DRI hardware accelerate driver and unless you have a Gallium driver that supports it, you'll see crashes</li>
</ul>
</body>
</html>

View File

@@ -8,7 +8,7 @@
<body bgcolor="#eeeeee">
<H1>Mesa 7.5.2 Release Notes, (date tbd)</H1>
<H1>Mesa 7.5.2 Release Notes, 28 September 2009</H1>
<p>
Mesa 7.5.2 is a bug-fix release fixing issues found since the 7.5.1 release.
@@ -31,7 +31,15 @@ for DRI hardware acceleration.
<h2>MD5 checksums</h2>
<pre>
tbd
43a90191dd9f76cd65dcc1ac91f3be70 MesaLib-7.5.2.tar.gz
94e47a499f1226803869c2e37a6a8e3a MesaLib-7.5.2.tar.bz2
1ecb822b567ad67a0617361d45206b67 MesaLib-7.5.2.zip
2718fdce7e075911d6147beb8f27104b MesaDemos-7.5.2.tar.gz
4e0f5ccd58afe21eddcd94327d926e86 MesaDemos-7.5.2.tar.bz2
f621f8c223b278d7c8e49a012d56ca25 MesaDemos-7.5.2.zip
83c16c1d6bcfcc3f97aab5d2fe430b4c MesaGLUT-7.5.2.tar.gz
e5d03bedae369ea3705783573bb33813 MesaGLUT-7.5.2.tar.bz2
e82ba28e00d653e6f437d32be8ca8481 MesaGLUT-7.5.2.zip
</pre>
@@ -49,8 +57,11 @@ tbd
(such as bug 23946)
<li>glUseProgram() is now compiled into display lists (bug 23746).
<li>glUniform functions are now compiled into display lists
<li>Auto mipmap generation didn't work reliably with Gallium.
<li>Fixed random number usage in GLX code.
<li>Fixed invalid GL_OUT_OF_MEMORY error sometimes raised by glTexSubImage2D
when using Gallium.
</ul>
</body>
</html>

70
docs/relnotes-7.6.1.html Normal file
View File

@@ -0,0 +1,70 @@
<HTML>
<TITLE>Mesa Release Notes</TITLE>
<head><link rel="stylesheet" type="text/css" href="mesa.css"></head>
<BODY>
<body bgcolor="#eeeeee">
<H1>Mesa 7.6.1 Release Notes, (date tbd)</H1>
<p>
Mesa 7.6.1 is a bug-fix release fixing issues since version 7.6.
</p>
<p>
Mesa 7.6.1 implements the OpenGL 2.1 API, but the version reported by
glGetString(GL_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 2.1.
</p>
<p>
See the <a href="install.html">Compiling/Installing page</a> for prerequisites
for DRI hardware acceleration.
</p>
<h2>MD5 checksums</h2>
<pre>
tbd
</pre>
<h2>New features</h2>
<ul>
<li>Upgraded GL/glext.h to version 56, GL/glxext.h to version 25,
GL/wglext.h to version 17
<li>New 3D driver, r600, for Radeon R6xx, R7xx hardware
</ul>
<h2>Bug fixes</h2>
<ul>
<li>Fixed crash caused by glXCopyContext() and glXDestroyContext(), bug 24217
<li>glXQueryContext(GLX_RENDER_TYPE) returned wrong values (bug 24211)
<li>GLSL sqrt(0) returned unpredictable results
<li>Fixed default texture binding bug when a bound texture was deleted.
<li>r300: Work around an issue with very large fragment programs on R500.
<li>Fake glXQueryDrawable() didn't return good values (bug 24320)
<li>Fixed AUX buffer breakage (bug 24426).
<li>Fixed locale-dependent float parsing bug in GLSL compiler (bug 24531)
<li>Fixed Gallium Cell driver compilation failure.
<li>Fixed glGetTexLevelParameter(GL_TEXTURE_INTERNAL_FORMAT) query so that
it returns the actual compressed format chosen.
<li>Fixed glBitmap bugs in Intel drivers.
<li>Fixed a number of Microsoft Visual Studio compilation problems.
<li>Fixed clipping / provoking vertex bugs in i965 driver.
<li>Assorted build fixes for AIX.
<li>Endianness fixes for the DRI swrast driver (bug 22767).</li>
<li>Point sprite fixes for i915/945 driver.
<li>Fixed assorted memory leaks (usually on error paths)
</ul>
<h2>Changes</h2>
<ul>
<li>Removed old VC6, VC7 project files for Windows
</ul>
</body>
</html>

84
docs/relnotes-7.6.html Normal file
View File

@@ -0,0 +1,84 @@
<HTML>
<TITLE>Mesa Release Notes</TITLE>
<head><link rel="stylesheet" type="text/css" href="mesa.css"></head>
<BODY>
<body bgcolor="#eeeeee">
<H1>Mesa 7.6 Release Notes, 28 September 2009</H1>
<p>
Mesa 7.6 is a new development release.
People who are concerned with stability and reliability should stick
with a previous release or wait for Mesa 7.6.1.
</p>
<p>
Mesa 7.6 implements the OpenGL 2.1 API, but the version reported by
glGetString(GL_VERSION) depends on the particular driver being used.
Some drivers don't support all the features required in OpenGL 2.1.
</p>
<p>
See the <a href="install.html">Compiling/Installing page</a> for prerequisites
for DRI hardware acceleration.
</p>
<h2>MD5 checksums</h2>
<pre>
5ffa7d7abf8973f57a1bc4f813e6dade MesaLib-7.6.tar.gz
8c75f90cd0303cfac9e4b6d54f6759ca MesaLib-7.6.tar.bz2
27fcfd69708599c978cb34ba5cd363e1 MesaLib-7.6.zip
e7befb3ae604f591806194a4da445628 MesaDemos-7.6.tar.gz
0ede7adf217951acd90dbe4551210c07 MesaDemos-7.6.tar.bz2
ed9298409cf6613bc0964525ca4afc8a MesaDemos-7.6.zip
666955668e44ff14acf7d15dc78407d3 MesaGLUT-7.6.tar.gz
b8b59706f827d18d1b784a0ff98b4dc2 MesaGLUT-7.6.tar.bz2
c49c19c2bbef4f3b7f1389974dff25f4 MesaGLUT-7.6.zip
</pre>
<h2>New features</h2>
<ul>
<li><a href="openvg.html">OpenVG</a> front-end (state tracker for Gallium).
This was written by Zack Rusin at Tungsten Graphics.
<li>GL_ARB_vertex_array_object and GL_APPLE_vertex_array_object extensions
(supported in Gallium drivers, Intel DRI drivers, and software drivers)</li>
<li>GL_ARB_copy_buffer extension
(supported in Gallium drivers, Intel DRI drivers, and software drivers)</li>
<li>GL_ARB_map_buffer_range extension
(supported in Gallium drivers, Intel DRI drivers, and software drivers)</li>
<li>GL_ARB_seamless_cube_map extension
(supported in software drivers and i965 drivers)</li>
<li>GL_ARB_vertex_array_bgra (ARB synonym for GL_EXT_vertex_array_bgra)</li>
<li>GL_ARB_sync (supported in software drivers and Intel DRI drivers)</li>
<li>GL_EXT_provoking_vertex extension (supported in Gallium, i915, i965, and software drivers)
<li>Rewritten radeon/r200/r300 driver using a buffer manager
<li>radeon/r200/r300 GL_EXT_framebuffer_object support when used with
kernel memory manager
<li>radeon/r200/r300 support for GL_ARB_occlusion_query</li>
<li>r300 driver supports OpenGL 1.5</li>
<li>r300 driver support for GL_EXT_vertex_array_bgra, GL_EXT_texture_sRGB
<li>i915/945 driver support for GL_ARB_point_sprite, GL_EXT_stencil_two_side
and GL_ATI_separate_stencil extensions
<li>Rewritten assembler for GL_ARB_vertex_program /
GL_ARB_fragment_program.</li>
<li>Added configure --with-max-width=W, --with-max-height=H options to specify
max framebuffer, viewport size.
<li>Initial version of Gallium llvmpipe driver. This is a new driver based
on LLVM which makes exensive use of run-time code generation. This is
an "alpha" stage driver. See the src/gallium/drivers/llvmpipe/README
file for more information.
</ul>
<h2>Bug fixes</h2>
<ul>
<li>i965 DRI driver fixes, including support for "unlimited" size constant
buffers (GLSL uniforms)
</ul>
</body>
</html>

View File

@@ -13,6 +13,8 @@ The release notes summarize what's new or changed in each Mesa release.
</p>
<UL>
<LI><A HREF="relnotes-7.6.1.html">7.6.1 release notes</A>
<LI><A HREF="relnotes-7.6.html">7.6 release notes</A>
<LI><A HREF="relnotes-7.5.2.html">7.5.2 release notes</A>
<LI><A HREF="relnotes-7.5.1.html">7.5.1 release notes</A>
<LI><A HREF="relnotes-7.5.html">7.5 release notes</A>

21
doxygen/.gitignore vendored
View File

@@ -1,21 +0,0 @@
*.tag
*.tmp
agpgart
array_cache
core
core_subset
gallium
glapi
main
math
math_subset
miniglx
radeondrm
radeonfb
radeon_subset
shader
swrast
swrast_setup
tnl
tnl_dd
vbo

View File

@@ -1,33 +0,0 @@
default: full
all: full subset
%.tag: %.doxy
doxygen $<
FULL = \
main.doxy \
math.doxy \
vbo.doxy \
glapi.doxy \
shader.doxy \
swrast.doxy \
swrast_setup.doxy \
tnl.doxy \
tnl_dd.doxy
full: $(FULL:.doxy=.tag)
$(foreach FILE,$(FULL),doxygen $(FILE);)
SUBSET = \
main.doxy \
math.doxy \
miniglx.doxy
subset: $(SUBSET:.doxy=.tag)
$(foreach FILE,$(SUBSET),doxygen $(FILE);)
clean:
-rm -rf $(FULL:.doxy=) $(SUBSET:.doxy=)
-rm -rf *.tag

View File

@@ -1,10 +0,0 @@
This directory is for doxygen (a source code documentation system).
See http://www.doxygen.org/ for more info.
Either run 'make' (Unix) or 'doxy.bat' (Windows) to run doxygen
and generate souce code documentation.
Then, load either doxygen/main/index.html or doxygen/core_subset/index.html into
your web browser.

File diff suppressed because it is too large Load Diff

View File

@@ -1,226 +0,0 @@
# Doxyfile 0.1
#---------------------------------------------------------------------------
# General configuration options
#---------------------------------------------------------------------------
PROJECT_NAME = "Mesa Main"
PROJECT_NUMBER =
OUTPUT_DIRECTORY =
OUTPUT_LANGUAGE = English
EXTRACT_ALL = NO
EXTRACT_PRIVATE = NO
EXTRACT_STATIC = YES
EXTRACT_LOCAL_CLASSES = YES
HIDE_UNDOC_MEMBERS = NO
HIDE_UNDOC_CLASSES = NO
BRIEF_MEMBER_DESC = YES
REPEAT_BRIEF = YES
ALWAYS_DETAILED_SEC = NO
INLINE_INHERITED_MEMB = NO
FULL_PATH_NAMES = NO
STRIP_FROM_PATH =
INTERNAL_DOCS = YES
STRIP_CODE_COMMENTS = YES
CASE_SENSE_NAMES = YES
SHORT_NAMES = NO
HIDE_SCOPE_NAMES = NO
VERBATIM_HEADERS = YES
SHOW_INCLUDE_FILES = YES
JAVADOC_AUTOBRIEF = NO
INHERIT_DOCS = YES
INLINE_INFO = YES
SORT_MEMBER_DOCS = NO
DISTRIBUTE_GROUP_DOC = NO
TAB_SIZE = 8
GENERATE_TODOLIST = YES
GENERATE_TESTLIST = YES
GENERATE_BUGLIST = YES
ALIASES =
ENABLED_SECTIONS = subset
MAX_INITIALIZER_LINES = 30
OPTIMIZE_OUTPUT_FOR_C = NO
SHOW_USED_FILES = YES
#---------------------------------------------------------------------------
# configuration options related to warning and progress messages
#---------------------------------------------------------------------------
QUIET = YES
WARNINGS = YES
WARN_IF_UNDOCUMENTED = NO
WARN_FORMAT =
WARN_LOGFILE =
#---------------------------------------------------------------------------
# configuration options related to the input files
#---------------------------------------------------------------------------
INPUT = ../src/mesa/main/
FILE_PATTERNS = \
accum.h \
attrib.h \
blend.[ch] \
buffers.[ch] \
dd.h \
debug.h \
depth.h \
dlist.h \
context.[ch] \
config.h \
colormac.h \
colortab.h \
enable.h \
enums.h \
eval.h \
extensions.h \
feedback.[ch] \
fog.h \
get.h \
glheader.h \
glthread.h \
hash.[ch] \
hint.h \
histogram.h \
image.[ch] \
imports.[ch] \
lines.[ch] \
light.h \
matrix.[ch] \
macros.h \
mmath.h \
mtypes.h \
pixel.h \
points.[ch] \
polygon.[ch] \
rastpos.[ch] \
simple_list.h \
state.[ch] \
stencil.[ch] \
subset_*.c \
texformat.h \
teximage.h \
texstate.h \
texstore.h \
texobj.[ch] \
texutil_tmp.h \
varray.h
RECURSIVE = NO
EXCLUDE =
EXCLUDE_PATTERNS =
EXAMPLE_PATH =
EXAMPLE_PATTERNS =
EXAMPLE_RECURSIVE = NO
IMAGE_PATH =
INPUT_FILTER =
FILTER_SOURCE_FILES = NO
#---------------------------------------------------------------------------
# configuration options related to source browsing
#---------------------------------------------------------------------------
SOURCE_BROWSER = YES
INLINE_SOURCES = NO
REFERENCED_BY_RELATION = YES
REFERENCES_RELATION = YES
#---------------------------------------------------------------------------
# configuration options related to the alphabetical class index
#---------------------------------------------------------------------------
ALPHABETICAL_INDEX = NO
COLS_IN_ALPHA_INDEX = 5
IGNORE_PREFIX =
#---------------------------------------------------------------------------
# configuration options related to the HTML output
#---------------------------------------------------------------------------
GENERATE_HTML = YES
HTML_OUTPUT = core_subset
HTML_HEADER = header_subset.html
HTML_FOOTER =
HTML_STYLESHEET =
HTML_ALIGN_MEMBERS = YES
GENERATE_HTMLHELP = NO
GENERATE_CHI = NO
BINARY_TOC = NO
TOC_EXPAND = NO
DISABLE_INDEX = NO
ENUM_VALUES_PER_LINE = 4
GENERATE_TREEVIEW = NO
TREEVIEW_WIDTH = 250
#---------------------------------------------------------------------------
# configuration options related to the LaTeX output
#---------------------------------------------------------------------------
GENERATE_LATEX = NO
LATEX_OUTPUT =
COMPACT_LATEX = NO
PAPER_TYPE = a4wide
EXTRA_PACKAGES =
LATEX_HEADER =
PDF_HYPERLINKS = NO
USE_PDFLATEX = NO
LATEX_BATCHMODE = NO
#---------------------------------------------------------------------------
# configuration options related to the RTF output
#---------------------------------------------------------------------------
GENERATE_RTF = NO
RTF_OUTPUT =
COMPACT_RTF = NO
RTF_HYPERLINKS = NO
RTF_STYLESHEET_FILE =
RTF_EXTENSIONS_FILE =
#---------------------------------------------------------------------------
# configuration options related to the man page output
#---------------------------------------------------------------------------
GENERATE_MAN = NO
MAN_OUTPUT =
MAN_EXTENSION =
MAN_LINKS = NO
#---------------------------------------------------------------------------
# configuration options related to the XML output
#---------------------------------------------------------------------------
GENERATE_XML = NO
#---------------------------------------------------------------------------
# configuration options for the AutoGen Definitions output
#---------------------------------------------------------------------------
GENERATE_AUTOGEN_DEF = NO
#---------------------------------------------------------------------------
# Configuration options related to the preprocessor
#---------------------------------------------------------------------------
ENABLE_PREPROCESSING = YES
MACRO_EXPANSION = NO
EXPAND_ONLY_PREDEF = NO
SEARCH_INCLUDES = YES
INCLUDE_PATH = ../include/
INCLUDE_FILE_PATTERNS =
PREDEFINED =
EXPAND_AS_DEFINED =
SKIP_FUNCTION_MACROS = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to external references
#---------------------------------------------------------------------------
TAGFILES = \
math_subset.tag=../math_subset \
miniglx.tag=../miniglx
GENERATE_TAGFILE = core_subset.tag
ALLEXTERNALS = NO
PERL_PATH =
#---------------------------------------------------------------------------
# Configuration options related to the dot tool
#---------------------------------------------------------------------------
CLASS_DIAGRAMS = NO
HAVE_DOT = NO
CLASS_GRAPH = YES
COLLABORATION_GRAPH = YES
TEMPLATE_RELATIONS = YES
HIDE_UNDOC_RELATIONS = YES
INCLUDE_GRAPH = YES
INCLUDED_BY_GRAPH = YES
GRAPHICAL_HIERARCHY = YES
DOT_PATH =
DOTFILE_DIRS =
MAX_DOT_GRAPH_WIDTH = 1024
MAX_DOT_GRAPH_HEIGHT = 1024
GENERATE_LEGEND = YES
DOT_CLEANUP = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to the search engine
#---------------------------------------------------------------------------
SEARCHENGINE = NO
CGI_NAME =
CGI_URL =
DOC_URL =
DOC_ABSPATH =
BIN_ABSPATH =
EXT_DOC_PATHS =

View File

@@ -1,19 +0,0 @@
doxygen tnl_dd.doxy
doxygen vbo.doxy
doxygen math.doxy
doxygen swrast.doxy
doxygen swrast_setup.doxy
doxygen tnl.doxy
doxygen core.doxy
doxygen glapi.doxy
doxygen shader.doxy
echo Building again, to resolve tags
doxygen tnl_dd.doxy
doxygen vbo.doxy
doxygen math.doxy
doxygen swrast.doxy
doxygen swrast_setup.doxy
doxygen tnl.doxy
doxygen glapi.doxy
doxygen shader.doxy

View File

@@ -1,323 +0,0 @@
/** \mainpage
\section about About
Gallium3D is <a href="http://www.tungstengraphics.com/">Tungsten Graphics</a>'
new architecture for building 3D graphics drivers. Initially
supporting Mesa and Linux graphics drivers, Gallium3D is designed to allow
portability to all major operating systems and graphics interfaces.
Compared to existing Linux graphics drivers, Gallium3D will:
- Make drivers smaller and simpler.
Current DRI drivers are rather complicated. They're large, contain
duplicated code and are burdened with implementing many concepts tightly
tied to the OpenGL 1.x/2.x API.
- Model modern graphics hardware.
The new driver architecture is an abstraction of modern graphics hardware,
rather than an OpenGL->hardware translator. The new driver interface will
assume the presence of programmable vertex/fragment shaders and flexible
memory objects.
- Support multiple graphics APIs.
The OpenGL 3.0 API will be very different from OpenGL 1.x/2.x. We'd like a
driver model that is API-neutral so that it's not tied to a specific
graphics API.
\section contents Contents
- \ref overview
- \ref statetracker
- Pipe drivers:
- \ref softpipe
- \ref i915simple
- Simple 965 driver (brw_context.h, brw_winsys.h)
- Cell driver (cell_context.h, cell_winsys.h)
- \ref failover
- Winsys drivers:
- X11 winsys driver (xm_winsys.c)
- Intel DRI winsys driver (intel_context.h, intel_winsys_pipe.c)
- Ancillary Modules:
- \ref draw
- \ref tgsi
- LLVM TGSI backend (gallivm.h)
- \ref callgraph
\section external External documentation
- <a href="http://www.tungstengraphics.com/gallium3D.htm">Gallium3D's Architectural Overview</a>
- <a href="http://www.tungstengraphics.com/wiki/index.php/Gallium3D">Technical Overview</a>
- <a href="http://www.tungstengraphics.com/wiki/files/gallium3d-xds2007.pdf">Gallium3D talk from XDS 2007</a>
*/
/** \page overview Overview
The public interface of a Gallium3D driver is described by the p_context.h
header file. The pipe_context structure is an abstract base class with
methods for:
- Setting rendering state (texture sampler state, vertex array info, drawing surfaces, etc.)
- Setting shader state, using the TGSI binary shader representation.
- Vertex array and indexed vertex array drawing.
- Region (memory) management for textures, renderbuffers, vertex buffers, etc.
- Hardware queries (number of texture units, max texture size, etc).
The p_state.h header defines all the state objects (such as polygon
rasterization options, blend modes, etc) and resources (drawing surfaces,
textures, memory buffers). The pipe interface uses "constant state" objects.
That is, state objects are created once and are immutable. State objects are
put into effect by binding them. This allows Gallium3D drivers to create
corresponding hardware state objects which can be quickly handled.
The p_defines.h header defines numerous constants and tokens (blend modes,
texture wrap modes, surface formats, etc.
The p_winsys.h header defines the window system and OS facilities which
Gallium3D drivers rely upon. For example, memory allocation is typically a
service the OS provides while window size/position information is provided by
the window system. Pipe drivers use the winsys interface to handle these
things.
By abstracting OS and window system services, pipe drivers are portable to
other platforms (e.g. embedded devices).
*/
/** \page statetracker The State Tracker
The state tracker is the piece which interfaces core Mesa to the Gallium3D
interface. It's responsible for translating Mesa state (blend modes, texture
state, etc) and drawing commands (like glDrawArrays and glDrawPixels) into
pipe objects and operations.
Traditional fixed-function OpenGL components (such as lighting and texture
combining) are implemented with shaders. OpenGL commands such as glDrawPixels
are translated into textured quadrilateral rendering. Basically, any
rendering operation that isn't directly supported by modern graphics hardware
is translated into a hardware-friendly form.
Future state trackers will be created for OpenGL 3.0 and OpenGL-ES 2.x.
*/
/** \page softpipe Softpipe Driver
The softpipe driver is a software implementation of the Gallium3D interface.
It will be used as a reference implementation and as a fallback driver when a
hardware driver isn't available. The softpipe driver will make extensive use
of run-time code generation to efficiently execute vertex, fragment and
rasterization operations.
\sa sp_winsys.h
*/
/** \page i915simple Simple i915 Driver
The i915 Gallium3D Driver is an initial hardware driver implementation within
the Gallium3D driver architecture. We expect that once complete this driver
will have equivalent functionality and performance to the current Mesa
i915tex driver, but from a much smaller codebase.
\sa i915_context.h
\sa i915_winsys.h
*/
/** \page failover Failover Module
The failover module acts as a selector between a hardware driver and the
softpipe driver. When the hardware can't implement a particular rendering
operation, the failover module will pass the request to the softpipe driver.
This is a different solution to the "software fallbacks" scheme of previous
Mesa drivers.
\sa fo_winsys.h
*/
/** \page draw Draw Module
The Draw module provides point/line/polygon rendering services such as
vertex transformation, polygon culling and clipping. It will be used by
drivers for hardware which lacks vertex transformation (such as the
i915/i945). It may also be instantiated and used directly by the state
tracker to implement some API functionality that doesn't map well to hardware
capabilities.
The interface of this module corresponds closely to the subset of the Gallium
Driver Interface which is relevent to these steps in the pipeline. Specifically
there are calls for:
- Vertex shader constant state objects
- Vertex buffer binding
- Vertex element layout (vertex fetch) constant state objects
- DrawArrays and DrawElements
- Rasterizer constant state objects.
The Draw module is effectively the part of \ref softpipe which is concerned with
vertex processing, split off into a separate module so that it can be reused
by drivers for rasterization-only hardware. As such it is also instantiated
by the \ref i915simple driver.
Additionally, there are cases in the Mesa OpenGL state_tracker where it is
required to obtain transformed vertices and yet it is anticipated that using
hardware transformation even if available would reduce performance, usually
because the setup costs or latency are prohibitive. For this reason the Mesa
state_tracker also instantiates a copy of this module.
\sa draw_context.h
*/
/** \page tgsi TGSI
The TGSI module provides a universal representation of shaders and
CPU-based execution of shaders. All Mesa vertex/fragment programs and shaders
are translated into the TGSI representation before being passed to the
driver. In turn, the driver will convert the TGSI instructions into
GPU-specific instructions. For hardware that lacks vertex or fragment shader
support, the TGSI's executor can be used. The TGSI executor includes support
for SSE code generation. Support for other processors (such as Cell) will be
added in the future.
\sa tgsi_parse.h
\sa <a href="http://www.tungstengraphics.com/wiki/files/tgsi.pdf">TGSI specification</a>
*/
/** \page callgraph Glxgears callgraph example
Below is a call graph of the glxgears application together with the Gallium3D's softpipe reference driver.
\htmlonly
The functions in the graph below are clickable.
\endhtmlonly
\dot
digraph {
graph [fontname=Arial, fontsize=10];
node [fontcolor=white, fontname=Arial, style=filled, fontsize=10, shape=box];
edge [fontname=Arial, fontsize=10];
1 [color="#ff0000", URL="\ref main", label="main\n100.00% (0.68%)\n0"];
1 -> 2 [color="#fe0400", fontcolor="#fe0400", label="99.32%\n1433"];
2 [color="#fe0400", URL="\ref do_draw", label="do_draw\n99.32% (0.00%)\n1433"];
2 -> 4 [color="#fa1201", fontcolor="#fa1201", label="96.67%\n4298"];
2 -> 39 [color="#0d4f76", fontcolor="#0d4f76", label="2.45%\n1433"];
3 [color="#fa1201", URL="\ref execute_list", label="execute_list\n96.67% (0.00%)\n4299"];
3 -> 5 [color="#f91301", fontcolor="#f91301", label="96.38%\n17196"];
4 [color="#fa1201", URL="\ref _mesa_CallList", label="_mesa_CallList\n96.67% (0.00%)\n4299"];
4 -> 3 [color="#fa1201", fontcolor="#fa1201", label="96.67%\n4299"];
5 [color="#f91301", URL="\ref vbo_save_playback_vertex_list", label="vbo_save_playback_vertex_list\n96.38% (0.10%)\n17196"];
5 -> 6 [color="#f91501", fontcolor="#f91501", label="96.09%\n17196"];
6 [color="#f91501", URL="\ref st_draw_vbo", label="st_draw_vbo\n96.09% (0.00%)\n17196"];
6 -> 10 [color="#ec3f03", fontcolor="#ec3f03", label="87.48%\n30093"];
6 -> 33 [color="#0d5f78", fontcolor="#0d5f78", label="3.72%\n34392"];
6 -> 34 [color="#0d5f78", fontcolor="#0d5f78", label="3.72%\n34392"];
6 -> 47 [color="#0d3a74", fontcolor="#0d3a74", label="1.17%\n17196"];
7 [color="#f71d01", URL="\ref draw_do_flush", label="draw_do_flush\n94.52% (0.20%)\n101744"];
7 -> 13 [color="#e74e04", fontcolor="#e74e04", label="84.25%\n1146400"];
7 -> 8 [color="#0d7d6c", fontcolor="#0d7d6c", label="8.32%\n114640"];
7 -> 46 [color="#0d4175", fontcolor="#0d4175", label="1.57%\n97444"];
8 [color="#f32702", URL="\ref clip_tri", label="clip_tri\n92.37% (0.49%)\n1261040"];
8 -> 9 [color="#f32a02", fontcolor="#f32a02", label="91.88%\n1261040"];
9 [color="#f32a02", URL="\ref cull_tri", label="cull_tri\n91.88% (0.20%)\n1261040"];
9 -> 15 [color="#e35d04", fontcolor="#e35d04", label="81.12%\n560810"];
9 -> 12 [color="#0d805e", fontcolor="#0d805e", label="10.57%\n560810"];
10 [color="#ec3f03", URL="\ref softpipe_draw_arrays", label="softpipe_draw_arrays\n87.48% (0.00%)\n30093"];
10 -> 11 [color="#ec3f03", fontcolor="#ec3f03", label="87.48%\n30093"];
11 [color="#ec3f03", URL="\ref softpipe_draw_elements", label="softpipe_draw_elements\n87.48% (0.10%)\n30093"];
11 -> 17 [color="#cf9507", fontcolor="#cf9507", label="67.61%\n30093"];
11 -> 27 [color="#0d844f", fontcolor="#0d844f", label="13.01%\n120372"];
11 -> 36 [color="#0d5a77", fontcolor="#0d5a77", label="3.33%\n30093"];
11 -> 23 [color="#0d5977", fontcolor="#0d5977", label="3.23%\n30093"];
12 [color="#ea4703", URL="\ref flush_spans", label="flush_spans\n85.91% (4.60%)\n4586176"];
12 -> 14 [color="#e35c04", fontcolor="#e35c04", label="81.31%\n15910811"];
13 [color="#e74e04", URL="\ref flatshade_tri", label="flatshade_tri\n84.25% (0.29%)\n1146400"];
13 -> 8 [color="#e75004", fontcolor="#e75004", label="83.95%\n1146400"];
14 [color="#e35c04", URL="\ref shade_quad", label="shade_quad\n81.31% (7.73%)\n15910811"];
14 -> 21 [color="#c0bb09", fontcolor="#c0bb09", label="57.24%\n13903725"];
14 -> 26 [color="#0c883c", fontcolor="#0c883c", label="16.24%\n15910811"];
15 [color="#e35d04", URL="\ref setup_tri", label="setup_tri\n81.12% (1.47%)\n560810"];
15 -> 16 [color="#e06505", fontcolor="#e06505", label="79.26%\n1121620"];
16 [color="#e06505", URL="\ref subtriangle", label="subtriangle\n79.26% (3.91%)\n1121620"];
16 -> 12 [color="#da7606", fontcolor="#da7606", label="75.34%\n4025366"];
17 [color="#cf9507", URL="\ref draw_arrays", label="draw_arrays\n67.61% (0.00%)\n30093"];
17 -> 19 [color="#cf9607", fontcolor="#cf9607", label="67.42%\n630520"];
18 [color="#cf9607", URL="\ref do_ef_triangle", label="do_ef_triangle\n67.42% (0.49%)\n1261040"];
18 -> 20 [color="#ce9807", fontcolor="#ce9807", label="66.83%\n1261040"];
19 [color="#cf9607", URL="\ref do_quad", label="do_quad\n67.42% (0.00%)\n630520"];
19 -> 18 [color="#cf9607", fontcolor="#cf9607", label="67.42%\n1261040"];
20 [color="#ce9807", URL="\ref get_queued_prim", label="get_queued_prim\n66.83% (0.10%)\n1261040"];
20 -> 7 [color="#cd9907", fontcolor="#cd9907", label="66.54%\n71650"];
21 [color="#c0bb09", URL="\ref depth_test_quad", label="depth_test_quad\n57.24% (1.08%)\n13903725"];
21 -> 22 [color="#40a00b", fontcolor="#40a00b", label="34.54%\n13074127"];
21 -> 24 [color="#0c8f1e", fontcolor="#0c8f1e", label="21.62%\n13903725"];
22 [color="#40a00b", URL="\ref output_quad", label="output_quad\n34.54% (3.91%)\n13074127"];
22 -> 25 [color="#0c8c2b", fontcolor="#0c8c2b", label="19.28%\n13074127"];
22 -> 28 [color="#0d8159", fontcolor="#0d8159", label="11.35%\n7223435"];
23 [color="#1c970c", URL="\ref draw_flush", label="draw_flush\n27.98% (0.00%)\n257944"];
23 -> 7 [color="#1c970c", fontcolor="#1c970c", label="27.98%\n30093"];
24 [color="#0c8f1e", URL="\ref sp_depth_test_quad", label="sp_depth_test_quad\n21.62% (16.14%)\n13903725"];
24 -> 37 [color="#0d5977", fontcolor="#0d5977", label="3.23%\n13903725"];
24 -> 44 [color="#0d4c76", fontcolor="#0d4c76", label="2.25%\n13903725"];
25 [color="#0c8c2b", URL="\ref write_quad_f_swz", label="write_quad_f_swz\n19.28% (16.14%)\n13074127"];
25 -> 38 [color="#0d5877", fontcolor="#0d5877", label="3.13%\n26148254"];
26 [color="#0c883a", URL="\ref tgsi_exec_machine_init", label="tgsi_exec_machine_init\n16.73% (10.27%)\n16326381"];
26 -> 30 [color="#0d6178", fontcolor="#0d6178", label="3.91%\n16326381"];
26 -> 45 [color="#0d4475", fontcolor="#0d4475", label="1.76%\n16326381"];
26 -> 52 [color="#0d3174", fontcolor="#0d3174", label="0.78%\n16326381"];
27 [color="#0d844f", URL="\ref draw_set_mapped_vertex_buffer", label="draw_set_mapped_vertex_buffer\n13.01% (0.00%)\n120372"];
27 -> 23 [color="#0d844f", fontcolor="#0d844f", label="13.01%\n120372"];
28 [color="#0d8159", URL="\ref read_quad_f_swz", label="read_quad_f_swz\n11.35% (5.87%)\n7223435"];
28 -> 29 [color="#0d737a", fontcolor="#0d737a", label="5.48%\n14446870"];
29 [color="#0d737a", URL="\ref get_row_rgba", label="get_row_rgba\n5.48% (5.48%)\n14446870"];
30 [color="#0d6178", URL="\ref tgsi_parse_init", label="tgsi_parse_init\n3.91% (3.52%)\n16326383"];
31 [color="#0d5f78", URL="\ref draw_set_vertex_buffer", label="draw_set_vertex_buffer\n3.72% (0.00%)\n34392"];
31 -> 23 [color="#0d5f78", fontcolor="#0d5f78", label="3.72%\n34392"];
32 [color="#0d5f78", URL="\ref draw_set_vertex_element", label="draw_set_vertex_element\n3.72% (0.00%)\n34392"];
32 -> 23 [color="#0d5f78", fontcolor="#0d5f78", label="3.72%\n34392"];
33 [color="#0d5f78", URL="\ref softpipe_set_vertex_buffer", label="softpipe_set_vertex_buffer\n3.72% (0.00%)\n34392"];
33 -> 31 [color="#0d5f78", fontcolor="#0d5f78", label="3.72%\n34392"];
34 [color="#0d5f78", URL="\ref softpipe_set_vertex_element", label="softpipe_set_vertex_element\n3.72% (0.00%)\n34392"];
34 -> 32 [color="#0d5f78", fontcolor="#0d5f78", label="3.72%\n34392"];
35 [color="#0d5d77", URL="\ref __i686.get_pc_thunk.bx", label="__i686.get_pc_thunk.bx\n3.52% (3.52%)\n0"];
36 [color="#0d5a77", URL="\ref draw_set_mapped_constant_buffer", label="draw_set_mapped_constant_buffer\n3.33% (0.10%)\n30093"];
36 -> 23 [color="#0d5977", fontcolor="#0d5977", label="3.23%\n30093"];
37 [color="#0d5977", URL="\ref s8z24_read_quad_z", label="s8z24_read_quad_z\n3.23% (3.23%)\n13903725"];
38 [color="#0d5877", URL="\ref put_row_8R8G8B_ximage", label="put_row_8R8G8B_ximage\n3.13% (3.13%)\n26148254"];
39 [color="#0d4f76", URL="\ref _mesa_Clear", label="_mesa_Clear\n2.45% (0.00%)\n1433"];
39 -> 40 [color="#0d4f76", fontcolor="#0d4f76", label="2.45%\n1433"];
40 [color="#0d4f76", URL="\ref st_clear", label="st_clear\n2.45% (0.00%)\n1433"];
40 -> 41 [color="#0d4d76", fontcolor="#0d4d76", label="2.35%\n2866"];
41 [color="#0d4d76", URL="\ref xmesa_clear", label="xmesa_clear\n2.35% (0.00%)\n2866"];
41 -> 42 [color="#0d4c76", fontcolor="#0d4c76", label="2.25%\n1433"];
42 [color="#0d4c76", URL="\ref softpipe_clear", label="softpipe_clear\n2.25% (0.00%)\n1433"];
42 -> 43 [color="#0d4c76", fontcolor="#0d4c76", label="2.25%\n1433"];
43 [color="#0d4c76", URL="\ref sp_region_fill", label="sp_region_fill\n2.25% (2.25%)\n1433"];
44 [color="#0d4c76", URL="\ref s8z24_write_quad_z", label="s8z24_write_quad_z\n2.25% (2.25%)\n13903725"];
45 [color="#0d4475", URL="\ref tgsi_parse_free", label="tgsi_parse_free\n1.76% (0.78%)\n16326383"];
45 -> 49 [color="#0d3674", fontcolor="#0d3674", label="0.98%\n16326383"];
46 [color="#0d4175", URL="\ref draw_vertex_shader_queue_flush", label="draw_vertex_shader_queue_flush\n1.57% (0.49%)\n97444"];
46 -> 53 [color="#0d2f74", fontcolor="#0d2f74", label="0.68%\n415570"];
46 -> 26 [color="#0d2973", fontcolor="#0d2973", label="0.49%\n415570"];
47 [color="#0d3b74", URL="\ref st_validate_state", label="st_validate_state\n1.27% (0.00%)\n18629"];
47 -> 48 [color="#0d3874", fontcolor="#0d3874", label="1.08%\n8599"];
48 [color="#0d3874", URL="\ref update_raster_state", label="update_raster_state\n1.08% (0.10%)\n8599"];
48 -> 51 [color="#0d3674", fontcolor="#0d3674", label="0.98%\n8599"];
49 [color="#0d3674", URL="\ref tgsi_full_token_free", label="tgsi_full_token_free\n0.98% (0.98%)\n16326412"];
50 [color="#0d3674", URL="\ref draw_set_rasterizer_state", label="draw_set_rasterizer_state\n0.98% (0.00%)\n8599"];
50 -> 23 [color="#0d3674", fontcolor="#0d3674", label="0.98%\n8599"];
51 [color="#0d3674", URL="\ref softpipe_bind_rasterizer_state", label="softpipe_bind_rasterizer_state\n0.98% (0.00%)\n8599"];
51 -> 50 [color="#0d3674", fontcolor="#0d3674", label="0.98%\n8599"];
52 [color="#0d3174", URL="\ref tgsi_align_128bit", label="tgsi_align_128bit\n0.78% (0.78%)\n16326381"];
53 [color="#0d2f74", URL="\ref draw_vertex_fetch", label="draw_vertex_fetch\n0.68% (0.68%)\n415570"];
}
\enddot
The graph above was generated by the <a href="http://code.google.com/p/jrfonseca/wiki/Gprof2Dot">gprof2dot.py script</a>.
*/

File diff suppressed because it is too large Load Diff

View File

@@ -1,49 +0,0 @@
# Doxyfile 0.1
@INCLUDE = common.doxy
#---------------------------------------------------------------------------
# General configuration options
#---------------------------------------------------------------------------
PROJECT_NAME = "Mesa GL API dispatcher"
#---------------------------------------------------------------------------
# configuration options related to the input files
#---------------------------------------------------------------------------
INPUT = ../src/mesa/glapi/
FILE_PATTERNS = *.c *.h
RECURSIVE = NO
EXCLUDE =
EXCLUDE_PATTERNS =
EXAMPLE_PATH =
EXAMPLE_PATTERNS =
EXAMPLE_RECURSIVE = NO
IMAGE_PATH =
INPUT_FILTER =
FILTER_SOURCE_FILES = NO
#---------------------------------------------------------------------------
# configuration options related to the HTML output
#---------------------------------------------------------------------------
HTML_OUTPUT = glapi
#---------------------------------------------------------------------------
# Configuration options related to the preprocessor
#---------------------------------------------------------------------------
ENABLE_PREPROCESSING = YES
MACRO_EXPANSION = NO
EXPAND_ONLY_PREDEF = NO
SEARCH_INCLUDES = YES
INCLUDE_PATH = ../include/
INCLUDE_FILE_PATTERNS =
PREDEFINED =
EXPAND_AS_DEFINED =
SKIP_FUNCTION_MACROS = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to external references
#---------------------------------------------------------------------------
TAGFILES = main.tag=../core \
math.tag=../math \
tnl_dd.tag=../tnl_dd \
swrast.tag=../swrast \
swrast_setup.tag=../swrast_setup \
tnl.tag=../tnl \
vbo.tag=vbo
GENERATE_TAGFILE = swrast.tag

View File

@@ -1,17 +0,0 @@
<html>
<head>
<title>Mesa Source Code Documentation</title>
<link href="doxygen.css" rel="stylesheet" type="text/css">
</head>
<body>
<div class="qindex">
<a class="qindex" href="../main/index.html">core</a> |
<a class="qindex" href="../glapi/index.html">glapi</a> |
<a class="qindex" href="../vbo/index.html">vbo</a> |
<a class="qindex" href="../math/index.html">math</a> |
<a class="qindex" href="../shader/index.html">shader</a> |
<a class="qindex" href="../swrast/index.html">swrast</a> |
<a class="qindex" href="../swrast_setup/index.html">swrast_setup</a> |
<a class="qindex" href="../tnl/index.html">tnl</a> |
<a class="qindex" href="../tnl_dd/index.html">tnl_dd</a>
</div>

View File

@@ -1,11 +0,0 @@
<html>
<head><title>Mesa Source Code Documentation</title>
<link href="doxygen.css" rel="stylesheet" type="text/css">
</head>
<body>
<div class="qindex">
<a class="qindex" href="../core_subset/index.html">Mesa Core</a> |
<a class="qindex" href="../math_subset/index.html">math</a> |
<a class="qindex" href="../miniglx/index.html">MiniGLX</a> |
<a class="qindex" href="../radeon_subset/index.html">radeon_subset</a>
</div>

View File

@@ -1,50 +0,0 @@
# Doxyfile 0.1
@INCLUDE = common.doxy
#---------------------------------------------------------------------------
# General configuration options
#---------------------------------------------------------------------------
PROJECT_NAME = "Mesa Main"
#---------------------------------------------------------------------------
# configuration options related to the input files
#---------------------------------------------------------------------------
INPUT = ../src/mesa/main/
FILE_PATTERNS = *.c *.h
RECURSIVE = NO
EXCLUDE = ../src/glapitemp.h ../src/glapioffsets.h
EXCLUDE_PATTERNS = subset_*
EXAMPLE_PATH =
EXAMPLE_PATTERNS =
EXAMPLE_RECURSIVE = NO
IMAGE_PATH =
INPUT_FILTER =
FILTER_SOURCE_FILES = NO
#---------------------------------------------------------------------------
# configuration options related to the HTML output
#---------------------------------------------------------------------------
HTML_OUTPUT = main
#---------------------------------------------------------------------------
# Configuration options related to the preprocessor
#---------------------------------------------------------------------------
ENABLE_PREPROCESSING = YES
MACRO_EXPANSION = YES
EXPAND_ONLY_PREDEF = YES
SEARCH_INCLUDES = YES
INCLUDE_PATH = ../include/
INCLUDE_FILE_PATTERNS =
PREDEFINED = _HAVE_FULL_GL=1
EXPAND_AS_DEFINED = _glthread_DECLARE_STATIC_MUTEX
SKIP_FUNCTION_MACROS = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to external references
#---------------------------------------------------------------------------
TAGFILES = tnl_dd.tag=../tnl_dd \
vbo.tag=../vbo \
glapi.tag=../glapi \
math.tag=../math \
shader.tag=../shader \
swrast.tag=../swrast \
swrast_setup.tag=../swrast_setup \
tnl.tag=../tnl
GENERATE_TAGFILE = main.tag

View File

@@ -1,49 +0,0 @@
# Doxyfile 0.1
@INCLUDE = common.doxy
#---------------------------------------------------------------------------
# General configuration options
#---------------------------------------------------------------------------
PROJECT_NAME = "Mesa math module"
#---------------------------------------------------------------------------
# configuration options related to the input files
#---------------------------------------------------------------------------
INPUT = ../src/mesa/math/
FILE_PATTERNS = *.c \
*.h
RECURSIVE = NO
EXCLUDE =
EXCLUDE_PATTERNS =
EXAMPLE_PATH =
EXAMPLE_PATTERNS =
EXAMPLE_RECURSIVE = NO
IMAGE_PATH =
INPUT_FILTER =
FILTER_SOURCE_FILES = NO
#---------------------------------------------------------------------------
# configuration options related to the HTML output
#---------------------------------------------------------------------------
HTML_OUTPUT = math
#---------------------------------------------------------------------------
# Configuration options related to the preprocessor
#---------------------------------------------------------------------------
ENABLE_PREPROCESSING = YES
MACRO_EXPANSION = NO
EXPAND_ONLY_PREDEF = NO
SEARCH_INCLUDES = YES
INCLUDE_PATH =
INCLUDE_FILE_PATTERNS =
PREDEFINED =
EXPAND_AS_DEFINED =
SKIP_FUNCTION_MACROS = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to external references
#---------------------------------------------------------------------------
TAGFILES = tnl_dd.tag=../tnl_dd \
main.tag=../core \
swrast.tag=../swrast \
swrast_setup.tag=../swrast_setup \
tnl.tag=../tnl \
vbo.tag=../vbo
GENERATE_TAGFILE = math.tag

View File

@@ -1,177 +0,0 @@
# Doxyfile 0.1
#---------------------------------------------------------------------------
# General configuration options
#---------------------------------------------------------------------------
PROJECT_NAME = "Mesa math module"
PROJECT_NUMBER =
OUTPUT_DIRECTORY = .
OUTPUT_LANGUAGE = English
EXTRACT_ALL = NO
EXTRACT_PRIVATE = NO
EXTRACT_STATIC = YES
EXTRACT_LOCAL_CLASSES = YES
HIDE_UNDOC_MEMBERS = NO
HIDE_UNDOC_CLASSES = NO
BRIEF_MEMBER_DESC = YES
REPEAT_BRIEF = YES
ALWAYS_DETAILED_SEC = NO
INLINE_INHERITED_MEMB = NO
FULL_PATH_NAMES = NO
STRIP_FROM_PATH =
INTERNAL_DOCS = NO
STRIP_CODE_COMMENTS = YES
CASE_SENSE_NAMES = YES
SHORT_NAMES = NO
HIDE_SCOPE_NAMES = NO
VERBATIM_HEADERS = YES
SHOW_INCLUDE_FILES = YES
JAVADOC_AUTOBRIEF = NO
INHERIT_DOCS = YES
INLINE_INFO = YES
SORT_MEMBER_DOCS = NO
DISTRIBUTE_GROUP_DOC = NO
TAB_SIZE = 8
GENERATE_TODOLIST = YES
GENERATE_TESTLIST = YES
GENERATE_BUGLIST = YES
ALIASES =
ENABLED_SECTIONS =
MAX_INITIALIZER_LINES = 30
OPTIMIZE_OUTPUT_FOR_C = YES
SHOW_USED_FILES = YES
#---------------------------------------------------------------------------
# configuration options related to warning and progress messages
#---------------------------------------------------------------------------
QUIET = YES
WARNINGS = YES
WARN_IF_UNDOCUMENTED = NO
WARN_FORMAT =
WARN_LOGFILE =
#---------------------------------------------------------------------------
# configuration options related to the input files
#---------------------------------------------------------------------------
INPUT = ../src/mesa/math/
FILE_PATTERNS = m_matrix.[ch]
RECURSIVE = NO
EXCLUDE =
EXCLUDE_PATTERNS =
EXAMPLE_PATH =
EXAMPLE_PATTERNS =
EXAMPLE_RECURSIVE = NO
IMAGE_PATH =
INPUT_FILTER =
FILTER_SOURCE_FILES = NO
#---------------------------------------------------------------------------
# configuration options related to source browsing
#---------------------------------------------------------------------------
SOURCE_BROWSER = NO
INLINE_SOURCES = NO
REFERENCED_BY_RELATION = YES
REFERENCES_RELATION = YES
#---------------------------------------------------------------------------
# configuration options related to the alphabetical class index
#---------------------------------------------------------------------------
ALPHABETICAL_INDEX = NO
COLS_IN_ALPHA_INDEX = 5
IGNORE_PREFIX =
#---------------------------------------------------------------------------
# configuration options related to the HTML output
#---------------------------------------------------------------------------
GENERATE_HTML = YES
HTML_OUTPUT = math_subset
HTML_HEADER = header_subset.html
HTML_FOOTER =
HTML_STYLESHEET =
HTML_ALIGN_MEMBERS = YES
GENERATE_HTMLHELP = NO
GENERATE_CHI = NO
BINARY_TOC = NO
TOC_EXPAND = NO
DISABLE_INDEX = NO
ENUM_VALUES_PER_LINE = 4
GENERATE_TREEVIEW = NO
TREEVIEW_WIDTH = 250
#---------------------------------------------------------------------------
# configuration options related to the LaTeX output
#---------------------------------------------------------------------------
GENERATE_LATEX = NO
LATEX_OUTPUT =
COMPACT_LATEX = NO
PAPER_TYPE = a4wide
EXTRA_PACKAGES =
LATEX_HEADER =
PDF_HYPERLINKS = NO
USE_PDFLATEX = NO
LATEX_BATCHMODE = NO
#---------------------------------------------------------------------------
# configuration options related to the RTF output
#---------------------------------------------------------------------------
GENERATE_RTF = NO
RTF_OUTPUT =
COMPACT_RTF = NO
RTF_HYPERLINKS = NO
RTF_STYLESHEET_FILE =
RTF_EXTENSIONS_FILE =
#---------------------------------------------------------------------------
# configuration options related to the man page output
#---------------------------------------------------------------------------
GENERATE_MAN = NO
MAN_OUTPUT =
MAN_EXTENSION =
MAN_LINKS = NO
#---------------------------------------------------------------------------
# configuration options related to the XML output
#---------------------------------------------------------------------------
GENERATE_XML = NO
#---------------------------------------------------------------------------
# configuration options for the AutoGen Definitions output
#---------------------------------------------------------------------------
GENERATE_AUTOGEN_DEF = NO
#---------------------------------------------------------------------------
# Configuration options related to the preprocessor
#---------------------------------------------------------------------------
ENABLE_PREPROCESSING = YES
MACRO_EXPANSION = NO
EXPAND_ONLY_PREDEF = NO
SEARCH_INCLUDES = YES
INCLUDE_PATH =
INCLUDE_FILE_PATTERNS =
PREDEFINED =
EXPAND_AS_DEFINED =
SKIP_FUNCTION_MACROS = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to external references
#---------------------------------------------------------------------------
TAGFILES = core_subset.tag=../core_subset
GENERATE_TAGFILE = math_subset.tag
ALLEXTERNALS = NO
PERL_PATH =
#---------------------------------------------------------------------------
# Configuration options related to the dot tool
#---------------------------------------------------------------------------
CLASS_DIAGRAMS = YES
HAVE_DOT = NO
CLASS_GRAPH = YES
COLLABORATION_GRAPH = YES
TEMPLATE_RELATIONS = YES
HIDE_UNDOC_RELATIONS = YES
INCLUDE_GRAPH = YES
INCLUDED_BY_GRAPH = YES
GRAPHICAL_HIERARCHY = YES
DOT_PATH =
DOTFILE_DIRS =
MAX_DOT_GRAPH_WIDTH = 1024
MAX_DOT_GRAPH_HEIGHT = 1024
GENERATE_LEGEND = YES
DOT_CLEANUP = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to the search engine
#---------------------------------------------------------------------------
SEARCHENGINE = NO
CGI_NAME =
CGI_URL =
DOC_URL =
DOC_ABSPATH =
BIN_ABSPATH =
EXT_DOC_PATHS =

View File

@@ -1,179 +0,0 @@
# Doxyfile 0.1
#---------------------------------------------------------------------------
# General configuration options
#---------------------------------------------------------------------------
PROJECT_NAME = "MiniGLX"
PROJECT_NUMBER =
OUTPUT_DIRECTORY =
OUTPUT_LANGUAGE = English
EXTRACT_ALL = NO
EXTRACT_PRIVATE = NO
EXTRACT_STATIC = YES
EXTRACT_LOCAL_CLASSES = YES
HIDE_UNDOC_MEMBERS = NO
HIDE_UNDOC_CLASSES = NO
BRIEF_MEMBER_DESC = YES
REPEAT_BRIEF = YES
ALWAYS_DETAILED_SEC = NO
INLINE_INHERITED_MEMB = NO
FULL_PATH_NAMES = NO
STRIP_FROM_PATH =
INTERNAL_DOCS = YES
STRIP_CODE_COMMENTS = YES
CASE_SENSE_NAMES = YES
SHORT_NAMES = NO
HIDE_SCOPE_NAMES = NO
VERBATIM_HEADERS = NO
SHOW_INCLUDE_FILES = NO
JAVADOC_AUTOBRIEF = NO
INHERIT_DOCS = YES
INLINE_INFO = YES
SORT_MEMBER_DOCS = NO
DISTRIBUTE_GROUP_DOC = NO
TAB_SIZE = 8
GENERATE_TODOLIST = YES
GENERATE_TESTLIST = YES
GENERATE_BUGLIST = YES
ALIASES =
ENABLED_SECTIONS =
MAX_INITIALIZER_LINES = 30
OPTIMIZE_OUTPUT_FOR_C = NO
SHOW_USED_FILES = YES
#---------------------------------------------------------------------------
# configuration options related to warning and progress messages
#---------------------------------------------------------------------------
QUIET = YES
WARNINGS = YES
WARN_IF_UNDOCUMENTED = NO
WARN_FORMAT =
WARN_LOGFILE =
#---------------------------------------------------------------------------
# configuration options related to the input files
#---------------------------------------------------------------------------
INPUT = ../src/glx/mini/ ../include/GL/miniglx.h
FILE_PATTERNS = *.h *.c
RECURSIVE = NO
EXCLUDE = ../src/glx/mini/glapi.c
EXCLUDE_PATTERNS =
EXAMPLE_PATH =
EXAMPLE_PATTERNS =
EXAMPLE_RECURSIVE = NO
IMAGE_PATH =
INPUT_FILTER =
FILTER_SOURCE_FILES = NO
#---------------------------------------------------------------------------
# configuration options related to source browsing
#---------------------------------------------------------------------------
SOURCE_BROWSER = NO
INLINE_SOURCES = NO
REFERENCED_BY_RELATION = YES
REFERENCES_RELATION = YES
#---------------------------------------------------------------------------
# configuration options related to the alphabetical class index
#---------------------------------------------------------------------------
ALPHABETICAL_INDEX = NO
COLS_IN_ALPHA_INDEX = 5
IGNORE_PREFIX =
#---------------------------------------------------------------------------
# configuration options related to the HTML output
#---------------------------------------------------------------------------
GENERATE_HTML = YES
HTML_OUTPUT = miniglx
HTML_HEADER = header_subset.html
HTML_FOOTER =
HTML_STYLESHEET =
HTML_ALIGN_MEMBERS = YES
GENERATE_HTMLHELP = NO
GENERATE_CHI = NO
BINARY_TOC = NO
TOC_EXPAND = NO
DISABLE_INDEX = NO
ENUM_VALUES_PER_LINE = 4
GENERATE_TREEVIEW = NO
TREEVIEW_WIDTH = 250
#---------------------------------------------------------------------------
# configuration options related to the LaTeX output
#---------------------------------------------------------------------------
GENERATE_LATEX = NO
LATEX_OUTPUT =
COMPACT_LATEX = NO
PAPER_TYPE = a4wide
EXTRA_PACKAGES =
LATEX_HEADER =
PDF_HYPERLINKS = NO
USE_PDFLATEX = NO
LATEX_BATCHMODE = NO
#---------------------------------------------------------------------------
# configuration options related to the RTF output
#---------------------------------------------------------------------------
GENERATE_RTF = NO
RTF_OUTPUT =
COMPACT_RTF = NO
RTF_HYPERLINKS = NO
RTF_STYLESHEET_FILE =
RTF_EXTENSIONS_FILE =
#---------------------------------------------------------------------------
# configuration options related to the man page output
#---------------------------------------------------------------------------
GENERATE_MAN = NO
MAN_OUTPUT =
MAN_EXTENSION =
MAN_LINKS = NO
#---------------------------------------------------------------------------
# configuration options related to the XML output
#---------------------------------------------------------------------------
GENERATE_XML = NO
#---------------------------------------------------------------------------
# configuration options for the AutoGen Definitions output
#---------------------------------------------------------------------------
GENERATE_AUTOGEN_DEF = NO
#---------------------------------------------------------------------------
# Configuration options related to the preprocessor
#---------------------------------------------------------------------------
ENABLE_PREPROCESSING = YES
MACRO_EXPANSION = NO
EXPAND_ONLY_PREDEF = NO
SEARCH_INCLUDES = YES
INCLUDE_PATH = ../include/
INCLUDE_FILE_PATTERNS =
PREDEFINED =
EXPAND_AS_DEFINED =
SKIP_FUNCTION_MACROS = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to external references
#---------------------------------------------------------------------------
TAGFILES = \
core_subset.tag=../core_subset \
math_subset.tag=../math_subset
GENERATE_TAGFILE = miniglx.tag
ALLEXTERNALS = NO
PERL_PATH =
#---------------------------------------------------------------------------
# Configuration options related to the dot tool
#---------------------------------------------------------------------------
CLASS_DIAGRAMS = NO
HAVE_DOT = NO
CLASS_GRAPH = YES
COLLABORATION_GRAPH = YES
TEMPLATE_RELATIONS = YES
HIDE_UNDOC_RELATIONS = YES
INCLUDE_GRAPH = YES
INCLUDED_BY_GRAPH = YES
GRAPHICAL_HIERARCHY = YES
DOT_PATH =
DOTFILE_DIRS =
MAX_DOT_GRAPH_WIDTH = 1024
MAX_DOT_GRAPH_HEIGHT = 1024
GENERATE_LEGEND = YES
DOT_CLEANUP = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to the search engine
#---------------------------------------------------------------------------
SEARCHENGINE = NO
CGI_NAME =
CGI_URL =
DOC_URL =
DOC_ABSPATH =
BIN_ABSPATH =
EXT_DOC_PATHS =

View File

@@ -1,203 +0,0 @@
# Doxyfile 0.1
#---------------------------------------------------------------------------
# General configuration options
#---------------------------------------------------------------------------
PROJECT_NAME = "Radeon Subset Driver"
PROJECT_NUMBER =
OUTPUT_DIRECTORY =
OUTPUT_LANGUAGE = English
EXTRACT_ALL = NO
EXTRACT_PRIVATE = NO
EXTRACT_STATIC = YES
EXTRACT_LOCAL_CLASSES = YES
HIDE_UNDOC_MEMBERS = NO
HIDE_UNDOC_CLASSES = NO
BRIEF_MEMBER_DESC = YES
REPEAT_BRIEF = YES
ALWAYS_DETAILED_SEC = NO
INLINE_INHERITED_MEMB = NO
FULL_PATH_NAMES = NO
STRIP_FROM_PATH =
INTERNAL_DOCS = YES
STRIP_CODE_COMMENTS = YES
CASE_SENSE_NAMES = YES
SHORT_NAMES = NO
HIDE_SCOPE_NAMES = NO
VERBATIM_HEADERS = NO
SHOW_INCLUDE_FILES = NO
JAVADOC_AUTOBRIEF = NO
INHERIT_DOCS = YES
INLINE_INFO = YES
SORT_MEMBER_DOCS = NO
DISTRIBUTE_GROUP_DOC = NO
TAB_SIZE = 8
GENERATE_TODOLIST = YES
GENERATE_TESTLIST = YES
GENERATE_BUGLIST = YES
ALIASES =
ENABLED_SECTIONS =
MAX_INITIALIZER_LINES = 30
OPTIMIZE_OUTPUT_FOR_C = NO
SHOW_USED_FILES = YES
#---------------------------------------------------------------------------
# configuration options related to warning and progress messages
#---------------------------------------------------------------------------
QUIET = YES
WARNINGS = YES
WARN_IF_UNDOCUMENTED = NO
WARN_FORMAT =
WARN_LOGFILE =
#---------------------------------------------------------------------------
# configuration options related to the input files
#---------------------------------------------------------------------------
INPUT = \
../src/mesa/drivers/dri/common/mm.c \
../src/mesa/drivers/dri/common/mm.h \
../src/mesa/drivers/dri/radeon/radeon_context.c \
../src/mesa/drivers/dri/radeon/radeon_context.h \
../src/mesa/drivers/dri/radeon/radeon_ioctl.c \
../src/mesa/drivers/dri/radeon/radeon_ioctl.h \
../src/mesa/drivers/dri/radeon/radeon_lock.c \
../src/mesa/drivers/dri/radeon/radeon_lock.h \
../src/mesa/drivers/dri/radeon/radeon_screen.c \
../src/mesa/drivers/dri/radeon/radeon_screen.h \
../src/mesa/drivers/dri/radeon/radeon_state.c \
../src/mesa/drivers/dri/radeon/radeon_state.h \
../src/mesa/drivers/dri/radeon/radeon_state_init.c \
../src/mesa/drivers/dri/radeon/radeon_subset.h \
../src/mesa/drivers/dri/radeon/radeon_subset_bitmap.c \
../src/mesa/drivers/dri/radeon/radeon_subset_readpix.c \
../src/mesa/drivers/dri/radeon/radeon_subset_select.c \
../src/mesa/drivers/dri/radeon/radeon_subset_tex.c \
../src/mesa/drivers/dri/radeon/radeon_subset_vtx.c \
../src/mesa/drivers/dri/radeon/radeon_tcl.h \
../src/mesa/drivers/dri/radeon/radeon_tex.h \
../src/mesa/drivers/dri/radeon/radeon_vtxfmt.h \
../src/mesa/drivers/dri/radeon/server
FILE_PATTERNS = *.h *.c
RECURSIVE = NO
EXCLUDE =
EXCLUDE_PATTERNS =
EXAMPLE_PATH =
EXAMPLE_PATTERNS =
EXAMPLE_RECURSIVE = NO
IMAGE_PATH =
INPUT_FILTER =
FILTER_SOURCE_FILES = NO
#---------------------------------------------------------------------------
# configuration options related to source browsing
#---------------------------------------------------------------------------
SOURCE_BROWSER = NO
INLINE_SOURCES = NO
REFERENCED_BY_RELATION = YES
REFERENCES_RELATION = YES
#---------------------------------------------------------------------------
# configuration options related to the alphabetical class index
#---------------------------------------------------------------------------
ALPHABETICAL_INDEX = NO
COLS_IN_ALPHA_INDEX = 5
IGNORE_PREFIX =
#---------------------------------------------------------------------------
# configuration options related to the HTML output
#---------------------------------------------------------------------------
GENERATE_HTML = YES
HTML_OUTPUT = radeon_subset
HTML_HEADER = header_subset.html
HTML_FOOTER =
HTML_STYLESHEET =
HTML_ALIGN_MEMBERS = YES
GENERATE_HTMLHELP = NO
GENERATE_CHI = NO
BINARY_TOC = NO
TOC_EXPAND = NO
DISABLE_INDEX = NO
ENUM_VALUES_PER_LINE = 4
GENERATE_TREEVIEW = NO
TREEVIEW_WIDTH = 250
#---------------------------------------------------------------------------
# configuration options related to the LaTeX output
#---------------------------------------------------------------------------
GENERATE_LATEX = NO
LATEX_OUTPUT =
COMPACT_LATEX = NO
PAPER_TYPE = a4wide
EXTRA_PACKAGES =
LATEX_HEADER =
PDF_HYPERLINKS = NO
USE_PDFLATEX = NO
LATEX_BATCHMODE = NO
#---------------------------------------------------------------------------
# configuration options related to the RTF output
#---------------------------------------------------------------------------
GENERATE_RTF = NO
RTF_OUTPUT =
COMPACT_RTF = NO
RTF_HYPERLINKS = NO
RTF_STYLESHEET_FILE =
RTF_EXTENSIONS_FILE =
#---------------------------------------------------------------------------
# configuration options related to the man page output
#---------------------------------------------------------------------------
GENERATE_MAN = NO
MAN_OUTPUT =
MAN_EXTENSION =
MAN_LINKS = NO
#---------------------------------------------------------------------------
# configuration options related to the XML output
#---------------------------------------------------------------------------
GENERATE_XML = NO
#---------------------------------------------------------------------------
# configuration options for the AutoGen Definitions output
#---------------------------------------------------------------------------
GENERATE_AUTOGEN_DEF = NO
#---------------------------------------------------------------------------
# Configuration options related to the preprocessor
#---------------------------------------------------------------------------
ENABLE_PREPROCESSING = YES
MACRO_EXPANSION = NO
EXPAND_ONLY_PREDEF = NO
SEARCH_INCLUDES = YES
INCLUDE_PATH = ../include/
INCLUDE_FILE_PATTERNS =
PREDEFINED =
EXPAND_AS_DEFINED =
SKIP_FUNCTION_MACROS = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to external references
#---------------------------------------------------------------------------
TAGFILES = \
core_subset.tag=../core_subset \
math_subset.tag=../math_subset \
miniglx.tag=../miniglx
GENERATE_TAGFILE = radeon_subset.tag
ALLEXTERNALS = NO
PERL_PATH =
#---------------------------------------------------------------------------
# Configuration options related to the dot tool
#---------------------------------------------------------------------------
CLASS_DIAGRAMS = NO
HAVE_DOT = NO
CLASS_GRAPH = YES
COLLABORATION_GRAPH = YES
TEMPLATE_RELATIONS = YES
HIDE_UNDOC_RELATIONS = YES
INCLUDE_GRAPH = YES
INCLUDED_BY_GRAPH = YES
GRAPHICAL_HIERARCHY = YES
DOT_PATH =
DOTFILE_DIRS =
MAX_DOT_GRAPH_WIDTH = 1024
MAX_DOT_GRAPH_HEIGHT = 1024
GENERATE_LEGEND = YES
DOT_CLEANUP = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to the search engine
#---------------------------------------------------------------------------
SEARCHENGINE = NO
CGI_NAME =
CGI_URL =
DOC_URL =
DOC_ABSPATH =
BIN_ABSPATH =
EXT_DOC_PATHS =

View File

@@ -1,49 +0,0 @@
# Doxyfile 0.1
@INCLUDE = common.doxy
#---------------------------------------------------------------------------
# General configuration options
#---------------------------------------------------------------------------
PROJECT_NAME = "Mesa Vertex and Fragment Program code"
#---------------------------------------------------------------------------
# configuration options related to the input files
#---------------------------------------------------------------------------
INPUT = ../src/mesa/shader/
FILE_PATTERNS = *.c *.h
RECURSIVE = NO
EXCLUDE =
EXCLUDE_PATTERNS =
EXAMPLE_PATH =
EXAMPLE_PATTERNS =
EXAMPLE_RECURSIVE = NO
IMAGE_PATH =
INPUT_FILTER =
FILTER_SOURCE_FILES = NO
#---------------------------------------------------------------------------
# configuration options related to the HTML output
#---------------------------------------------------------------------------
HTML_OUTPUT = shader
#---------------------------------------------------------------------------
# Configuration options related to the preprocessor
#---------------------------------------------------------------------------
ENABLE_PREPROCESSING = YES
MACRO_EXPANSION = NO
EXPAND_ONLY_PREDEF = NO
SEARCH_INCLUDES = YES
INCLUDE_PATH = ../include/
INCLUDE_FILE_PATTERNS =
PREDEFINED =
EXPAND_AS_DEFINED =
SKIP_FUNCTION_MACROS = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to external references
#---------------------------------------------------------------------------
TAGFILES = main.tag=../core \
math.tag=../math \
tnl_dd.tag=../tnl_dd \
swrast.tag=../swrast \
swrast_setup.tag=../swrast_setup \
tnl.tag=../tnl \
vbo.tag=vbo
GENERATE_TAGFILE = swrast.tag

View File

@@ -1,48 +0,0 @@
# Doxyfile 0.1
@INCLUDE = common.doxy
#---------------------------------------------------------------------------
# General configuration options
#---------------------------------------------------------------------------
PROJECT_NAME = "Mesa Software Rasterization (swrast)"
#---------------------------------------------------------------------------
# configuration options related to the input files
#---------------------------------------------------------------------------
INPUT = ../src/mesa/swrast/
FILE_PATTERNS = *.c *.h
RECURSIVE = NO
EXCLUDE =
EXCLUDE_PATTERNS =
EXAMPLE_PATH =
EXAMPLE_PATTERNS =
EXAMPLE_RECURSIVE = NO
IMAGE_PATH =
INPUT_FILTER =
FILTER_SOURCE_FILES = NO
#---------------------------------------------------------------------------
# configuration options related to the HTML output
#---------------------------------------------------------------------------
HTML_OUTPUT = swrast
#---------------------------------------------------------------------------
# Configuration options related to the preprocessor
#---------------------------------------------------------------------------
ENABLE_PREPROCESSING = YES
MACRO_EXPANSION = NO
EXPAND_ONLY_PREDEF = NO
SEARCH_INCLUDES = YES
INCLUDE_PATH = ../include/
INCLUDE_FILE_PATTERNS =
PREDEFINED =
EXPAND_AS_DEFINED =
SKIP_FUNCTION_MACROS = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to external references
#---------------------------------------------------------------------------
TAGFILES = main.tag=../core \
math.tag=../math \
tnl_dd.tag=../tnl_dd \
swrast_setup.tag=../swrast_setup \
tnl.tag=../tnl \
vbo.tag=vbo
GENERATE_TAGFILE = swrast.tag

View File

@@ -1,49 +0,0 @@
# Doxyfile 0.1
@INCLUDE = common.doxy
#---------------------------------------------------------------------------
# General configuration options
#---------------------------------------------------------------------------
PROJECT_NAME = "Mesa swrast_setup"
#---------------------------------------------------------------------------
# configuration options related to the input files
#---------------------------------------------------------------------------
INPUT = ../src/mesa/swrast_setup/
FILE_PATTERNS = *.c \
*.h
RECURSIVE = NO
EXCLUDE =
EXCLUDE_PATTERNS =
EXAMPLE_PATH =
EXAMPLE_PATTERNS =
EXAMPLE_RECURSIVE = NO
IMAGE_PATH =
INPUT_FILTER =
FILTER_SOURCE_FILES = NO
#---------------------------------------------------------------------------
# configuration options related to the HTML output
#---------------------------------------------------------------------------
HTML_OUTPUT = swrast_setup
#---------------------------------------------------------------------------
# Configuration options related to the preprocessor
#---------------------------------------------------------------------------
ENABLE_PREPROCESSING = YES
MACRO_EXPANSION = NO
EXPAND_ONLY_PREDEF = NO
SEARCH_INCLUDES = YES
INCLUDE_PATH =
INCLUDE_FILE_PATTERNS =
PREDEFINED =
EXPAND_AS_DEFINED =
SKIP_FUNCTION_MACROS = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to external references
#---------------------------------------------------------------------------
TAGFILES = tnl_dd.tag=../tnl_dd \
main.tag=../core \
math.tag=../math \
swrast.tag=../swrast \
tnl.tag=../tnl \
vbo.tag=../vbo
GENERATE_TAGFILE = swrast_setup.tag

View File

@@ -1,50 +0,0 @@
# Doxyfile 0.1
@INCLUDE = common.doxy
#---------------------------------------------------------------------------
# General configuration options
#---------------------------------------------------------------------------
PROJECT_NAME = "Mesa Transform and Lighting (tnl)"
#---------------------------------------------------------------------------
# configuration options related to the input files
#---------------------------------------------------------------------------
INPUT = ../src/mesa/tnl/
FILE_PATTERNS = *.c \
*.h
RECURSIVE = NO
EXCLUDE =
EXCLUDE_PATTERNS =
EXAMPLE_PATH =
EXAMPLE_PATTERNS =
EXAMPLE_RECURSIVE = NO
IMAGE_PATH =
INPUT_FILTER =
FILTER_SOURCE_FILES = NO
#---------------------------------------------------------------------------
# configuration options related to the HTML output
#---------------------------------------------------------------------------
HTML_OUTPUT = tnl
#---------------------------------------------------------------------------
# Configuration options related to the preprocessor
#---------------------------------------------------------------------------
ENABLE_PREPROCESSING = YES
MACRO_EXPANSION = NO
EXPAND_ONLY_PREDEF = NO
SEARCH_INCLUDES = YES
INCLUDE_PATH =
INCLUDE_FILE_PATTERNS =
PREDEFINED =
EXPAND_AS_DEFINED =
SKIP_FUNCTION_MACROS = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to external references
#---------------------------------------------------------------------------
TAGFILES = tnl_dd.tag=../tnl \
main.tag=../core \
math.tag=../math \
shader.tag=../shader \
swrast.tag=../swrast \
swrast_setup.tag=swrast_setup \
vbo.tag=vbo
GENERATE_TAGFILE = tnl.tag

View File

@@ -1,49 +0,0 @@
# Doxyfile 0.1
@INCLUDE = common.doxy
#---------------------------------------------------------------------------
# General configuration options
#---------------------------------------------------------------------------
PROJECT_NAME = "Mesa tnl_dd"
#---------------------------------------------------------------------------
# configuration options related to the input files
#---------------------------------------------------------------------------
INPUT = ../src/mesa/tnl_dd/
FILE_PATTERNS = *.c *.h
RECURSIVE = YES
EXCLUDE =
EXCLUDE_PATTERNS =
EXAMPLE_PATH =
EXAMPLE_PATTERNS =
EXAMPLE_RECURSIVE = NO
IMAGE_PATH =
INPUT_FILTER =
FILTER_SOURCE_FILES = NO
#---------------------------------------------------------------------------
# configuration options related to the HTML output
#---------------------------------------------------------------------------
HTML_OUTPUT = tnl_dd
#---------------------------------------------------------------------------
# Configuration options related to the preprocessor
#---------------------------------------------------------------------------
ENABLE_PREPROCESSING = YES
MACRO_EXPANSION = NO
EXPAND_ONLY_PREDEF = NO
SEARCH_INCLUDES = YES
INCLUDE_PATH =
INCLUDE_FILE_PATTERNS =
PREDEFINED =
EXPAND_AS_DEFINED =
SKIP_FUNCTION_MACROS = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to external references
#---------------------------------------------------------------------------
TAGFILES = main.tag=../core \
math.tag=../math \
shader.tag=../shader \
swrast.tag=../swrast \
swrast_setup.tag=../swrast_setup \
tnl.tag=../tnl \
vbo.tag=vbo
GENERATE_TAGFILE = tnl_dd.tag

View File

@@ -1,50 +0,0 @@
# Doxyfile 0.1
@INCLUDE = common.doxy
#---------------------------------------------------------------------------
# General configuration options
#---------------------------------------------------------------------------
PROJECT_NAME = "Mesa vbo"
#---------------------------------------------------------------------------
# configuration options related to the input files
#---------------------------------------------------------------------------
INPUT = ../src/mesa/vbo/
FILE_PATTERNS = *.c \
*.h
RECURSIVE = NO
EXCLUDE =
EXCLUDE_PATTERNS =
EXAMPLE_PATH =
EXAMPLE_PATTERNS =
EXAMPLE_RECURSIVE = NO
IMAGE_PATH =
INPUT_FILTER =
FILTER_SOURCE_FILES = NO
#---------------------------------------------------------------------------
# configuration options related to the HTML output
#---------------------------------------------------------------------------
HTML_OUTPUT = vbo
#---------------------------------------------------------------------------
# Configuration options related to the preprocessor
#---------------------------------------------------------------------------
ENABLE_PREPROCESSING = YES
MACRO_EXPANSION = NO
EXPAND_ONLY_PREDEF = NO
SEARCH_INCLUDES = YES
INCLUDE_PATH =
INCLUDE_FILE_PATTERNS =
PREDEFINED =
EXPAND_AS_DEFINED =
SKIP_FUNCTION_MACROS = YES
#---------------------------------------------------------------------------
# Configuration::addtions related to external references
#---------------------------------------------------------------------------
TAGFILES = main.tag=../core \
math.tag=../math \
shader.tag=../shader \
swrast.tag=../swrast \
swrast_setup.tag=../swrast_setup \
tnl.tag=../tnl \
tnl_dd.tag=../tnl_dd
GENERATE_TAGFILE = vbo.tag

View File

@@ -1,8 +1,9 @@
/*
* Mesa 3-D graphics library
* Version: 7.5
* Version: 7.6
*
* Copyright (C) 1999-2006 Brian Paul All Rights Reserved.
* Copyright (C) 2009 VMware, Inc. All Rights Reserved.
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and associated documentation files (the "Software"),
@@ -1741,38 +1742,6 @@ GLAPI void GLAPIENTRY glGetSeparableFilter( GLenum target, GLenum format,
typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
typedef void (APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode);
typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table);
typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
typedef void (APIENTRYP PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table);
typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image);
typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image);
typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params);
typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params);
typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image);
typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span);
typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column);
typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink);
typedef void (APIENTRYP PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink);
typedef void (APIENTRYP PFNGLRESETHISTOGRAMPROC) (GLenum target);
typedef void (APIENTRYP PFNGLRESETMINMAXPROC) (GLenum target);
@@ -1978,44 +1947,8 @@ GLAPI void GLAPIENTRY glMultTransposeMatrixf( const GLfloat m[16] );
GLAPI void GLAPIENTRY glSampleCoverage( GLclampf value, GLboolean invert );
typedef void (APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture);
typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREPROC) (GLenum texture);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v);
typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFPROC) (const GLfloat *m);
typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDPROC) (const GLdouble *m);
typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFPROC) (const GLfloat *m);
typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble *m);
typedef void (APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLclampf value, GLboolean invert);
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data);
@@ -2023,7 +1956,8 @@ typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint lev
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, void *img);
typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, GLvoid *img);
/*

View File

@@ -53,6 +53,7 @@
#define glBeginFragmentShaderATI MANGLE(BeginFragmentShaderATI)
#define glBegin MANGLE(Begin)
#define glBeginOcclusionQueryNV MANGLE(BeginOcclusionQueryNV)
#define glBeginPerfMonitorAMD MANGLE(BeginPerfMonitorAMD)
#define glBeginQueryARB MANGLE(BeginQueryARB)
#define glBeginQuery MANGLE(BeginQuery)
#define glBeginTransformFeedbackEXT MANGLE(BeginTransformFeedbackEXT)
@@ -107,12 +108,20 @@
#define glBlendColorEXT MANGLE(BlendColorEXT)
#define glBlendColor MANGLE(BlendColor)
#define glBlendEquationEXT MANGLE(BlendEquationEXT)
#define glBlendEquationi MANGLE(BlendEquationi)
#define glBlendEquationIndexedAMD MANGLE(BlendEquationIndexedAMD)
#define glBlendEquation MANGLE(BlendEquation)
#define glBlendEquationSeparateATI MANGLE(BlendEquationSeparateATI)
#define glBlendEquationSeparateEXT MANGLE(BlendEquationSeparateEXT)
#define glBlendEquationSeparatei MANGLE(BlendEquationSeparatei)
#define glBlendEquationSeparateIndexedAMD MANGLE(BlendEquationSeparateIndexedAMD)
#define glBlendEquationSeparate MANGLE(BlendEquationSeparate)
#define glBlendFunci MANGLE(BlendFunci)
#define glBlendFuncIndexedAMD MANGLE(BlendFuncIndexedAMD)
#define glBlendFunc MANGLE(BlendFunc)
#define glBlendFuncSeparateEXT MANGLE(BlendFuncSeparateEXT)
#define glBlendFuncSeparatei MANGLE(BlendFuncSeparatei)
#define glBlendFuncSeparateIndexedAMD MANGLE(BlendFuncSeparateIndexedAMD)
#define glBlendFuncSeparateINGR MANGLE(BlendFuncSeparateINGR)
#define glBlendFuncSeparate MANGLE(BlendFuncSeparate)
#define glBlitFramebufferEXT MANGLE(BlitFramebufferEXT)
@@ -147,6 +156,7 @@
#define glClientActiveTexture MANGLE(ClientActiveTexture)
#define glClientActiveVertexStreamATI MANGLE(ClientActiveVertexStreamATI)
#define glClientAttribDefaultEXT MANGLE(ClientAttribDefaultEXT)
#define glClientWaitSync MANGLE(ClientWaitSync)
#define glClipPlane MANGLE(ClipPlane)
#define glColor3b MANGLE(Color3b)
#define glColor3bv MANGLE(Color3bv)
@@ -257,6 +267,7 @@
#define glConvolutionParameteri MANGLE(ConvolutionParameteri)
#define glConvolutionParameterivEXT MANGLE(ConvolutionParameterivEXT)
#define glConvolutionParameteriv MANGLE(ConvolutionParameteriv)
#define glCopyBufferSubData MANGLE(CopyBufferSubData)
#define glCopyColorSubTableEXT MANGLE(CopyColorSubTableEXT)
#define glCopyColorSubTable MANGLE(CopyColorSubTable)
#define glCopyColorTable MANGLE(CopyColorTable)
@@ -309,6 +320,7 @@
#define glDeleteLists MANGLE(DeleteLists)
#define glDeleteObjectARB MANGLE(DeleteObjectARB)
#define glDeleteOcclusionQueriesNV MANGLE(DeleteOcclusionQueriesNV)
#define glDeletePerfMonitorsAMD MANGLE(DeletePerfMonitorsAMD)
#define glDeleteProgram MANGLE(DeleteProgram)
#define glDeleteProgramsARB MANGLE(DeleteProgramsARB)
#define glDeleteProgramsNV MANGLE(DeleteProgramsNV)
@@ -317,6 +329,7 @@
#define glDeleteRenderbuffersEXT MANGLE(DeleteRenderbuffersEXT)
#define glDeleteRenderbuffers MANGLE(DeleteRenderbuffers)
#define glDeleteShader MANGLE(DeleteShader)
#define glDeleteSync MANGLE(DeleteSync)
#define glDeleteTexturesEXT MANGLE(DeleteTexturesEXT)
#define glDeleteTextures MANGLE(DeleteTextures)
#define glDeleteTransformFeedbacksNV MANGLE(DeleteTransformFeedbacksNV)
@@ -338,11 +351,13 @@
#define glDisableIndexedEXT MANGLE(DisableIndexedEXT)
#define glDisable MANGLE(Disable)
#define glDisableVariantClientStateEXT MANGLE(DisableVariantClientStateEXT)
#define glDisableVertexAttribAPPLE MANGLE(DisableVertexAttribAPPLE)
#define glDisableVertexAttribArrayARB MANGLE(DisableVertexAttribArrayARB)
#define glDisableVertexAttribArray MANGLE(DisableVertexAttribArray)
#define glDrawArraysEXT MANGLE(DrawArraysEXT)
#define glDrawArraysInstancedARB MANGLE(DrawArraysInstancedARB)
#define glDrawArraysInstancedEXT MANGLE(DrawArraysInstancedEXT)
#define glDrawArraysInstanced MANGLE(DrawArraysInstanced)
#define glDrawArrays MANGLE(DrawArrays)
#define glDrawBuffer MANGLE(DrawBuffer)
#define glDrawBuffersARB MANGLE(DrawBuffersARB)
@@ -350,13 +365,17 @@
#define glDrawBuffers MANGLE(DrawBuffers)
#define glDrawElementArrayAPPLE MANGLE(DrawElementArrayAPPLE)
#define glDrawElementArrayATI MANGLE(DrawElementArrayATI)
#define glDrawElementsBaseVertex MANGLE(DrawElementsBaseVertex)
#define glDrawElementsInstancedARB MANGLE(DrawElementsInstancedARB)
#define glDrawElementsInstancedBaseVertex MANGLE(DrawElementsInstancedBaseVertex)
#define glDrawElementsInstancedEXT MANGLE(DrawElementsInstancedEXT)
#define glDrawElementsInstanced MANGLE(DrawElementsInstanced)
#define glDrawElements MANGLE(DrawElements)
#define glDrawMeshArraysSUN MANGLE(DrawMeshArraysSUN)
#define glDrawPixels MANGLE(DrawPixels)
#define glDrawRangeElementArrayAPPLE MANGLE(DrawRangeElementArrayAPPLE)
#define glDrawRangeElementArrayATI MANGLE(DrawRangeElementArrayATI)
#define glDrawRangeElementsBaseVertex MANGLE(DrawRangeElementsBaseVertex)
#define glDrawRangeElementsEXT MANGLE(DrawRangeElementsEXT)
#define glDrawRangeElements MANGLE(DrawRangeElements)
#define glDrawTransformFeedbackNV MANGLE(DrawTransformFeedbackNV)
@@ -373,6 +392,7 @@
#define glEnableIndexedEXT MANGLE(EnableIndexedEXT)
#define glEnable MANGLE(Enable)
#define glEnableVariantClientStateEXT MANGLE(EnableVariantClientStateEXT)
#define glEnableVertexAttribAPPLE MANGLE(EnableVertexAttribAPPLE)
#define glEnableVertexAttribArrayARB MANGLE(EnableVertexAttribArrayARB)
#define glEnableVertexAttribArray MANGLE(EnableVertexAttribArray)
#define glEndConditionalRender MANGLE(EndConditionalRender)
@@ -381,6 +401,7 @@
#define glEndList MANGLE(EndList)
#define glEnd MANGLE(End)
#define glEndOcclusionQueryNV MANGLE(EndOcclusionQueryNV)
#define glEndPerfMonitorAMD MANGLE(EndPerfMonitorAMD)
#define glEndQueryARB MANGLE(EndQueryARB)
#define glEndQuery MANGLE(EndQuery)
#define glEndTransformFeedbackEXT MANGLE(EndTransformFeedbackEXT)
@@ -403,6 +424,7 @@
#define glExecuteProgramNV MANGLE(ExecuteProgramNV)
#define glExtractComponentEXT MANGLE(ExtractComponentEXT)
#define glFeedbackBuffer MANGLE(FeedbackBuffer)
#define glFenceSync MANGLE(FenceSync)
#define glFinalCombinerInputNV MANGLE(FinalCombinerInputNV)
#define glFinishAsyncSGIX MANGLE(FinishAsyncSGIX)
#define glFinishFenceAPPLE MANGLE(FinishFenceAPPLE)
@@ -463,9 +485,11 @@
#define glFramebufferTextureEXT MANGLE(FramebufferTextureEXT)
#define glFramebufferTextureFaceARB MANGLE(FramebufferTextureFaceARB)
#define glFramebufferTextureFaceEXT MANGLE(FramebufferTextureFaceEXT)
#define glFramebufferTextureFace MANGLE(FramebufferTextureFace)
#define glFramebufferTextureLayerARB MANGLE(FramebufferTextureLayerARB)
#define glFramebufferTextureLayerEXT MANGLE(FramebufferTextureLayerEXT)
#define glFramebufferTextureLayer MANGLE(FramebufferTextureLayer)
#define glFramebufferTexture MANGLE(FramebufferTexture)
#define glFrameTerminatorGREMEDY MANGLE(FrameTerminatorGREMEDY)
#define glFrameZoomSGIX MANGLE(FrameZoomSGIX)
#define glFreeObjectBufferATI MANGLE(FreeObjectBufferATI)
@@ -485,6 +509,7 @@
#define glGenFramebuffers MANGLE(GenFramebuffers)
#define glGenLists MANGLE(GenLists)
#define glGenOcclusionQueriesNV MANGLE(GenOcclusionQueriesNV)
#define glGenPerfMonitorsAMD MANGLE(GenPerfMonitorsAMD)
#define glGenProgramsARB MANGLE(GenProgramsARB)
#define glGenProgramsNV MANGLE(GenProgramsNV)
#define glGenQueriesARB MANGLE(GenQueriesARB)
@@ -501,7 +526,11 @@
#define glGetActiveAttribARB MANGLE(GetActiveAttribARB)
#define glGetActiveAttrib MANGLE(GetActiveAttrib)
#define glGetActiveUniformARB MANGLE(GetActiveUniformARB)
#define glGetActiveUniformBlockiv MANGLE(GetActiveUniformBlockiv)
#define glGetActiveUniformBlockName MANGLE(GetActiveUniformBlockName)
#define glGetActiveUniform MANGLE(GetActiveUniform)
#define glGetActiveUniformName MANGLE(GetActiveUniformName)
#define glGetActiveUniformsiv MANGLE(GetActiveUniformsiv)
#define glGetActiveVaryingNV MANGLE(GetActiveVaryingNV)
#define glGetArrayObjectfvATI MANGLE(GetArrayObjectfvATI)
#define glGetArrayObjectivATI MANGLE(GetArrayObjectivATI)
@@ -512,6 +541,7 @@
#define glGetBooleanIndexedvEXT MANGLE(GetBooleanIndexedvEXT)
#define glGetBooleani_v MANGLE(GetBooleani_v)
#define glGetBooleanv MANGLE(GetBooleanv)
#define glGetBufferParameteri64v MANGLE(GetBufferParameteri64v)
#define glGetBufferParameterivARB MANGLE(GetBufferParameterivARB)
#define glGetBufferParameteriv MANGLE(GetBufferParameteriv)
#define glGetBufferPointervARB MANGLE(GetBufferPointervARB)
@@ -575,6 +605,8 @@
#define glGetImageTransformParameterivHP MANGLE(GetImageTransformParameterivHP)
#define glGetInfoLogARB MANGLE(GetInfoLogARB)
#define glGetInstrumentsSGIX MANGLE(GetInstrumentsSGIX)
#define glGetInteger64i_v MANGLE(GetInteger64i_v)
#define glGetInteger64v MANGLE(GetInteger64v)
#define glGetIntegerIndexedvEXT MANGLE(GetIntegerIndexedvEXT)
#define glGetIntegeri_v MANGLE(GetIntegeri_v)
#define glGetIntegerv MANGLE(GetIntegerv)
@@ -604,6 +636,7 @@
#define glGetMinmaxParameterfv MANGLE(GetMinmaxParameterfv)
#define glGetMinmaxParameterivEXT MANGLE(GetMinmaxParameterivEXT)
#define glGetMinmaxParameteriv MANGLE(GetMinmaxParameteriv)
#define glGetMultisamplefv MANGLE(GetMultisamplefv)
#define glGetMultisamplefvNV MANGLE(GetMultisamplefvNV)
#define glGetMultiTexEnvfvEXT MANGLE(GetMultiTexEnvfvEXT)
#define glGetMultiTexEnvivEXT MANGLE(GetMultiTexEnvivEXT)
@@ -631,9 +664,16 @@
#define glGetObjectBufferfvATI MANGLE(GetObjectBufferfvATI)
#define glGetObjectBufferivATI MANGLE(GetObjectBufferivATI)
#define glGetObjectParameterfvARB MANGLE(GetObjectParameterfvARB)
#define glGetObjectParameterivAPPLE MANGLE(GetObjectParameterivAPPLE)
#define glGetObjectParameterivARB MANGLE(GetObjectParameterivARB)
#define glGetOcclusionQueryivNV MANGLE(GetOcclusionQueryivNV)
#define glGetOcclusionQueryuivNV MANGLE(GetOcclusionQueryuivNV)
#define glGetPerfMonitorCounterDataAMD MANGLE(GetPerfMonitorCounterDataAMD)
#define glGetPerfMonitorCounterInfoAMD MANGLE(GetPerfMonitorCounterInfoAMD)
#define glGetPerfMonitorCountersAMD MANGLE(GetPerfMonitorCountersAMD)
#define glGetPerfMonitorCounterStringAMD MANGLE(GetPerfMonitorCounterStringAMD)
#define glGetPerfMonitorGroupsAMD MANGLE(GetPerfMonitorGroupsAMD)
#define glGetPerfMonitorGroupStringAMD MANGLE(GetPerfMonitorGroupStringAMD)
#define glGetPixelMapfv MANGLE(GetPixelMapfv)
#define glGetPixelMapuiv MANGLE(GetPixelMapuiv)
#define glGetPixelMapusv MANGLE(GetPixelMapusv)
@@ -681,6 +721,7 @@
#define glGetSharpenTexFuncSGIS MANGLE(GetSharpenTexFuncSGIS)
#define glGetStringi MANGLE(GetStringi)
#define glGetString MANGLE(GetString)
#define glGetSynciv MANGLE(GetSynciv)
#define glGetTexBumpParameterfvATI MANGLE(GetTexBumpParameterfvATI)
#define glGetTexBumpParameterivATI MANGLE(GetTexBumpParameterivATI)
#define glGetTexEnvfv MANGLE(GetTexEnvfv)
@@ -698,6 +739,7 @@
#define glGetTexParameterIuivEXT MANGLE(GetTexParameterIuivEXT)
#define glGetTexParameterIuiv MANGLE(GetTexParameterIuiv)
#define glGetTexParameteriv MANGLE(GetTexParameteriv)
#define glGetTexParameterPointervAPPLE MANGLE(GetTexParameterPointervAPPLE)
#define glGetTextureImageEXT MANGLE(GetTextureImageEXT)
#define glGetTextureLevelParameterfvEXT MANGLE(GetTextureLevelParameterfvEXT)
#define glGetTextureLevelParameterivEXT MANGLE(GetTextureLevelParameterivEXT)
@@ -709,9 +751,11 @@
#define glGetTransformFeedbackVaryingEXT MANGLE(GetTransformFeedbackVaryingEXT)
#define glGetTransformFeedbackVarying MANGLE(GetTransformFeedbackVarying)
#define glGetTransformFeedbackVaryingNV MANGLE(GetTransformFeedbackVaryingNV)
#define glGetUniformBlockIndex MANGLE(GetUniformBlockIndex)
#define glGetUniformBufferSizeEXT MANGLE(GetUniformBufferSizeEXT)
#define glGetUniformfvARB MANGLE(GetUniformfvARB)
#define glGetUniformfv MANGLE(GetUniformfv)
#define glGetUniformIndices MANGLE(GetUniformIndices)
#define glGetUniformivARB MANGLE(GetUniformivARB)
#define glGetUniformiv MANGLE(GetUniformiv)
#define glGetUniformLocationARB MANGLE(GetUniformLocationARB)
@@ -744,6 +788,10 @@
#define glGetVertexAttribPointervARB MANGLE(GetVertexAttribPointervARB)
#define glGetVertexAttribPointerv MANGLE(GetVertexAttribPointerv)
#define glGetVertexAttribPointervNV MANGLE(GetVertexAttribPointervNV)
#define glGetVideoi64vNV MANGLE(GetVideoi64vNV)
#define glGetVideoivNV MANGLE(GetVideoivNV)
#define glGetVideoui64vNV MANGLE(GetVideoui64vNV)
#define glGetVideouivNV MANGLE(GetVideouivNV)
#define glGlobalAlphaFactorbSUN MANGLE(GlobalAlphaFactorbSUN)
#define glGlobalAlphaFactordSUN MANGLE(GlobalAlphaFactordSUN)
#define glGlobalAlphaFactorfSUN MANGLE(GlobalAlphaFactorfSUN)
@@ -802,12 +850,14 @@
#define glIsRenderbufferEXT MANGLE(IsRenderbufferEXT)
#define glIsRenderbuffer MANGLE(IsRenderbuffer)
#define glIsShader MANGLE(IsShader)
#define glIsSync MANGLE(IsSync)
#define glIsTextureEXT MANGLE(IsTextureEXT)
#define glIsTexture MANGLE(IsTexture)
#define glIsTransformFeedbackNV MANGLE(IsTransformFeedbackNV)
#define glIsVariantEnabledEXT MANGLE(IsVariantEnabledEXT)
#define glIsVertexArrayAPPLE MANGLE(IsVertexArrayAPPLE)
#define glIsVertexArray MANGLE(IsVertexArray)
#define glIsVertexAttribEnabledAPPLE MANGLE(IsVertexAttribEnabledAPPLE)
#define glLightEnviSGIX MANGLE(LightEnviSGIX)
#define glLightf MANGLE(Lightf)
#define glLightfv MANGLE(Lightfv)
@@ -854,6 +904,10 @@
#define glMapObjectBufferATI MANGLE(MapObjectBufferATI)
#define glMapParameterfvNV MANGLE(MapParameterfvNV)
#define glMapParameterivNV MANGLE(MapParameterivNV)
#define glMapVertexAttrib1dAPPLE MANGLE(MapVertexAttrib1dAPPLE)
#define glMapVertexAttrib1fAPPLE MANGLE(MapVertexAttrib1fAPPLE)
#define glMapVertexAttrib2dAPPLE MANGLE(MapVertexAttrib2dAPPLE)
#define glMapVertexAttrib2fAPPLE MANGLE(MapVertexAttrib2fAPPLE)
#define glMaterialf MANGLE(Materialf)
#define glMaterialfv MANGLE(Materialfv)
#define glMateriali MANGLE(Materiali)
@@ -884,9 +938,11 @@
#define glMatrixTranslatefEXT MANGLE(MatrixTranslatefEXT)
#define glMinmaxEXT MANGLE(MinmaxEXT)
#define glMinmax MANGLE(Minmax)
#define glMinSampleShading MANGLE(MinSampleShading)
#define glMultiDrawArraysEXT MANGLE(MultiDrawArraysEXT)
#define glMultiDrawArrays MANGLE(MultiDrawArrays)
#define glMultiDrawElementArrayAPPLE MANGLE(MultiDrawElementArrayAPPLE)
#define glMultiDrawElementsBaseVertex MANGLE(MultiDrawElementsBaseVertex)
#define glMultiDrawElementsEXT MANGLE(MultiDrawElementsEXT)
#define glMultiDrawElements MANGLE(MultiDrawElements)
#define glMultiDrawRangeElementArrayAPPLE MANGLE(MultiDrawRangeElementArrayAPPLE)
@@ -1049,6 +1105,8 @@
#define glNormalStream3ivATI MANGLE(NormalStream3ivATI)
#define glNormalStream3sATI MANGLE(NormalStream3sATI)
#define glNormalStream3svATI MANGLE(NormalStream3svATI)
#define glObjectPurgeableAPPLE MANGLE(ObjectPurgeableAPPLE)
#define glObjectUnpurgeableAPPLE MANGLE(ObjectUnpurgeableAPPLE)
#define glOrtho MANGLE(Ortho)
#define glPassTexCoordATI MANGLE(PassTexCoordATI)
#define glPassThrough MANGLE(PassThrough)
@@ -1096,6 +1154,9 @@
#define glPopClientAttrib MANGLE(PopClientAttrib)
#define glPopMatrix MANGLE(PopMatrix)
#define glPopName MANGLE(PopName)
#define glPresentFrameDualFillNV MANGLE(PresentFrameDualFillNV)
#define glPresentFrameKeyedNV MANGLE(PresentFrameKeyedNV)
#define glPrimitiveRestartIndex MANGLE(PrimitiveRestartIndex)
#define glPrimitiveRestartIndexNV MANGLE(PrimitiveRestartIndexNV)
#define glPrimitiveRestartNV MANGLE(PrimitiveRestartNV)
#define glPrioritizeTexturesEXT MANGLE(PrioritizeTexturesEXT)
@@ -1136,6 +1197,7 @@
#define glProgramParameter4fvNV MANGLE(ProgramParameter4fvNV)
#define glProgramParameteriARB MANGLE(ProgramParameteriARB)
#define glProgramParameteriEXT MANGLE(ProgramParameteriEXT)
#define glProgramParameteri MANGLE(ProgramParameteri)
#define glProgramParameters4dvNV MANGLE(ProgramParameters4dvNV)
#define glProgramParameters4fvNV MANGLE(ProgramParameters4fvNV)
#define glProgramStringARB MANGLE(ProgramStringARB)
@@ -1173,6 +1235,8 @@
#define glProgramUniformMatrix4x2fvEXT MANGLE(ProgramUniformMatrix4x2fvEXT)
#define glProgramUniformMatrix4x3fvEXT MANGLE(ProgramUniformMatrix4x3fvEXT)
#define glProgramVertexLimitNV MANGLE(ProgramVertexLimitNV)
#define glProvokingVertexEXT MANGLE(ProvokingVertexEXT)
#define glProvokingVertex MANGLE(ProvokingVertex)
#define glPushAttrib MANGLE(PushAttrib)
#define glPushClientAttribDefaultEXT MANGLE(PushClientAttribDefaultEXT)
#define glPushClientAttrib MANGLE(PushClientAttrib)
@@ -1256,6 +1320,7 @@
#define glSampleCoverage MANGLE(SampleCoverage)
#define glSampleMapATI MANGLE(SampleMapATI)
#define glSampleMaskEXT MANGLE(SampleMaskEXT)
#define glSampleMaski MANGLE(SampleMaski)
#define glSampleMaskIndexedNV MANGLE(SampleMaskIndexedNV)
#define glSampleMaskSGIS MANGLE(SampleMaskSGIS)
#define glSamplePatternEXT MANGLE(SamplePatternEXT)
@@ -1301,6 +1366,7 @@
#define glSecondaryColorPointerListIBM MANGLE(SecondaryColorPointerListIBM)
#define glSecondaryColorPointer MANGLE(SecondaryColorPointer)
#define glSelectBuffer MANGLE(SelectBuffer)
#define glSelectPerfMonitorCountersAMD MANGLE(SelectPerfMonitorCountersAMD)
#define glSeparableFilter2DEXT MANGLE(SeparableFilter2DEXT)
#define glSeparableFilter2D MANGLE(SeparableFilter2D)
#define glSetFenceAPPLE MANGLE(SetFenceAPPLE)
@@ -1345,11 +1411,14 @@
#define glTangent3svEXT MANGLE(Tangent3svEXT)
#define glTangentPointerEXT MANGLE(TangentPointerEXT)
#define glTbufferMask3DFX MANGLE(TbufferMask3DFX)
#define glTessellationFactorAMD MANGLE(TessellationFactorAMD)
#define glTessellationModeAMD MANGLE(TessellationModeAMD)
#define glTestFenceAPPLE MANGLE(TestFenceAPPLE)
#define glTestFenceNV MANGLE(TestFenceNV)
#define glTestObjectAPPLE MANGLE(TestObjectAPPLE)
#define glTexBufferARB MANGLE(TexBufferARB)
#define glTexBufferEXT MANGLE(TexBufferEXT)
#define glTexBuffer MANGLE(TexBuffer)
#define glTexBumpParameterfvATI MANGLE(TexBumpParameterfvATI)
#define glTexBumpParameterivATI MANGLE(TexBumpParameterivATI)
#define glTexCoord1d MANGLE(TexCoord1d)
@@ -1423,8 +1492,10 @@
#define glTexGeniv MANGLE(TexGeniv)
#define glTexImage1D MANGLE(TexImage1D)
#define glTexImage2D MANGLE(TexImage2D)
#define glTexImage2DMultisample MANGLE(TexImage2DMultisample)
#define glTexImage3DEXT MANGLE(TexImage3DEXT)
#define glTexImage3D MANGLE(TexImage3D)
#define glTexImage3DMultisample MANGLE(TexImage3DMultisample)
#define glTexImage4DSGIS MANGLE(TexImage4DSGIS)
#define glTexParameterf MANGLE(TexParameterf)
#define glTexParameterfv MANGLE(TexParameterfv)
@@ -1456,6 +1527,7 @@
#define glTextureParameterIivEXT MANGLE(TextureParameterIivEXT)
#define glTextureParameterIuivEXT MANGLE(TextureParameterIuivEXT)
#define glTextureParameterivEXT MANGLE(TextureParameterivEXT)
#define glTextureRangeAPPLE MANGLE(TextureRangeAPPLE)
#define glTextureRenderbufferEXT MANGLE(TextureRenderbufferEXT)
#define glTextureSubImage1DEXT MANGLE(TextureSubImage1DEXT)
#define glTextureSubImage2DEXT MANGLE(TextureSubImage2DEXT)
@@ -1515,6 +1587,7 @@
#define glUniform4ui MANGLE(Uniform4ui)
#define glUniform4uivEXT MANGLE(Uniform4uivEXT)
#define glUniform4uiv MANGLE(Uniform4uiv)
#define glUniformBlockBinding MANGLE(UniformBlockBinding)
#define glUniformBufferEXT MANGLE(UniformBufferEXT)
#define glUniformMatrix2fvARB MANGLE(UniformMatrix2fvARB)
#define glUniformMatrix2fv MANGLE(UniformMatrix2fv)
@@ -1688,7 +1761,7 @@
#define glVertexAttrib4usvARB MANGLE(VertexAttrib4usvARB)
#define glVertexAttrib4usv MANGLE(VertexAttrib4usv)
#define glVertexAttribArrayObjectATI MANGLE(VertexAttribArrayObjectATI)
#define glVertexAttribDivisor MANGLE(VertexAttribDivisor)
#define glVertexAttribDivisorARB MANGLE(VertexAttribDivisorARB)
#define glVertexAttribI1iEXT MANGLE(VertexAttribI1iEXT)
#define glVertexAttribI1i MANGLE(VertexAttribI1i)
#define glVertexAttribI1ivEXT MANGLE(VertexAttribI1ivEXT)
@@ -1796,6 +1869,7 @@
#define glVertexWeighthvNV MANGLE(VertexWeighthvNV)
#define glVertexWeightPointerEXT MANGLE(VertexWeightPointerEXT)
#define glViewport MANGLE(Viewport)
#define glWaitSync MANGLE(WaitSync)
#define glWeightbvARB MANGLE(WeightbvARB)
#define glWeightdvARB MANGLE(WeightdvARB)
#define glWeightfvARB MANGLE(WeightfvARB)

File diff suppressed because it is too large Load Diff

View File

@@ -76,6 +76,7 @@
/* GLX 1.4 */
#define glXGetProcAddress mglXGetProcAddress
#define glXGetProcAddressARB mglXGetProcAddressARB
#endif

View File

@@ -6,7 +6,7 @@ extern "C" {
#endif
/*
** Copyright (c) 2007 The Khronos Group Inc.
** Copyright (c) 2007-2009 The Khronos Group Inc.
**
** Permission is hereby granted, free of charge, to any person obtaining a
** copy of this software and/or associated documentation files (the
@@ -28,6 +28,8 @@ extern "C" {
** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS.
*/
/* Function declaration macros - to move into glplatform.h */
#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__)
#define WIN32_LEAN_AND_MEAN 1
#include <windows.h>
@@ -46,9 +48,9 @@ extern "C" {
/*************************************************************/
/* Header file version number, required by OpenGL ABI for Linux */
/* glxext.h last updated 2008/10/22 */
/* glxext.h last updated 2009/10/08 */
/* Current version at http://www.opengl.org/registry/ */
#define GLX_GLXEXT_VERSION 21
#define GLX_GLXEXT_VERSION 25
#ifndef GLX_VERSION_1_3
#define GLX_WINDOW_BIT 0x00000001
@@ -135,6 +137,12 @@ extern "C" {
#define GLX_CONTEXT_FLAGS_ARB 0x2094
#endif
#ifndef GLX_ARB_create_context_profile
#define GLX_CONTEXT_CORE_PROFILE_BIT_ARB 0x00000001
#define GLX_CONTEXT_COMPATIBILITY_PROFILE_BIT_ARB 0x00000002
#define GLX_CONTEXT_PROFILE_MASK_ARB 0x9126
#endif
#ifndef GLX_SGIS_multisample
#define GLX_SAMPLE_BUFFERS_SGIS 100000
#define GLX_SAMPLES_SGIS 100001
@@ -374,6 +382,20 @@ extern "C" {
#ifndef GLX_NV_swap_group
#endif
#ifndef GLX_NV_video_capture
#define GLX_DEVICE_ID_NV 0x20CD
#define GLX_UNIQUE_ID_NV 0x20CE
#define GLX_NUM_VIDEO_CAPTURE_SLOTS_NV 0x20CF
#endif
#ifndef GLX_EXT_swap_control
#define GLX_SWAP_INTERVAL_EXT 0x20F1
#define GLX_MAX_SWAP_INTERVAL_EXT 0x20F2
#endif
#ifndef GLX_NV_copy_image
#endif
/*************************************************************/
@@ -407,6 +429,14 @@ typedef struct {
} GLXBufferClobberEventSGIX;
#endif
#ifndef GLX_NV_video_output
typedef unsigned int GLXVideoDeviceNV;
#endif
#ifndef GLX_NV_video_capture
typedef XID GLXVideoCaptureDeviceNV;
#endif
#ifndef GLEXT_64_TYPES_DEFINED
/* This code block is duplicated in glext.h, so must be protected */
#define GLEXT_64_TYPES_DEFINED
@@ -518,6 +548,10 @@ extern GLXContext glXCreateContextAttribsARB (Display *, GLXFBConfig, GLXContext
typedef GLXContext ( * PFNGLXCREATECONTEXTATTRIBSARBPROC) (Display *dpy, GLXFBConfig config, GLXContext share_context, Bool direct, const int *attrib_list);
#endif
#ifndef GLX_ARB_create_context_profile
#define GLX_ARB_create_context_profile 1
#endif
#ifndef GLX_SGIS_multisample
#define GLX_SGIS_multisample 1
#endif
@@ -815,14 +849,80 @@ typedef void ( * PFNGLXRELEASETEXIMAGEEXTPROC) (Display *dpy, GLXDrawable drawab
#ifndef GLX_NV_present_video
#define GLX_NV_present_video 1
#ifdef GLX_GLXEXT_PROTOTYPES
extern unsigned int * glXEnumerateVideoDevicesNV (Display *, int, int *);
extern int glXBindVideoDeviceNV (Display *, unsigned int, unsigned int, const int *);
#endif /* GLX_GLXEXT_PROTOTYPES */
typedef unsigned int * ( * PFNGLXENUMERATEVIDEODEVICESNVPROC) (Display *dpy, int screen, int *nelements);
typedef int ( * PFNGLXBINDVIDEODEVICENVPROC) (Display *dpy, unsigned int video_slot, unsigned int video_device, const int *attrib_list);
#endif
#ifndef GLX_NV_video_out
#define GLX_NV_video_out 1
#ifndef GLX_NV_video_output
#define GLX_NV_video_output 1
#ifdef GLX_GLXEXT_PROTOTYPES
extern int glXGetVideoDeviceNV (Display *, int, int, GLXVideoDeviceNV *);
extern int glXReleaseVideoDeviceNV (Display *, int, GLXVideoDeviceNV);
extern int glXBindVideoImageNV (Display *, GLXVideoDeviceNV, GLXPbuffer, int);
extern int glXReleaseVideoImageNV (Display *, GLXPbuffer);
extern int glXSendPbufferToVideoNV (Display *, GLXPbuffer, int, unsigned long *, GLboolean);
extern int glXGetVideoInfoNV (Display *, int, GLXVideoDeviceNV, unsigned long *, unsigned long *);
#endif /* GLX_GLXEXT_PROTOTYPES */
typedef int ( * PFNGLXGETVIDEODEVICENVPROC) (Display *dpy, int screen, int numVideoDevices, GLXVideoDeviceNV *pVideoDevice);
typedef int ( * PFNGLXRELEASEVIDEODEVICENVPROC) (Display *dpy, int screen, GLXVideoDeviceNV VideoDevice);
typedef int ( * PFNGLXBINDVIDEOIMAGENVPROC) (Display *dpy, GLXVideoDeviceNV VideoDevice, GLXPbuffer pbuf, int iVideoBuffer);
typedef int ( * PFNGLXRELEASEVIDEOIMAGENVPROC) (Display *dpy, GLXPbuffer pbuf);
typedef int ( * PFNGLXSENDPBUFFERTOVIDEONVPROC) (Display *dpy, GLXPbuffer pbuf, int iBufferType, unsigned long *pulCounterPbuffer, GLboolean bBlock);
typedef int ( * PFNGLXGETVIDEOINFONVPROC) (Display *dpy, int screen, GLXVideoDeviceNV VideoDevice, unsigned long *pulCounterOutputPbuffer, unsigned long *pulCounterOutputVideo);
#endif
#ifndef GLX_NV_swap_group
#define GLX_NV_swap_group 1
#ifdef GLX_GLXEXT_PROTOTYPES
extern Bool glXJoinSwapGroupNV (Display *, GLXDrawable, GLuint);
extern Bool glXBindSwapBarrierNV (Display *, GLuint, GLuint);
extern Bool glXQuerySwapGroupNV (Display *, GLXDrawable, GLuint *, GLuint *);
extern Bool glXQueryMaxSwapGroupsNV (Display *, int, GLuint *, GLuint *);
extern Bool glXQueryFrameCountNV (Display *, int, GLuint *);
extern Bool glXResetFrameCountNV (Display *, int);
#endif /* GLX_GLXEXT_PROTOTYPES */
typedef Bool ( * PFNGLXJOINSWAPGROUPNVPROC) (Display *dpy, GLXDrawable drawable, GLuint group);
typedef Bool ( * PFNGLXBINDSWAPBARRIERNVPROC) (Display *dpy, GLuint group, GLuint barrier);
typedef Bool ( * PFNGLXQUERYSWAPGROUPNVPROC) (Display *dpy, GLXDrawable drawable, GLuint *group, GLuint *barrier);
typedef Bool ( * PFNGLXQUERYMAXSWAPGROUPSNVPROC) (Display *dpy, int screen, GLuint *maxGroups, GLuint *maxBarriers);
typedef Bool ( * PFNGLXQUERYFRAMECOUNTNVPROC) (Display *dpy, int screen, GLuint *count);
typedef Bool ( * PFNGLXRESETFRAMECOUNTNVPROC) (Display *dpy, int screen);
#endif
#ifndef GLX_NV_video_capture
#define GLX_NV_video_capture 1
#ifdef GLX_GLXEXT_PROTOTYPES
extern int glXBindVideoCaptureDeviceNV (Display *, unsigned int, GLXVideoCaptureDeviceNV);
extern GLXVideoCaptureDeviceNV * glXEnumerateVideoCaptureDevicesNV (Display *, int, int *);
extern void glXLockVideoCaptureDeviceNV (Display *, GLXVideoCaptureDeviceNV);
extern int glXQueryVideoCaptureDeviceNV (Display *, GLXVideoCaptureDeviceNV, int, int *);
extern void glXReleaseVideoCaptureDeviceNV (Display *, GLXVideoCaptureDeviceNV);
#endif /* GLX_GLXEXT_PROTOTYPES */
typedef int ( * PFNGLXBINDVIDEOCAPTUREDEVICENVPROC) (Display *dpy, unsigned int video_capture_slot, GLXVideoCaptureDeviceNV device);
typedef GLXVideoCaptureDeviceNV * ( * PFNGLXENUMERATEVIDEOCAPTUREDEVICESNVPROC) (Display *dpy, int screen, int *nelements);
typedef void ( * PFNGLXLOCKVIDEOCAPTUREDEVICENVPROC) (Display *dpy, GLXVideoCaptureDeviceNV device);
typedef int ( * PFNGLXQUERYVIDEOCAPTUREDEVICENVPROC) (Display *dpy, GLXVideoCaptureDeviceNV device, int attribute, int *value);
typedef void ( * PFNGLXRELEASEVIDEOCAPTUREDEVICENVPROC) (Display *dpy, GLXVideoCaptureDeviceNV device);
#endif
#ifndef GLX_EXT_swap_control
#define GLX_EXT_swap_control 1
#ifdef GLX_GLXEXT_PROTOTYPES
extern int glXSwapIntervalEXT (Display *, GLXDrawable, int);
#endif /* GLX_GLXEXT_PROTOTYPES */
typedef int ( * PFNGLXSWAPINTERVALEXTPROC) (Display *dpy, GLXDrawable drawable, int interval);
#endif
#ifndef GLX_NV_copy_image
#define GLX_NV_copy_image 1
#ifdef GLX_GLXEXT_PROTOTYPES
extern void glXCopyImageSubDataNV (Display *, GLXContext, GLuint, GLenum, GLint, GLint, GLint, GLint, GLXContext, GLuint, GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei);
#endif /* GLX_GLXEXT_PROTOTYPES */
typedef void ( * PFNGLXCOPYIMAGESUBDATANVPROC) (Display *dpy, GLXContext srcCtx, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLXContext dstCtx, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth);
#endif

View File

@@ -6,7 +6,7 @@ extern "C" {
#endif
/*
** Copyright (c) 2007 The Khronos Group Inc.
** Copyright (c) 2007-2009 The Khronos Group Inc.
**
** Permission is hereby granted, free of charge, to any person obtaining a
** copy of this software and/or associated documentation files (the
@@ -28,6 +28,8 @@ extern "C" {
** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS.
*/
/* Function declaration macros - to move into glplatform.h */
#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__)
#define WIN32_LEAN_AND_MEAN 1
#include <windows.h>
@@ -46,9 +48,9 @@ extern "C" {
/*************************************************************/
/* Header file version number */
/* wglext.h last updated 2009/03/03 */
/* wglext.h last updated 2009/09/16 */
/* Current version at http://www.opengl.org/registry/ */
#define WGL_WGLEXT_VERSION 12
#define WGL_WGLEXT_VERSION 17
#ifndef WGL_ARB_buffer_region
#define WGL_FRONT_COLOR_BUFFER_BIT_ARB 0x00000001
@@ -174,8 +176,8 @@ extern "C" {
#endif
#ifndef WGL_ARB_create_context
#define WGL_CONTEXT_DEBUG_BIT_ARB 0x0001
#define WGL_CONTEXT_FORWARD_COMPATIBLE_BIT_ARB 0x0002
#define WGL_CONTEXT_DEBUG_BIT_ARB 0x00000001
#define WGL_CONTEXT_FORWARD_COMPATIBLE_BIT_ARB 0x00000002
#define WGL_CONTEXT_MAJOR_VERSION_ARB 0x2091
#define WGL_CONTEXT_MINOR_VERSION_ARB 0x2092
#define WGL_CONTEXT_LAYER_PLANE_ARB 0x2093
@@ -183,6 +185,13 @@ extern "C" {
#define ERROR_INVALID_VERSION_ARB 0x2095
#endif
#ifndef WGL_ARB_create_context_profile
#define WGL_CONTEXT_PROFILE_MASK_ARB 0x9126
#define WGL_CONTEXT_CORE_PROFILE_BIT_ARB 0x00000001
#define WGL_CONTEXT_COMPATIBILITY_PROFILE_BIT_ARB 0x00000002
#define ERROR_INVALID_PROFILE_ARB 0x2096
#endif
#ifndef WGL_EXT_make_current_read
#define ERROR_INVALID_PIXEL_TYPE_EXT 0x2043
#endif
@@ -379,6 +388,14 @@ extern "C" {
#define WGL_GPU_NUM_SPI_AMD 0x21A8
#endif
#ifndef NV_video_capture
#define WGL_UNIQUE_ID_NV 0x20CE
#define WGL_NUM_VIDEO_CAPTURE_SLOTS_NV 0x20CF
#endif
#ifndef NV_copy_image
#endif
/*************************************************************/
@@ -391,7 +408,7 @@ DECLARE_HANDLE(HPBUFFEREXT);
#ifndef WGL_NV_present_video
DECLARE_HANDLE(HVIDEOOUTPUTDEVICENV);
#endif
#ifndef WGL_NV_video_out
#ifndef WGL_NV_video_output
DECLARE_HANDLE(HPVIDEODEV);
#endif
#ifndef WGL_NV_gpu_affinity
@@ -406,6 +423,9 @@ typedef struct _GPU_DEVICE {
RECT rcVirtualScreen;
} GPU_DEVICE, *PGPU_DEVICE;
#endif
#ifndef WGL_NV_video_capture
DECLARE_HANDLE(HVIDEOINPUTDEVICENV);
#endif
#ifndef WGL_ARB_buffer_region
#define WGL_ARB_buffer_region 1
@@ -495,6 +515,10 @@ extern HGLRC WINAPI wglCreateContextAttribsARB (HDC, HGLRC, const int *);
typedef HGLRC (WINAPI * PFNWGLCREATECONTEXTATTRIBSARBPROC) (HDC hDC, HGLRC hShareContext, const int *attribList);
#endif
#ifndef WGL_ARB_create_context_profile
#define WGL_ARB_create_context_profile 1
#endif
#ifndef WGL_EXT_display_color_table
#define WGL_EXT_display_color_table 1
#ifdef WGL_WGLEXT_PROTOTYPES
@@ -709,6 +733,14 @@ typedef BOOL (WINAPI * PFNWGLQUERYFRAMETRACKINGI3DPROC) (DWORD *pFrameCount, DWO
#define WGL_NV_float_buffer 1
#endif
#ifndef WGL_3DL_stereo_control
#define WGL_3DL_stereo_control 1
#ifdef WGL_WGLEXT_PROTOTYPES
extern BOOL WINAPI wglSetStereoEmitterState3DL (HDC, UINT);
#endif /* WGL_WGLEXT_PROTOTYPES */
typedef BOOL (WINAPI * PFNWGLSETSTEREOEMITTERSTATE3DLPROC) (HDC hDC, UINT uState);
#endif
#ifndef WGL_EXT_pixel_format_packed_float
#define WGL_EXT_pixel_format_packed_float 1
#endif
@@ -729,8 +761,8 @@ typedef BOOL (WINAPI * PFNWGLBINDVIDEODEVICENVPROC) (HDC hDC, unsigned int uVide
typedef BOOL (WINAPI * PFNWGLQUERYCURRENTCONTEXTNVPROC) (int iAttribute, int *piValue);
#endif
#ifndef WGL_NV_video_out
#define WGL_NV_video_out 1
#ifndef WGL_NV_video_output
#define WGL_NV_video_output 1
#ifdef WGL_WGLEXT_PROTOTYPES
extern BOOL WINAPI wglGetVideoDeviceNV (HDC, int, HPVIDEODEV *);
extern BOOL WINAPI wglReleaseVideoDeviceNV (HPVIDEODEV);
@@ -805,6 +837,30 @@ typedef HGLRC (WINAPI * PFNWGLGETCURRENTASSOCIATEDCONTEXTAMDPROC) (void);
typedef VOID (WINAPI * PFNWGLBLITCONTEXTFRAMEBUFFERAMDPROC) (HGLRC dstCtx, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter);
#endif
#ifndef WGL_NV_video_capture
#define WGL_NV_video_capture 1
#ifdef WGL_WGLEXT_PROTOTYPES
extern BOOL WINAPI wglBindVideoCaptureDeviceNV (UINT, HVIDEOINPUTDEVICENV);
extern UINT WINAPI wglEnumerateVideoCaptureDevicesNV (HDC, HVIDEOINPUTDEVICENV *);
extern BOOL WINAPI wglLockVideoCaptureDeviceNV (HDC, HVIDEOINPUTDEVICENV);
extern BOOL WINAPI wglQueryVideoCaptureDeviceNV (HDC, HVIDEOINPUTDEVICENV, int, int *);
extern BOOL WINAPI wglReleaseVideoCaptureDeviceNV (HDC, HVIDEOINPUTDEVICENV);
#endif /* WGL_WGLEXT_PROTOTYPES */
typedef BOOL (WINAPI * PFNWGLBINDVIDEOCAPTUREDEVICENVPROC) (UINT uVideoSlot, HVIDEOINPUTDEVICENV hDevice);
typedef UINT (WINAPI * PFNWGLENUMERATEVIDEOCAPTUREDEVICESNVPROC) (HDC hDc, HVIDEOINPUTDEVICENV *phDeviceList);
typedef BOOL (WINAPI * PFNWGLLOCKVIDEOCAPTUREDEVICENVPROC) (HDC hDc, HVIDEOINPUTDEVICENV hDevice);
typedef BOOL (WINAPI * PFNWGLQUERYVIDEOCAPTUREDEVICENVPROC) (HDC hDc, HVIDEOINPUTDEVICENV hDevice, int iAttribute, int *piValue);
typedef BOOL (WINAPI * PFNWGLRELEASEVIDEOCAPTUREDEVICENVPROC) (HDC hDc, HVIDEOINPUTDEVICENV hDevice);
#endif
#ifndef WGL_NV_copy_image
#define WGL_NV_copy_image 1
#ifdef WGL_WGLEXT_PROTOTYPES
extern BOOL WINAPI wglCopyImageSubDataNV (HGLRC, GLuint, GLenum, GLint, GLint, GLint, GLint, HGLRC, GLuint, GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei);
#endif /* WGL_WGLEXT_PROTOTYPES */
typedef BOOL (WINAPI * PFNWGLCOPYIMAGESUBDATANVPROC) (HGLRC hSrcRC, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, HGLRC hDstRC, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth);
#endif
#ifdef __cplusplus
}

686
include/VG/openvg.h Normal file
View File

@@ -0,0 +1,686 @@
/* $Revision: 6822 $ on $Date:: 2008-10-30 05:14:19 -0400 #$ */
/*------------------------------------------------------------------------
*
* OpenVG 1.0.1 Reference Implementation
* -------------------------------------
*
* Copyright (c) 2008 The Khronos Group Inc.
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and /or associated documentation files
* (the "Materials "), to deal in the Materials without restriction,
* including without limitation the rights to use, copy, modify, merge,
* publish, distribute, sublicense, and/or sell copies of the Materials,
* and to permit persons to whom the Materials are furnished to do so,
* subject to the following conditions:
*
* The above copyright notice and this permission notice shall be included
* in all copies or substantial portions of the Materials.
*
* THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
* IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
* DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
* OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
* THE USE OR OTHER DEALINGS IN THE MATERIALS.
*
*//**
* \file
* \brief OpenVG 1.0.1 API.
*//*-------------------------------------------------------------------*/
#ifndef _OPENVG_H
#define _OPENVG_H
#include <VG/vgplatform.h>
#ifdef __cplusplus
extern "C" {
#endif
#define OPENVG_VERSION_1_0 1
#define OPENVG_VERSION_1_0_1 1
#ifndef VG_MAXSHORT
#define VG_MAXSHORT 0x7FFF
#endif
#ifndef VG_MAXINT
#define VG_MAXINT 0x7FFFFFFF
#endif
#ifndef VG_MAX_ENUM
#define VG_MAX_ENUM 0x7FFFFFFF
#endif
typedef long VGHandle;
typedef VGHandle VGPath;
typedef VGHandle VGImage;
typedef VGHandle VGPaint;
#define VG_INVALID_HANDLE ((VGHandle)0)
typedef enum {
VG_FALSE = 0,
VG_TRUE = 1,
VG_BOOLEAN_FORCE_SIZE = VG_MAX_ENUM
} VGboolean;
typedef enum {
VG_NO_ERROR = 0,
VG_BAD_HANDLE_ERROR = 0x1000,
VG_ILLEGAL_ARGUMENT_ERROR = 0x1001,
VG_OUT_OF_MEMORY_ERROR = 0x1002,
VG_PATH_CAPABILITY_ERROR = 0x1003,
VG_UNSUPPORTED_IMAGE_FORMAT_ERROR = 0x1004,
VG_UNSUPPORTED_PATH_FORMAT_ERROR = 0x1005,
VG_IMAGE_IN_USE_ERROR = 0x1006,
VG_NO_CONTEXT_ERROR = 0x1007,
VG_ERROR_CODE_FORCE_SIZE = VG_MAX_ENUM
} VGErrorCode;
typedef enum {
/* Mode settings */
VG_MATRIX_MODE = 0x1100,
VG_FILL_RULE = 0x1101,
VG_IMAGE_QUALITY = 0x1102,
VG_RENDERING_QUALITY = 0x1103,
VG_BLEND_MODE = 0x1104,
VG_IMAGE_MODE = 0x1105,
/* Scissoring rectangles */
VG_SCISSOR_RECTS = 0x1106,
/* Stroke parameters */
VG_STROKE_LINE_WIDTH = 0x1110,
VG_STROKE_CAP_STYLE = 0x1111,
VG_STROKE_JOIN_STYLE = 0x1112,
VG_STROKE_MITER_LIMIT = 0x1113,
VG_STROKE_DASH_PATTERN = 0x1114,
VG_STROKE_DASH_PHASE = 0x1115,
VG_STROKE_DASH_PHASE_RESET = 0x1116,
/* Edge fill color for VG_TILE_FILL tiling mode */
VG_TILE_FILL_COLOR = 0x1120,
/* Color for vgClear */
VG_CLEAR_COLOR = 0x1121,
/* Enable/disable alpha masking and scissoring */
VG_MASKING = 0x1130,
VG_SCISSORING = 0x1131,
/* Pixel layout information */
VG_PIXEL_LAYOUT = 0x1140,
VG_SCREEN_LAYOUT = 0x1141,
/* Source format selection for image filters */
VG_FILTER_FORMAT_LINEAR = 0x1150,
VG_FILTER_FORMAT_PREMULTIPLIED = 0x1151,
/* Destination write enable mask for image filters */
VG_FILTER_CHANNEL_MASK = 0x1152,
/* Implementation limits (read-only) */
VG_MAX_SCISSOR_RECTS = 0x1160,
VG_MAX_DASH_COUNT = 0x1161,
VG_MAX_KERNEL_SIZE = 0x1162,
VG_MAX_SEPARABLE_KERNEL_SIZE = 0x1163,
VG_MAX_COLOR_RAMP_STOPS = 0x1164,
VG_MAX_IMAGE_WIDTH = 0x1165,
VG_MAX_IMAGE_HEIGHT = 0x1166,
VG_MAX_IMAGE_PIXELS = 0x1167,
VG_MAX_IMAGE_BYTES = 0x1168,
VG_MAX_FLOAT = 0x1169,
VG_MAX_GAUSSIAN_STD_DEVIATION = 0x116A,
VG_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGParamType;
typedef enum {
VG_RENDERING_QUALITY_NONANTIALIASED = 0x1200,
VG_RENDERING_QUALITY_FASTER = 0x1201,
VG_RENDERING_QUALITY_BETTER = 0x1202, /* Default */
VG_RENDERING_QUALITY_FORCE_SIZE = VG_MAX_ENUM
} VGRenderingQuality;
typedef enum {
VG_PIXEL_LAYOUT_UNKNOWN = 0x1300,
VG_PIXEL_LAYOUT_RGB_VERTICAL = 0x1301,
VG_PIXEL_LAYOUT_BGR_VERTICAL = 0x1302,
VG_PIXEL_LAYOUT_RGB_HORIZONTAL = 0x1303,
VG_PIXEL_LAYOUT_BGR_HORIZONTAL = 0x1304,
VG_PIXEL_LAYOUT_FORCE_SIZE = VG_MAX_ENUM
} VGPixelLayout;
typedef enum {
VG_MATRIX_PATH_USER_TO_SURFACE = 0x1400,
VG_MATRIX_IMAGE_USER_TO_SURFACE = 0x1401,
VG_MATRIX_FILL_PAINT_TO_USER = 0x1402,
VG_MATRIX_STROKE_PAINT_TO_USER = 0x1403,
VG_MATRIX_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGMatrixMode;
typedef enum {
VG_CLEAR_MASK = 0x1500,
VG_FILL_MASK = 0x1501,
VG_SET_MASK = 0x1502,
VG_UNION_MASK = 0x1503,
VG_INTERSECT_MASK = 0x1504,
VG_SUBTRACT_MASK = 0x1505,
VG_MASK_OPERATION_FORCE_SIZE = VG_MAX_ENUM
} VGMaskOperation;
#define VG_PATH_FORMAT_STANDARD 0
typedef enum {
VG_PATH_DATATYPE_S_8 = 0,
VG_PATH_DATATYPE_S_16 = 1,
VG_PATH_DATATYPE_S_32 = 2,
VG_PATH_DATATYPE_F = 3,
VG_PATH_DATATYPE_FORCE_SIZE = VG_MAX_ENUM
} VGPathDatatype;
typedef enum {
VG_ABSOLUTE = 0,
VG_RELATIVE = 1,
VG_PATH_ABS_REL_FORCE_SIZE = VG_MAX_ENUM
} VGPathAbsRel;
typedef enum {
VG_CLOSE_PATH = ( 0 << 1),
VG_MOVE_TO = ( 1 << 1),
VG_LINE_TO = ( 2 << 1),
VG_HLINE_TO = ( 3 << 1),
VG_VLINE_TO = ( 4 << 1),
VG_QUAD_TO = ( 5 << 1),
VG_CUBIC_TO = ( 6 << 1),
VG_SQUAD_TO = ( 7 << 1),
VG_SCUBIC_TO = ( 8 << 1),
VG_SCCWARC_TO = ( 9 << 1),
VG_SCWARC_TO = (10 << 1),
VG_LCCWARC_TO = (11 << 1),
VG_LCWARC_TO = (12 << 1),
VG_PATH_SEGMENT_FORCE_SIZE = VG_MAX_ENUM
} VGPathSegment;
typedef enum {
VG_MOVE_TO_ABS = VG_MOVE_TO | VG_ABSOLUTE,
VG_MOVE_TO_REL = VG_MOVE_TO | VG_RELATIVE,
VG_LINE_TO_ABS = VG_LINE_TO | VG_ABSOLUTE,
VG_LINE_TO_REL = VG_LINE_TO | VG_RELATIVE,
VG_HLINE_TO_ABS = VG_HLINE_TO | VG_ABSOLUTE,
VG_HLINE_TO_REL = VG_HLINE_TO | VG_RELATIVE,
VG_VLINE_TO_ABS = VG_VLINE_TO | VG_ABSOLUTE,
VG_VLINE_TO_REL = VG_VLINE_TO | VG_RELATIVE,
VG_QUAD_TO_ABS = VG_QUAD_TO | VG_ABSOLUTE,
VG_QUAD_TO_REL = VG_QUAD_TO | VG_RELATIVE,
VG_CUBIC_TO_ABS = VG_CUBIC_TO | VG_ABSOLUTE,
VG_CUBIC_TO_REL = VG_CUBIC_TO | VG_RELATIVE,
VG_SQUAD_TO_ABS = VG_SQUAD_TO | VG_ABSOLUTE,
VG_SQUAD_TO_REL = VG_SQUAD_TO | VG_RELATIVE,
VG_SCUBIC_TO_ABS = VG_SCUBIC_TO | VG_ABSOLUTE,
VG_SCUBIC_TO_REL = VG_SCUBIC_TO | VG_RELATIVE,
VG_SCCWARC_TO_ABS = VG_SCCWARC_TO | VG_ABSOLUTE,
VG_SCCWARC_TO_REL = VG_SCCWARC_TO | VG_RELATIVE,
VG_SCWARC_TO_ABS = VG_SCWARC_TO | VG_ABSOLUTE,
VG_SCWARC_TO_REL = VG_SCWARC_TO | VG_RELATIVE,
VG_LCCWARC_TO_ABS = VG_LCCWARC_TO | VG_ABSOLUTE,
VG_LCCWARC_TO_REL = VG_LCCWARC_TO | VG_RELATIVE,
VG_LCWARC_TO_ABS = VG_LCWARC_TO | VG_ABSOLUTE,
VG_LCWARC_TO_REL = VG_LCWARC_TO | VG_RELATIVE,
VG_PATH_COMMAND_FORCE_SIZE = VG_MAX_ENUM
} VGPathCommand;
typedef enum {
VG_PATH_CAPABILITY_APPEND_FROM = (1 << 0),
VG_PATH_CAPABILITY_APPEND_TO = (1 << 1),
VG_PATH_CAPABILITY_MODIFY = (1 << 2),
VG_PATH_CAPABILITY_TRANSFORM_FROM = (1 << 3),
VG_PATH_CAPABILITY_TRANSFORM_TO = (1 << 4),
VG_PATH_CAPABILITY_INTERPOLATE_FROM = (1 << 5),
VG_PATH_CAPABILITY_INTERPOLATE_TO = (1 << 6),
VG_PATH_CAPABILITY_PATH_LENGTH = (1 << 7),
VG_PATH_CAPABILITY_POINT_ALONG_PATH = (1 << 8),
VG_PATH_CAPABILITY_TANGENT_ALONG_PATH = (1 << 9),
VG_PATH_CAPABILITY_PATH_BOUNDS = (1 << 10),
VG_PATH_CAPABILITY_PATH_TRANSFORMED_BOUNDS = (1 << 11),
VG_PATH_CAPABILITY_ALL = (1 << 12) - 1,
VG_PATH_CAPABILITIES_FORCE_SIZE = VG_MAX_ENUM
} VGPathCapabilities;
typedef enum {
VG_PATH_FORMAT = 0x1600,
VG_PATH_DATATYPE = 0x1601,
VG_PATH_SCALE = 0x1602,
VG_PATH_BIAS = 0x1603,
VG_PATH_NUM_SEGMENTS = 0x1604,
VG_PATH_NUM_COORDS = 0x1605,
VG_PATH_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGPathParamType;
typedef enum {
VG_CAP_BUTT = 0x1700,
VG_CAP_ROUND = 0x1701,
VG_CAP_SQUARE = 0x1702,
VG_CAP_STYLE_FORCE_SIZE = VG_MAX_ENUM
} VGCapStyle;
typedef enum {
VG_JOIN_MITER = 0x1800,
VG_JOIN_ROUND = 0x1801,
VG_JOIN_BEVEL = 0x1802,
VG_JOIN_STYLE_FORCE_SIZE = VG_MAX_ENUM
} VGJoinStyle;
typedef enum {
VG_EVEN_ODD = 0x1900,
VG_NON_ZERO = 0x1901,
VG_FILL_RULE_FORCE_SIZE = VG_MAX_ENUM
} VGFillRule;
typedef enum {
VG_STROKE_PATH = (1 << 0),
VG_FILL_PATH = (1 << 1),
VG_PAINT_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGPaintMode;
typedef enum {
/* Color paint parameters */
VG_PAINT_TYPE = 0x1A00,
VG_PAINT_COLOR = 0x1A01,
VG_PAINT_COLOR_RAMP_SPREAD_MODE = 0x1A02,
VG_PAINT_COLOR_RAMP_PREMULTIPLIED = 0x1A07,
VG_PAINT_COLOR_RAMP_STOPS = 0x1A03,
/* Linear gradient paint parameters */
VG_PAINT_LINEAR_GRADIENT = 0x1A04,
/* Radial gradient paint parameters */
VG_PAINT_RADIAL_GRADIENT = 0x1A05,
/* Pattern paint parameters */
VG_PAINT_PATTERN_TILING_MODE = 0x1A06,
VG_PAINT_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGPaintParamType;
typedef enum {
VG_PAINT_TYPE_COLOR = 0x1B00,
VG_PAINT_TYPE_LINEAR_GRADIENT = 0x1B01,
VG_PAINT_TYPE_RADIAL_GRADIENT = 0x1B02,
VG_PAINT_TYPE_PATTERN = 0x1B03,
VG_PAINT_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGPaintType;
typedef enum {
VG_COLOR_RAMP_SPREAD_PAD = 0x1C00,
VG_COLOR_RAMP_SPREAD_REPEAT = 0x1C01,
VG_COLOR_RAMP_SPREAD_REFLECT = 0x1C02,
VG_COLOR_RAMP_SPREAD_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGColorRampSpreadMode;
typedef enum {
VG_TILE_FILL = 0x1D00,
VG_TILE_PAD = 0x1D01,
VG_TILE_REPEAT = 0x1D02,
VG_TILE_REFLECT = 0x1D03,
VG_TILING_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGTilingMode;
typedef enum {
/* RGB{A,X} channel ordering */
VG_sRGBX_8888 = 0,
VG_sRGBA_8888 = 1,
VG_sRGBA_8888_PRE = 2,
VG_sRGB_565 = 3,
VG_sRGBA_5551 = 4,
VG_sRGBA_4444 = 5,
VG_sL_8 = 6,
VG_lRGBX_8888 = 7,
VG_lRGBA_8888 = 8,
VG_lRGBA_8888_PRE = 9,
VG_lL_8 = 10,
VG_A_8 = 11,
VG_BW_1 = 12,
/* {A,X}RGB channel ordering */
VG_sXRGB_8888 = 0 | (1 << 6),
VG_sARGB_8888 = 1 | (1 << 6),
VG_sARGB_8888_PRE = 2 | (1 << 6),
VG_sARGB_1555 = 4 | (1 << 6),
VG_sARGB_4444 = 5 | (1 << 6),
VG_lXRGB_8888 = 7 | (1 << 6),
VG_lARGB_8888 = 8 | (1 << 6),
VG_lARGB_8888_PRE = 9 | (1 << 6),
/* BGR{A,X} channel ordering */
VG_sBGRX_8888 = 0 | (1 << 7),
VG_sBGRA_8888 = 1 | (1 << 7),
VG_sBGRA_8888_PRE = 2 | (1 << 7),
VG_sBGR_565 = 3 | (1 << 7),
VG_sBGRA_5551 = 4 | (1 << 7),
VG_sBGRA_4444 = 5 | (1 << 7),
VG_lBGRX_8888 = 7 | (1 << 7),
VG_lBGRA_8888 = 8 | (1 << 7),
VG_lBGRA_8888_PRE = 9 | (1 << 7),
/* {A,X}BGR channel ordering */
VG_sXBGR_8888 = 0 | (1 << 6) | (1 << 7),
VG_sABGR_8888 = 1 | (1 << 6) | (1 << 7),
VG_sABGR_8888_PRE = 2 | (1 << 6) | (1 << 7),
VG_sABGR_1555 = 4 | (1 << 6) | (1 << 7),
VG_sABGR_4444 = 5 | (1 << 6) | (1 << 7),
VG_lXBGR_8888 = 7 | (1 << 6) | (1 << 7),
VG_lABGR_8888 = 8 | (1 << 6) | (1 << 7),
VG_lABGR_8888_PRE = 9 | (1 << 6) | (1 << 7),
VG_IMAGE_FORMAT_FORCE_SIZE = VG_MAX_ENUM
} VGImageFormat;
typedef enum {
VG_IMAGE_QUALITY_NONANTIALIASED = (1 << 0),
VG_IMAGE_QUALITY_FASTER = (1 << 1),
VG_IMAGE_QUALITY_BETTER = (1 << 2),
VG_IMAGE_QUALITY_FORCE_SIZE = VG_MAX_ENUM
} VGImageQuality;
typedef enum {
VG_IMAGE_FORMAT = 0x1E00,
VG_IMAGE_WIDTH = 0x1E01,
VG_IMAGE_HEIGHT = 0x1E02,
VG_IMAGE_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGImageParamType;
typedef enum {
VG_DRAW_IMAGE_NORMAL = 0x1F00,
VG_DRAW_IMAGE_MULTIPLY = 0x1F01,
VG_DRAW_IMAGE_STENCIL = 0x1F02,
VG_IMAGE_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGImageMode;
typedef enum {
VG_RED = (1 << 3),
VG_GREEN = (1 << 2),
VG_BLUE = (1 << 1),
VG_ALPHA = (1 << 0),
VG_IMAGE_CHANNEL_FORCE_SIZE = VG_MAX_ENUM
} VGImageChannel;
typedef enum {
VG_BLEND_SRC = 0x2000,
VG_BLEND_SRC_OVER = 0x2001,
VG_BLEND_DST_OVER = 0x2002,
VG_BLEND_SRC_IN = 0x2003,
VG_BLEND_DST_IN = 0x2004,
VG_BLEND_MULTIPLY = 0x2005,
VG_BLEND_SCREEN = 0x2006,
VG_BLEND_DARKEN = 0x2007,
VG_BLEND_LIGHTEN = 0x2008,
VG_BLEND_ADDITIVE = 0x2009,
VG_BLEND_MODE_FORCE_SIZE = VG_MAX_ENUM
} VGBlendMode;
typedef enum {
VG_IMAGE_FORMAT_QUERY = 0x2100,
VG_PATH_DATATYPE_QUERY = 0x2101,
VG_HARDWARE_QUERY_TYPE_FORCE_SIZE = VG_MAX_ENUM
} VGHardwareQueryType;
typedef enum {
VG_HARDWARE_ACCELERATED = 0x2200,
VG_HARDWARE_UNACCELERATED = 0x2201,
VG_HARDWARE_QUERY_RESULT_FORCE_SIZE = VG_MAX_ENUM
} VGHardwareQueryResult;
typedef enum {
VG_VENDOR = 0x2300,
VG_RENDERER = 0x2301,
VG_VERSION = 0x2302,
VG_EXTENSIONS = 0x2303,
VG_STRING_ID_FORCE_SIZE = VG_MAX_ENUM
} VGStringID;
/* Function Prototypes */
#ifndef VG_API_CALL
# error VG_API_CALL must be defined
#endif
#ifndef VG_API_ENTRY
# error VG_API_ENTRY must be defined
#endif
#ifndef VG_API_EXIT
# error VG_API_EXIT must be defined
#endif
VG_API_CALL VGErrorCode VG_API_ENTRY vgGetError(void) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgFlush(void) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgFinish(void) VG_API_EXIT;
/* Getters and Setters */
VG_API_CALL void VG_API_ENTRY vgSetf (VGParamType type, VGfloat value) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSeti (VGParamType type, VGint value) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetfv(VGParamType type, VGint count,
const VGfloat * values) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetiv(VGParamType type, VGint count,
const VGint * values) VG_API_EXIT;
VG_API_CALL VGfloat VG_API_ENTRY vgGetf(VGParamType type) VG_API_EXIT;
VG_API_CALL VGint VG_API_ENTRY vgGeti(VGParamType type) VG_API_EXIT;
VG_API_CALL VGint VG_API_ENTRY vgGetVectorSize(VGParamType type) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetfv(VGParamType type, VGint count, VGfloat * values) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetiv(VGParamType type, VGint count, VGint * values) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetParameterf(VGHandle object,
VGint paramType,
VGfloat value) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetParameteri(VGHandle object,
VGint paramType,
VGint value) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetParameterfv(VGHandle object,
VGint paramType,
VGint count, const VGfloat * values) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetParameteriv(VGHandle object,
VGint paramType,
VGint count, const VGint * values) VG_API_EXIT;
VG_API_CALL VGfloat VG_API_ENTRY vgGetParameterf(VGHandle object,
VGint paramType) VG_API_EXIT;
VG_API_CALL VGint VG_API_ENTRY vgGetParameteri(VGHandle object,
VGint paramType);
VG_API_CALL VGint VG_API_ENTRY vgGetParameterVectorSize(VGHandle object,
VGint paramType) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetParameterfv(VGHandle object,
VGint paramType,
VGint count, VGfloat * values) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetParameteriv(VGHandle object,
VGint paramType,
VGint count, VGint * values) VG_API_EXIT;
/* Matrix Manipulation */
VG_API_CALL void VG_API_ENTRY vgLoadIdentity(void) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgLoadMatrix(const VGfloat * m) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetMatrix(VGfloat * m) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgMultMatrix(const VGfloat * m) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgTranslate(VGfloat tx, VGfloat ty) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgScale(VGfloat sx, VGfloat sy) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgShear(VGfloat shx, VGfloat shy) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgRotate(VGfloat angle) VG_API_EXIT;
/* Masking and Clearing */
VG_API_CALL void VG_API_ENTRY vgMask(VGImage mask, VGMaskOperation operation,
VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgClear(VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
/* Paths */
VG_API_CALL VGPath VG_API_ENTRY vgCreatePath(VGint pathFormat,
VGPathDatatype datatype,
VGfloat scale, VGfloat bias,
VGint segmentCapacityHint,
VGint coordCapacityHint,
VGbitfield capabilities) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgClearPath(VGPath path, VGbitfield capabilities) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDestroyPath(VGPath path) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgRemovePathCapabilities(VGPath path,
VGbitfield capabilities) VG_API_EXIT;
VG_API_CALL VGbitfield VG_API_ENTRY vgGetPathCapabilities(VGPath path) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgAppendPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgAppendPathData(VGPath dstPath,
VGint numSegments,
const VGubyte * pathSegments,
const void * pathData) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgModifyPathCoords(VGPath dstPath, VGint startIndex,
VGint numSegments,
const void * pathData) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgTransformPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT;
VG_API_CALL VGboolean VG_API_ENTRY vgInterpolatePath(VGPath dstPath,
VGPath startPath,
VGPath endPath,
VGfloat amount) VG_API_EXIT;
VG_API_CALL VGfloat VG_API_ENTRY vgPathLength(VGPath path,
VGint startSegment, VGint numSegments) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgPointAlongPath(VGPath path,
VGint startSegment, VGint numSegments,
VGfloat distance,
VGfloat * x, VGfloat * y,
VGfloat * tangentX, VGfloat * tangentY) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgPathBounds(VGPath path,
VGfloat * minX, VGfloat * minY,
VGfloat * width, VGfloat * height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgPathTransformedBounds(VGPath path,
VGfloat * minX, VGfloat * minY,
VGfloat * width, VGfloat * height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDrawPath(VGPath path, VGbitfield paintModes) VG_API_EXIT;
/* Paint */
VG_API_CALL VGPaint VG_API_ENTRY vgCreatePaint(void) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDestroyPaint(VGPaint paint) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetPaint(VGPaint paint, VGbitfield paintModes) VG_API_EXIT;
VG_API_CALL VGPaint VG_API_ENTRY vgGetPaint(VGPaintMode paintMode) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetColor(VGPaint paint, VGuint rgba) VG_API_EXIT;
VG_API_CALL VGuint VG_API_ENTRY vgGetColor(VGPaint paint) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgPaintPattern(VGPaint paint, VGImage pattern) VG_API_EXIT;
/* Images */
VG_API_CALL VGImage VG_API_ENTRY vgCreateImage(VGImageFormat format,
VGint width, VGint height,
VGbitfield allowedQuality) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDestroyImage(VGImage image) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgClearImage(VGImage image,
VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgImageSubData(VGImage image,
const void * data, VGint dataStride,
VGImageFormat dataFormat,
VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetImageSubData(VGImage image,
void * data, VGint dataStride,
VGImageFormat dataFormat,
VGint x, VGint y,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL VGImage VG_API_ENTRY vgChildImage(VGImage parent,
VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
VG_API_CALL VGImage VG_API_ENTRY vgGetParent(VGImage image) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgCopyImage(VGImage dst, VGint dx, VGint dy,
VGImage src, VGint sx, VGint sy,
VGint width, VGint height,
VGboolean dither) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgDrawImage(VGImage image) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSetPixels(VGint dx, VGint dy,
VGImage src, VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgWritePixels(const void * data, VGint dataStride,
VGImageFormat dataFormat,
VGint dx, VGint dy,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGetPixels(VGImage dst, VGint dx, VGint dy,
VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgReadPixels(void * data, VGint dataStride,
VGImageFormat dataFormat,
VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgCopyPixels(VGint dx, VGint dy,
VGint sx, VGint sy,
VGint width, VGint height) VG_API_EXIT;
/* Image Filters */
VG_API_CALL void VG_API_ENTRY vgColorMatrix(VGImage dst, VGImage src,
const VGfloat * matrix) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgConvolve(VGImage dst, VGImage src,
VGint kernelWidth, VGint kernelHeight,
VGint shiftX, VGint shiftY,
const VGshort * kernel,
VGfloat scale,
VGfloat bias,
VGTilingMode tilingMode) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgSeparableConvolve(VGImage dst, VGImage src,
VGint kernelWidth,
VGint kernelHeight,
VGint shiftX, VGint shiftY,
const VGshort * kernelX,
const VGshort * kernelY,
VGfloat scale,
VGfloat bias,
VGTilingMode tilingMode) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgGaussianBlur(VGImage dst, VGImage src,
VGfloat stdDeviationX,
VGfloat stdDeviationY,
VGTilingMode tilingMode) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgLookup(VGImage dst, VGImage src,
const VGubyte * redLUT,
const VGubyte * greenLUT,
const VGubyte * blueLUT,
const VGubyte * alphaLUT,
VGboolean outputLinear,
VGboolean outputPremultiplied) VG_API_EXIT;
VG_API_CALL void VG_API_ENTRY vgLookupSingle(VGImage dst, VGImage src,
const VGuint * lookupTable,
VGImageChannel sourceChannel,
VGboolean outputLinear,
VGboolean outputPremultiplied) VG_API_EXIT;
/* Hardware Queries */
VG_API_CALL VGHardwareQueryResult VG_API_ENTRY vgHardwareQuery(VGHardwareQueryType key,
VGint setting) VG_API_EXIT;
/* Renderer and Extension Information */
VG_API_CALL const VGubyte * VG_API_ENTRY vgGetString(VGStringID name) VG_API_EXIT;
#ifdef __cplusplus
} /* extern "C" */
#endif
#endif /* _OPENVG_H */

233
include/VG/vgext.h Normal file
View File

@@ -0,0 +1,233 @@
/* $Revision: 6810 $ on $Date:: 2008-10-29 10:31:37 -0400 #$ */
/*------------------------------------------------------------------------
*
* VG extensions Reference Implementation
* -------------------------------------
*
* Copyright (c) 2008 The Khronos Group Inc.
*
* Permission is hereby granted, free of charge, to any person obtaining a
* copy of this software and /or associated documentation files
* (the "Materials "), to deal in the Materials without restriction,
* including without limitation the rights to use, copy, modify, merge,
* publish, distribute, sublicense, and/or sell copies of the Materials,
* and to permit persons to whom the Materials are furnished to do so,
* subject to the following conditions:
*
* The above copyright notice and this permission notice shall be included
* in all copies or substantial portions of the Materials.
*
* THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
* EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
* MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
* IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
* DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
* OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
* THE USE OR OTHER DEALINGS IN THE MATERIALS.
*
*//**
* \file
* \brief VG extensions
*//*-------------------------------------------------------------------*/
#ifndef _VGEXT_H
#define _VGEXT_H
#ifdef __cplusplus
extern "C" {
#endif
#include <VG/openvg.h>
#include <VG/vgu.h>
#ifndef VG_API_ENTRYP
# define VG_API_ENTRYP VG_API_ENTRY*
#endif
#ifndef VGU_API_ENTRYP
# define VGU_API_ENTRYP VGU_API_ENTRY*
#endif
/*-------------------------------------------------------------------------------
* KHR extensions
*------------------------------------------------------------------------------*/
typedef enum {
#ifndef VG_KHR_iterative_average_blur
VG_MAX_AVERAGE_BLUR_DIMENSION_KHR = 0x116B,
VG_AVERAGE_BLUR_DIMENSION_RESOLUTION_KHR = 0x116C,
VG_MAX_AVERAGE_BLUR_ITERATIONS_KHR = 0x116D,
#endif
VG_PARAM_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM
} VGParamTypeKHR;
#ifndef VG_KHR_EGL_image
#define VG_KHR_EGL_image 1
/* VGEGLImageKHR is an opaque handle to an EGLImage */
typedef void* VGeglImageKHR;
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL VGImage VG_API_ENTRY vgCreateEGLImageTargetKHR(VGeglImageKHR image);
#endif
typedef VGImage (VG_API_ENTRYP PFNVGCREATEEGLIMAGETARGETKHRPROC) (VGeglImageKHR image);
#endif
#ifndef VG_KHR_iterative_average_blur
#define VG_KHR_iterative_average_blur 1
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL void vgIterativeAverageBlurKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
#endif
typedef void (VG_API_ENTRYP PFNVGITERATIVEAVERAGEBLURKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
#endif
#ifndef VG_KHR_advanced_blending
#define VG_KHR_advanced_blending 1
typedef enum {
VG_BLEND_OVERLAY_KHR = 0x2010,
VG_BLEND_HARDLIGHT_KHR = 0x2011,
VG_BLEND_SOFTLIGHT_SVG_KHR = 0x2012,
VG_BLEND_SOFTLIGHT_KHR = 0x2013,
VG_BLEND_COLORDODGE_KHR = 0x2014,
VG_BLEND_COLORBURN_KHR = 0x2015,
VG_BLEND_DIFFERENCE_KHR = 0x2016,
VG_BLEND_SUBTRACT_KHR = 0x2017,
VG_BLEND_INVERT_KHR = 0x2018,
VG_BLEND_EXCLUSION_KHR = 0x2019,
VG_BLEND_LINEARDODGE_KHR = 0x201a,
VG_BLEND_LINEARBURN_KHR = 0x201b,
VG_BLEND_VIVIDLIGHT_KHR = 0x201c,
VG_BLEND_LINEARLIGHT_KHR = 0x201d,
VG_BLEND_PINLIGHT_KHR = 0x201e,
VG_BLEND_HARDMIX_KHR = 0x201f,
VG_BLEND_CLEAR_KHR = 0x2020,
VG_BLEND_DST_KHR = 0x2021,
VG_BLEND_SRC_OUT_KHR = 0x2022,
VG_BLEND_DST_OUT_KHR = 0x2023,
VG_BLEND_SRC_ATOP_KHR = 0x2024,
VG_BLEND_DST_ATOP_KHR = 0x2025,
VG_BLEND_XOR_KHR = 0x2026,
VG_BLEND_MODE_KHR_FORCE_SIZE= VG_MAX_ENUM
} VGBlendModeKHR;
#endif
#ifndef VG_KHR_parametric_filter
#define VG_KHR_parametric_filter 1
typedef enum {
VG_PF_OBJECT_VISIBLE_FLAG_KHR = (1 << 0),
VG_PF_KNOCKOUT_FLAG_KHR = (1 << 1),
VG_PF_OUTER_FLAG_KHR = (1 << 2),
VG_PF_INNER_FLAG_KHR = (1 << 3),
VG_PF_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM
} VGPfTypeKHR;
typedef enum {
VGU_IMAGE_IN_USE_ERROR = 0xF010,
VGU_ERROR_CODE_KHR_FORCE_SIZE = VG_MAX_ENUM
} VGUErrorCodeKHR;
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL void VG_API_ENTRY vgParametricFilterKHR(VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguDropShadowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA) ;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
#endif
typedef void (VG_API_ENTRYP PFNVGPARAMETRICFILTERKHRPROC) (VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUDROPSHADOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
#endif
/*-------------------------------------------------------------------------------
* NDS extensions
*------------------------------------------------------------------------------*/
#ifndef VG_NDS_paint_generation
#define VG_NDS_paint_generation 1
typedef enum {
VG_PAINT_COLOR_RAMP_LINEAR_NDS = 0x1A10,
VG_COLOR_MATRIX_NDS = 0x1A11,
VG_PAINT_COLOR_TRANSFORM_LINEAR_NDS = 0x1A12,
VG_PAINT_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGPaintParamTypeNds;
typedef enum {
VG_DRAW_IMAGE_COLOR_MATRIX_NDS = 0x1F10,
VG_IMAGE_MODE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGImageModeNds;
#endif
#ifndef VG_NDS_projective_geometry
#define VG_NDS_projective_geometry 1
typedef enum {
VG_CLIP_MODE_NDS = 0x1180,
VG_CLIP_LINES_NDS = 0x1181,
VG_MAX_CLIP_LINES_NDS = 0x1182,
VG_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGParamTypeNds;
typedef enum {
VG_CLIPMODE_NONE_NDS = 0x3000,
VG_CLIPMODE_CLIP_CLOSED_NDS = 0x3001,
VG_CLIPMODE_CLIP_OPEN_NDS = 0x3002,
VG_CLIPMODE_CULL_NDS = 0x3003,
VG_CLIPMODE_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGClipModeNds;
typedef enum {
VG_RQUAD_TO_NDS = ( 13 << 1 ),
VG_RCUBIC_TO_NDS = ( 14 << 1 ),
VG_PATH_SEGMENT_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGPathSegmentNds;
typedef enum {
VG_RQUAD_TO_ABS_NDS = (VG_RQUAD_TO_NDS | VG_ABSOLUTE),
VG_RQUAD_TO_REL_NDS = (VG_RQUAD_TO_NDS | VG_RELATIVE),
VG_RCUBIC_TO_ABS_NDS = (VG_RCUBIC_TO_NDS | VG_ABSOLUTE),
VG_RCUBIC_TO_REL_NDS = (VG_RCUBIC_TO_NDS | VG_RELATIVE),
VG_PATH_COMMAND_NDS_FORCE_SIZE = VG_MAX_ENUM
} VGPathCommandNds;
#ifdef VG_VGEXT_PROTOTYPES
VG_API_CALL void VG_API_ENTRY vgProjectiveMatrixNDS(VGboolean enable) ;
VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguTransformClipLineNDS(const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
#endif
typedef void (VG_API_ENTRYP PFNVGPROJECTIVEMATRIXNDSPROC) (VGboolean enable) ;
typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUTRANSFORMCLIPLINENDSPROC) (const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
#endif
#ifdef __cplusplus
} /* extern "C" */
#endif
#endif /* _VGEXT_H */

Some files were not shown because too many files have changed in this diff Show More