docs: Add sha256 sums for the 10.2.9 release

Signed-off-by: Emil Velikov <emil.l.velikov@gmail.com>

.dir-locals.el

@@ -1,4 +1,4 @@
-((prog-mode
+((nil
   (indent-tabs-mode . nil)
   (tab-width . 8)
   (c-basic-offset . 3)

.gitignore

@@ -18,7 +18,6 @@
 *.tar
 *.tar.bz2
 *.tar.gz
-*.tar.xz
 *.trs
 *.zip
 *~
@@ -45,4 +44,3 @@ manifest.txt
 .libs/
 Makefile
 Makefile.in
-.install-mesa-links

Android.common.mk

@@ -24,17 +24,16 @@
 # use c99 compiler by default
 ifeq ($(LOCAL_CC),)
 ifeq ($(LOCAL_IS_HOST_MODULE),true)
-LOCAL_CC := $(HOST_CC) -std=c99 -D_GNU_SOURCE
+LOCAL_CC := $(HOST_CC) -std=c99
 else
 LOCAL_CC := $(TARGET_CC) -std=c99
 endif
 endif
 
 LOCAL_C_INCLUDES += \
-	$(MESA_TOP)/src \
 	$(MESA_TOP)/include
 
-MESA_VERSION := $(shell cat $(MESA_TOP)/VERSION)
+MESA_VERSION=$(shell cat $(MESA_TOP)/VERSION)
 # define ANDROID_VERSION (e.g., 4.0.x => 0x0400)
 LOCAL_CFLAGS += \
 	-DPACKAGE_VERSION=\"$(MESA_VERSION)\" \
@@ -42,19 +41,6 @@ LOCAL_CFLAGS += \
 	-DANDROID_VERSION=0x0$(MESA_ANDROID_MAJOR_VERSION)0$(MESA_ANDROID_MINOR_VERSION)
 
 LOCAL_CFLAGS += \
-	-DHAVE___BUILTIN_EXPECT \
-	-DHAVE___BUILTIN_FFS \
-	-DHAVE___BUILTIN_FFSLL \
-	-DHAVE_FUNC_ATTRIBUTE_FLATTEN \
-	-DHAVE_FUNC_ATTRIBUTE_UNUSED \
-	-DHAVE_FUNC_ATTRIBUTE_FORMAT \
-	-DHAVE_FUNC_ATTRIBUTE_PACKED \
-	-DHAVE___BUILTIN_CTZ \
-	-DHAVE___BUILTIN_POPCOUNT \
-	-DHAVE___BUILTIN_POPCOUNTLL \
-	-DHAVE___BUILTIN_CLZ \
-	-DHAVE___BUILTIN_CLZLL \
-	-DHAVE___BUILTIN_UNREACHABLE \
 	-DHAVE_PTHREAD=1 \
 	-fvisibility=hidden \
 	-Wno-sign-compare

Android.mk

@@ -34,17 +34,11 @@ MESA_TOP := $(call my-dir)
 MESA_ANDROID_MAJOR_VERSION := $(word 1, $(subst ., , $(PLATFORM_VERSION)))
 MESA_ANDROID_MINOR_VERSION := $(word 2, $(subst ., , $(PLATFORM_VERSION)))
 MESA_ANDROID_VERSION := $(MESA_ANDROID_MAJOR_VERSION).$(MESA_ANDROID_MINOR_VERSION)
-ifeq ($(filter 1 2 3 4,$(MESA_ANDROID_MAJOR_VERSION)),)
-MESA_LOLLIPOP_BUILD := true
-else
-define local-generated-sources-dir
-$(call local-intermediates-dir)
-endef
-endif
 
 MESA_COMMON_MK := $(MESA_TOP)/Android.common.mk
 MESA_PYTHON2 := python
 
+DRM_TOP := external/drm
 DRM_GRALLOC_TOP := hardware/drm_gralloc
 
 classic_drivers := i915 i965
@@ -88,7 +82,6 @@ SUBDIRS := \
 	src/mapi \
 	src/glsl \
 	src/mesa \
-	src/util \
 	src/egl/main
 
 ifeq ($(strip $(MESA_BUILD_CLASSIC)),true)
@@ -101,6 +94,7 @@ ifeq ($(strip $(MESA_BUILD_GALLIUM)),true)
 SUBDIRS += src/gallium
 endif
 
-include $(call all-named-subdir-makefiles,$(SUBDIRS))
+mkfiles := $(patsubst %,$(MESA_TOP)/%/Android.mk,$(SUBDIRS))
+include $(mkfiles)
 
 endif

CleanSpec.mk

@@ -1,15 +0,0 @@
-$(call add-clean-step, rm -rf $(PRODUCT_OUT)/obj/STATIC_LIBRARIES/libmesa_*_intermediates)
-$(call add-clean-step, rm -rf $(PRODUCT_OUT)/obj/SHARED_LIBRARIES/i9*5_dri_intermediates)
-$(call add-clean-step, rm -rf $(PRODUCT_OUT)/obj/SHARED_LIBRARIES/libglapi_intermediates)
-$(call add-clean-step, rm -rf $(PRODUCT_OUT)/obj/SHARED_LIBRARIES/libGLES_mesa_intermediates)
-$(call add-clean-step, rm -rf $(OUT_DIR)/host/$(HOST_OS)-$(HOST_ARCH)/obj/EXECUTABLES/mesa_*_intermediates)
-$(call add-clean-step, rm -rf $(OUT_DIR)/host/$(HOST_OS)-$(HOST_ARCH)/obj/EXECUTABLES/glsl_compiler_intermediates)
-$(call add-clean-step, rm -rf $(OUT_DIR)/host/$(HOST_OS)-$(HOST_ARCH)/obj/STATIC_LIBRARIES/libmesa_glsl_utils_intermediates)
-
-$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/STATIC_LIBRARIES/libmesa_*_intermediates)
-$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/SHARED_LIBRARIES/i9?5_dri_intermediates)
-$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/SHARED_LIBRARIES/libglapi_intermediates)
-$(call add-clean-step, rm -rf $(PRODUCT_OUT)/*/SHARED_LIBRARIES/libGLES_mesa_intermediates)
-$(call add-clean-step, rm -rf $(HOST_OUT_release)/*/EXECUTABLES/mesa_*_intermediates)
-$(call add-clean-step, rm -rf $(HOST_OUT_release)/*/EXECUTABLES/glsl_compiler_intermediates)
-$(call add-clean-step, rm -rf $(HOST_OUT_release)/*/STATIC_LIBRARIES/libmesa_*_intermediates)

Makefile.am

@@ -21,41 +21,85 @@
 
 SUBDIRS = src
 
-AM_DISTCHECK_CONFIGURE_FLAGS = \
-	--enable-dri3 \
-	--enable-gallium-tests \
-	--enable-gbm \
-	--enable-gles1 \
-	--enable-gles2 \
-	--enable-glx-tls \
-	--enable-va \
-	--enable-vdpau \
-	--enable-xa \
-	--enable-xvmc \
-	--with-egl-platforms=x11,wayland,drm
-
 ACLOCAL_AMFLAGS = -I m4
 
-EXTRA_DIST = \
-	autogen.sh \
-	common.py \
-	docs \
-	doxygen \
-	scons \
-	SConstruct
+doxygen:
+	cd doxygen && $(MAKE)
 
-noinst_HEADERS = \
-	include/c99_alloca.h \
-	include/c99_compat.h \
-	include/c99_math.h \
-	include/c99 \
-	include/c11 \
-	include/D3D9 \
-	include/HaikuGL \
-	include/no_extern_c.h \
-	include/pci_ids
+.PHONY: doxygen
 
-# We list some directories in EXTRA_DIST, but don't actually want to include
-# the .gitignore files in the tarball.
-dist-hook:
-	find $(distdir) -name .gitignore -exec $(RM) {} +
+# Rules for making release tarballs
+
+PACKAGE_DIR = Mesa-$(PACKAGE_VERSION)
+PACKAGE_NAME = MesaLib-$(PACKAGE_VERSION)
+
+EXTRA_FILES = \
+	aclocal.m4					\
+	configure					\
+	bin/ar-lib					\
+	bin/compile					\
+	bin/config.sub					\
+	bin/config.guess				\
+	bin/depcomp					\
+	bin/install-sh					\
+	bin/ltmain.sh					\
+	bin/missing					\
+	bin/ylwrap					\
+        bin/test-driver					\
+	src/glsl/glsl_parser.cpp			\
+	src/glsl/glsl_parser.h				\
+	src/glsl/glsl_lexer.cpp				\
+	src/glsl/glcpp/glcpp-lex.c			\
+	src/glsl/glcpp/glcpp-parse.c			\
+	src/glsl/glcpp/glcpp-parse.h			\
+	src/mesa/program/lex.yy.c			\
+	src/mesa/program/program_parse.tab.c		\
+	src/mesa/program/program_parse.tab.h		\
+	`git ls-files | grep "Makefile.am" | sed -e "s/Makefile.am/Makefile.in/"`
+
+
+IGNORE_FILES = \
+	-x autogen.sh
+
+
+parsers: configure
+	$(MAKE) -C src/glsl glsl_parser.cpp glsl_parser.h glsl_lexer.cpp glcpp/glcpp-lex.c glcpp/glcpp-parse.c glcpp/glcpp-parse.h
+
+# Everything for new a Mesa release:
+ARCHIVES = $(PACKAGE_NAME).tar.gz \
+	$(PACKAGE_NAME).tar.bz2 \
+	$(PACKAGE_NAME).zip
+
+tarballs: checksums
+	rm -f ../$(PACKAGE_DIR) $(PACKAGE_NAME).tar
+
+manifest.txt: .git
+	( \
+		ls -1 $(EXTRA_FILES) ; \
+		git ls-files $(IGNORE_FILES) \
+	) | sed -e '/^\(.*\/\)\?\./d' -e "s@^@$(PACKAGE_DIR)/@" > $@
+
+../$(PACKAGE_DIR):
+	ln -s $(PWD) $@
+
+$(PACKAGE_NAME).tar: parsers ../$(PACKAGE_DIR) manifest.txt
+	cd .. ; tar -cf $(PACKAGE_DIR)/$(PACKAGE_NAME).tar -T $(PACKAGE_DIR)/manifest.txt
+
+$(PACKAGE_NAME).tar.gz: $(PACKAGE_NAME).tar ../$(PACKAGE_DIR)
+	gzip --stdout --best $(PACKAGE_NAME).tar > $(PACKAGE_NAME).tar.gz
+
+$(PACKAGE_NAME).tar.bz2: $(PACKAGE_NAME).tar
+	bzip2 --stdout --best $(PACKAGE_NAME).tar > $(PACKAGE_NAME).tar.bz2
+
+$(PACKAGE_NAME).zip: parsers ../$(PACKAGE_DIR) manifest.txt
+	rm -f $(PACKAGE_NAME).zip ; \
+	cd .. ; \
+	zip -q -@ $(PACKAGE_NAME).zip < $(PACKAGE_DIR)/manifest.txt ; \
+	mv $(PACKAGE_NAME).zip $(PACKAGE_DIR)
+
+checksums: $(ARCHIVES)
+	@-sha256sum $(PACKAGE_NAME).tar.gz
+	@-sha256sum $(PACKAGE_NAME).tar.bz2
+	@-sha256sum $(PACKAGE_NAME).zip
+
+.PHONY: tarballs md5

VERSION

@@ -1 +1 @@
-10.6.9
+10.2.9

autogen.sh

@@ -6,8 +6,8 @@ test -z "$srcdir" && srcdir=.
 ORIGDIR=`pwd`
 cd "$srcdir"
 
-autoreconf --force --verbose --install || exit 1
-cd "$ORIGDIR" || exit $?
+autoreconf -v --install || exit 1
+cd $ORIGDIR || exit $?
 
 if test -z "$NOCONFIGURE"; then
     "$srcdir"/configure "$@"

bin/.cherry-ignore

@@ -1,8 +1,30 @@
-# The vec4 nir i965 work landed after the 10.6 branchpoint
-b8d2263c83d29f4626ac0fe0316978aa6262aefb i965/vec4_nir: Load constants as integers
+# The first is the change, and the second is the revert of that change.
+e6967270c75a5b669152127bb7a746d55f4407a6 i965: Fix depth (array slices) computation for 1D_ARRAY render targets.
+155f98d49fdc2f46c760f8214327b3804ee60079 Revert "i965: Fix depth (array slices) computation for 1D_ARRAY render targets."
 
-# The issue/commit it fixes has landed post 10.6 branchpoint
-afa1efdc8522d987e3af7c7a6272021caa33eb82 mesa: fix errors when reading depth with glReadPixels
+# This patch didn't have enough in the commit message to convince me it
+# is a bug fix, (email sent to author asking for more information).
+41d759d076737f94976f5294b734dbc437a12bae
 
-# The issue/commit is fixes has landed post 10.6 branchpoint
-7f8815bcb9af9b4b374ad7bd6e7cfa7529a6c980 i965: fix textureGrad for cubemaps
+# These patch were already cherry-picked before the 10.2.4 release.
+#
+# But get-pick-list.sh doesn't realize that because the commit messages for
+# these on the stable branch reference commit IDs that don't actually appear
+# on master. I'm not sure what happened, (perhaps master was force-pushed at
+# some point?).
+2eaf3f670fea4ce4466340141244e41a45542c13
+e5adc560cc8544200faa3e04504202839626ab37
+cf1b5eee7f36af29d1d5caba3538ad4985e51f81
+
+# The patch depends on earlier ones that are not part of 10.2.
+b3121bfd413973f460e2cc9a9f852bdfa1265fcf mesa: guard better when building with sse4.1 optimisations
+
+# The PIPE_CAP is not in mesa 10.2 - breaks the build.
+72969e0efb7a5a011629c1001e81aa2329ede6b1 radeon/compute: Report a value for PIPE_SHADER_CAP_MAX_CONST_BUFFER_SIZE
+
+# No whitespace fixes for the stable branches.
+38fccc37c1fa57c1fd373e8d71621bb4aed31083 radeonsi/compute: Whitespace fixes
+
+# The commit relies of patches restructuring r600_resource, which never made
+# it in the 10.2 branch.
+a15088338ebe544efd90bfa7934cb99521488141 radeonsi/compute: Stop leaking the input buffer

bin/bugzilla_mesa.sh

@@ -15,14 +15,17 @@
 # $ DRYRUN=yes bin/bugzilla_mesa.sh mesa-9.0.2..mesa-9.0.3 | wc -l
 
 
-# regex pattern: trim before bug number
-trim_before='s/.*show_bug.cgi?id=\([0-9]*\).*/\1/'
+# regex pattern: trim before url
+trim_before='s/.*\(http\)/\1/'
 
-# regex pattern: reconstruct the url
-use_after='s,^,https://bugs.freedesktop.org/show_bug.cgi?id=,'
+# regex pattern: trim after url
+trim_after='s/\(show_bug.cgi?id=[0-9]*\).*/\1/'
+
+# regex pattern: always use https
+use_https='s/http:/https:/'
 
 # extract fdo urls from commit log
-urls=$(git log $* | grep 'bugs.freedesktop.org/show_bug' | sed -e $trim_before | sort -n -u | sed -e $use_after)
+urls=$(git log $* | grep 'bugs.freedesktop.org/show_bug' | sed -e $trim_before -e $trim_after -e $use_https | sort | uniq)
 
 # if DRYRUN is set to "yes", simply print the URLs and don't fetch the
 # details from fdo bugzilla.

bin/get-pick-list.sh

@@ -14,7 +14,7 @@ git log --reverse --grep="cherry picked from commit" origin/master..HEAD |\
 	sed -e 's/^[[:space:]]*(cherry picked from commit[[:space:]]*//' -e 's/)//' > already_picked
 
 # Grep for commits that were marked as a candidate for the stable tree.
-git log --reverse --pretty=%H -i --grep='^\([[:space:]]*NOTE: .*[Cc]andidate\|CC:.*10\.6.*mesa-stable\)' HEAD..origin/master |\
+git log --reverse --pretty=%H -i --grep='^\([[:space:]]*NOTE: .*[Cc]andidate\|CC:.*10\.2.*mesa-stable\)' HEAD..origin/master |\
 while read sha
 do
 	# Check to see whether the patch is on the ignore list.

common.py

@@ -26,28 +26,28 @@ else:
     target_platform = host_platform
 
 _machine_map = {
-    'x86': 'x86',
-    'i386': 'x86',
-    'i486': 'x86',
-    'i586': 'x86',
-    'i686': 'x86',
-    'BePC': 'x86',
-    'Intel': 'x86',
-    'ppc': 'ppc',
-    'BeBox': 'ppc',
-    'BeMac': 'ppc',
-    'AMD64': 'x86_64',
-    'x86_64': 'x86_64',
-    'sparc': 'sparc',
-    'sun4u': 'sparc',
+	'x86': 'x86',
+	'i386': 'x86',
+	'i486': 'x86',
+	'i586': 'x86',
+	'i686': 'x86',
+	'BePC': 'x86',
+	'Intel': 'x86',
+	'ppc' : 'ppc',
+	'BeBox': 'ppc',
+	'BeMac': 'ppc',
+	'AMD64': 'x86_64',
+	'x86_64': 'x86_64',
+	'sparc': 'sparc',
+	'sun4u': 'sparc',
 }
 
 
 # find host_machine value
 if 'PROCESSOR_ARCHITECTURE' in os.environ:
-    host_machine = os.environ['PROCESSOR_ARCHITECTURE']
+	host_machine = os.environ['PROCESSOR_ARCHITECTURE']
 else:
-    host_machine = _platform.machine()
+	host_machine = _platform.machine()
 host_machine = _machine_map.get(host_machine, 'generic')
 
 default_machine = host_machine
@@ -65,8 +65,7 @@ else:
     default_llvm = 'no'
     try:
         if target_platform != 'windows' and \
-           subprocess.call(['llvm-config', '--version'],
-                           stdout=subprocess.PIPE) == 0:
+           subprocess.call(['llvm-config', '--version'], stdout=subprocess.PIPE) == 0:
             default_llvm = 'yes'
     except:
         pass
@@ -76,38 +75,30 @@ else:
 # Common options
 
 def AddOptions(opts):
-    try:
-        from SCons.Variables.BoolVariable import BoolVariable as BoolOption
-    except ImportError:
-        from SCons.Options.BoolOption import BoolOption
-    try:
-        from SCons.Variables.EnumVariable import EnumVariable as EnumOption
-    except ImportError:
-        from SCons.Options.EnumOption import EnumOption
-    opts.Add(EnumOption('build', 'build type', 'debug',
-                        allowed_values=('debug', 'checked', 'profile',
-                                        'release')))
-    opts.Add(BoolOption('verbose', 'verbose output', 'no'))
-    opts.Add(EnumOption('machine', 'use machine-specific assembly code',
-                        default_machine,
-                        allowed_values=('generic', 'ppc', 'x86', 'x86_64')))
-    opts.Add(EnumOption('platform', 'target platform', host_platform,
-                        allowed_values=('cygwin', 'darwin', 'freebsd', 'haiku',
-                                        'linux', 'sunos', 'windows')))
-    opts.Add(BoolOption('embedded', 'embedded build', 'no'))
-    opts.Add(BoolOption('analyze',
-                        'enable static code analysis where available', 'no'))
-    opts.Add('toolchain', 'compiler toolchain', default_toolchain)
-    opts.Add(BoolOption('gles', 'EXPERIMENTAL: enable OpenGL ES support',
-                        'no'))
-    opts.Add(BoolOption('llvm', 'use LLVM', default_llvm))
-    opts.Add(BoolOption('openmp', 'EXPERIMENTAL: compile with openmp (swrast)',
-                        'no'))
-    opts.Add(BoolOption('debug', 'DEPRECATED: debug build', 'yes'))
-    opts.Add(BoolOption('profile', 'DEPRECATED: profile build', 'no'))
-    opts.Add(BoolOption('quiet', 'DEPRECATED: profile build', 'yes'))
-    opts.Add(BoolOption('texture_float',
-                        'enable floating-point textures and renderbuffers',
-                        'no'))
-    if host_platform == 'windows':
-        opts.Add('MSVC_VERSION', 'Microsoft Visual C/C++ version')
+	try:
+		from SCons.Variables.BoolVariable import BoolVariable as BoolOption
+	except ImportError:
+		from SCons.Options.BoolOption import BoolOption
+	try:
+		from SCons.Variables.EnumVariable import EnumVariable as EnumOption
+	except ImportError:
+		from SCons.Options.EnumOption import EnumOption
+	opts.Add(EnumOption('build', 'build type', 'debug',
+	                  allowed_values=('debug', 'checked', 'profile', 'release')))
+	opts.Add(BoolOption('verbose', 'verbose output', 'no'))
+	opts.Add(EnumOption('machine', 'use machine-specific assembly code', default_machine,
+											 allowed_values=('generic', 'ppc', 'x86', 'x86_64')))
+	opts.Add(EnumOption('platform', 'target platform', host_platform,
+											 allowed_values=('cygwin', 'darwin', 'freebsd', 'haiku', 'linux', 'sunos', 'windows')))
+	opts.Add(BoolOption('embedded', 'embedded build', 'no'))
+	opts.Add(BoolOption('analyze', 'enable static code analysis where available', 'no'))
+	opts.Add('toolchain', 'compiler toolchain', default_toolchain)
+	opts.Add(BoolOption('gles', 'EXPERIMENTAL: enable OpenGL ES support', 'no'))
+	opts.Add(BoolOption('llvm', 'use LLVM', default_llvm))
+	opts.Add(BoolOption('openmp', 'EXPERIMENTAL: compile with openmp (swrast)', 'no'))
+	opts.Add(BoolOption('debug', 'DEPRECATED: debug build', 'yes'))
+	opts.Add(BoolOption('profile', 'DEPRECATED: profile build', 'no'))
+	opts.Add(BoolOption('quiet', 'DEPRECATED: profile build', 'yes'))
+	opts.Add(BoolOption('texture_float', 'enable floating-point textures and renderbuffers', 'no'))
+	if host_platform == 'windows':
+		opts.Add('MSVC_VERSION', 'Microsoft Visual C/C++ version')

docs/GL3.txt

@@ -18,26 +18,27 @@ are exposed in the 3.0 context as extensions.
 Feature                                               Status
 ----------------------------------------------------- ------------------------
 
-GL 3.0, GLSL 1.30 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe
+GL 3.0 --- all DONE: i965, nv50, nvc0, r600, radeonsi
 
+  GLSL 1.30                                             DONE ()
   glBindFragDataLocation, glGetFragDataLocation         DONE
-  Conditional rendering (GL_NV_conditional_render)      DONE ()
-  Map buffer subranges (GL_ARB_map_buffer_range)        DONE ()
-  Clamping controls (GL_ARB_color_buffer_float)         DONE ()
-  Float textures, renderbuffers (GL_ARB_texture_float)  DONE ()
+  Conditional rendering (GL_NV_conditional_render)      DONE (r300, swrast)
+  Map buffer subranges (GL_ARB_map_buffer_range)        DONE (r300, swrast)
+  Clamping controls (GL_ARB_color_buffer_float)         DONE (r300)
+  Float textures, renderbuffers (GL_ARB_texture_float)  DONE (r300)
   GL_EXT_packed_float                                   DONE ()
-  GL_EXT_texture_shared_exponent                        DONE ()
+  GL_EXT_texture_shared_exponent                        DONE (swrast)
   Float depth buffers (GL_ARB_depth_buffer_float)       DONE ()
-  Framebuffer objects (GL_ARB_framebuffer_object)       DONE ()
+  Framebuffer objects (GL_ARB_framebuffer_object)       DONE (r300, swrast)
   GL_ARB_half_float_pixel                               DONE (all drivers)
-  GL_ARB_half_float_vertex                              DONE ()
+  GL_ARB_half_float_vertex                              DONE (r300, swrast)
   GL_EXT_texture_integer                                DONE ()
   GL_EXT_texture_array                                  DONE ()
-  Per-buffer blend and masks (GL_EXT_draw_buffers2)     DONE ()
-  GL_EXT_texture_compression_rgtc                       DONE ()
-  GL_ARB_texture_rg                                     DONE ()
+  Per-buffer blend and masks (GL_EXT_draw_buffers2)     DONE (swrast)
+  GL_EXT_texture_compression_rgtc                       DONE (r300, swrast)
+  GL_ARB_texture_rg                                     DONE (r300, swrast)
   Transform feedback (GL_EXT_transform_feedback)        DONE ()
-  Vertex array objects (GL_ARB_vertex_array_object)     DONE ()
+  Vertex array objects (GL_ARB_vertex_array_object)     DONE (all drivers)
   sRGB framebuffer format (GL_EXT_framebuffer_sRGB)     DONE ()
   glClearBuffer commands                                DONE
   glGetStringi command                                  DONE
@@ -45,197 +46,151 @@ GL 3.0, GLSL 1.30 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, soft
   glVertexAttribI commands                              DONE
   Depth format cube textures                            DONE ()
   GLX_ARB_create_context (GLX 1.4 is required)          DONE
-  Multisample anti-aliasing                             DONE (llvmpipe (*), softpipe (*))
-
-(*) llvmpipe and softpipe have fake Multisample anti-aliasing support
+  Multisample anti-aliasing                             DONE (r300)
 
 
-GL 3.1, GLSL 1.40 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe
+GL 3.1 --- all DONE: i965, nv50, nvc0, r600, radeonsi
 
+  GLSL 1.40                                             DONE ()
   Forward compatible context support/deprecations       DONE ()
-  Instanced drawing (GL_ARB_draw_instanced)             DONE ()
-  Buffer copying (GL_ARB_copy_buffer)                   DONE ()
-  Primitive restart (GL_NV_primitive_restart)           DONE ()
+  Instanced drawing (GL_ARB_draw_instanced)             DONE (swrast)
+  Buffer copying (GL_ARB_copy_buffer)                   DONE (r300, swrast)
+  Primitive restart (GL_NV_primitive_restart)           DONE (r300)
   16 vertex texture image units                         DONE ()
   Texture buffer objs (GL_ARB_texture_buffer_object)    DONE for OpenGL 3.1 contexts ()
-  Rectangular textures (GL_ARB_texture_rectangle)       DONE ()
-  Uniform buffer objs (GL_ARB_uniform_buffer_object)    DONE ()
-  Signed normalized textures (GL_EXT_texture_snorm)     DONE ()
+  Rectangular textures (GL_ARB_texture_rectangle)       DONE (r300, swrast)
+  Uniform buffer objs (GL_ARB_uniform_buffer_object)    DONE (swrast)
+  Signed normalized textures (GL_EXT_texture_snorm)     DONE (r300)
 
 
-GL 3.2, GLSL 1.50 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe
+GL 3.2 --- all DONE: i965, nv50, nvc0, r600, radeonsi
 
   Core/compatibility profiles                           DONE
+  GLSL 1.50                                             DONE ()
   Geometry shaders                                      DONE ()
-  BGRA vertex order (GL_ARB_vertex_array_bgra)          DONE ()
-  Base vertex offset(GL_ARB_draw_elements_base_vertex)  DONE ()
-  Frag shader coord (GL_ARB_fragment_coord_conventions) DONE ()
-  Provoking vertex (GL_ARB_provoking_vertex)            DONE ()
+  BGRA vertex order (GL_ARB_vertex_array_bgra)          DONE (r300, swrast)
+  Base vertex offset(GL_ARB_draw_elements_base_vertex)  DONE (r300, swrast)
+  Frag shader coord (GL_ARB_fragment_coord_conventions) DONE (r300, swrast)
+  Provoking vertex (GL_ARB_provoking_vertex)            DONE (r300, swrast)
   Seamless cubemaps (GL_ARB_seamless_cube_map)          DONE ()
   Multisample textures (GL_ARB_texture_multisample)     DONE ()
-  Frag depth clamp (GL_ARB_depth_clamp)                 DONE ()
-  Fence objects (GL_ARB_sync)                           DONE ()
+  Frag depth clamp (GL_ARB_depth_clamp)                 DONE (swrast)
+  Fence objects (GL_ARB_sync)                           DONE (r300, swrast)
   GLX_ARB_create_context_profile                        DONE
 
 
-GL 3.3, GLSL 3.30 --- all DONE: i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe
+GL 3.3 --- all DONE: i965, nv50, nvc0, r600, radeonsi
 
-  GL_ARB_blend_func_extended                            DONE ()
+  GLSL 3.30                                             DONE ()
+  GL_ARB_blend_func_extended                            DONE (softpipe)
   GL_ARB_explicit_attrib_location                       DONE (all drivers that support GLSL)
-  GL_ARB_occlusion_query2                               DONE ()
+  GL_ARB_occlusion_query2                               DONE (r300, swrast)
   GL_ARB_sampler_objects                                DONE (all drivers)
   GL_ARB_shader_bit_encoding                            DONE ()
   GL_ARB_texture_rgb10_a2ui                             DONE ()
-  GL_ARB_texture_swizzle                                DONE ()
+  GL_ARB_texture_swizzle                                DONE (r300, swrast)
   GL_ARB_timer_query                                    DONE ()
-  GL_ARB_instanced_arrays                               DONE ()
+  GL_ARB_instanced_arrays                               DONE (r300)
   GL_ARB_vertex_type_2_10_10_10_rev                     DONE ()
 
 
-GL 4.0, GLSL 4.00:
+GL 4.0:
 
-  GL_ARB_draw_buffers_blend                            DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_draw_indirect                                 DONE (i965, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_gpu_shader5                                   DONE (i965, nvc0)
-  - 'precise' qualifier                                DONE
-  - Dynamically uniform sampler array indices          DONE (r600)
-  - Dynamically uniform UBO array indices              DONE (r600)
-  - Implicit signed -> unsigned conversions            DONE
-  - Fused multiply-add                                 DONE ()
-  - Packing/bitfield/conversion functions              DONE (r600, radeonsi)
-  - Enhanced textureGather                             DONE (r600, radeonsi)
-  - Geometry shader instancing                         DONE (r600)
-  - Geometry shader multiple streams                   DONE ()
-  - Enhanced per-sample shading                        DONE (r600, radeonsi)
-  - Interpolation functions                            DONE (r600)
-  - New overload resolution rules                      DONE
-  GL_ARB_gpu_shader_fp64                               DONE (nvc0, softpipe)
-  GL_ARB_sample_shading                                DONE (i965, nv50, nvc0, r600, radeonsi)
-  GL_ARB_shader_subroutine                             started (Dave)
-  GL_ARB_tessellation_shader                           started (Chris, Ilia)
-  GL_ARB_texture_buffer_object_rgb32                   DONE (i965, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_texture_cube_map_array                        DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_texture_gather                                DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe)
-  GL_ARB_texture_query_lod                             DONE (i965, nv50, nvc0, r600, radeonsi)
-  GL_ARB_transform_feedback2                           DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_transform_feedback3                           DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
+  GLSL 4.0                                             not started
+  GL_ARB_texture_query_lod                             DONE (i965, nv50, nvc0)
+  GL_ARB_draw_buffers_blend                            DONE (i965, nv50, nvc0, r600, radeonsi, softpipe)
+  GL_ARB_draw_indirect                                 DONE (i965)
+  GL_ARB_gpu_shader5                                   started
+  - 'precise' qualifier                                not started
+  - Dynamically uniform sampler array indices          not started
+  - Dynamically uniform UBO array indices              not started
+  - Implicit signed -> unsigned conversions            not started
+  - Fused multiply-add                                 DONE
+  - Packing/bitfield/conversion functions              DONE
+  - Enhanced textureGather                             DONE
+  - Geometry shader instancing                         DONE
+  - Geometry shader multiple streams                   not started
+  - Enhanced per-sample shading                        DONE
+  - Interpolation functions                            started
+  - New overload resolution rules                      not started
+  GL_ARB_gpu_shader_fp64                               not started
+  GL_ARB_sample_shading                                DONE (i965, nv50, nvc0)
+  GL_ARB_shader_subroutine                             not started
+  GL_ARB_tessellation_shader                           not started
+  GL_ARB_texture_buffer_object_rgb32                   DONE (i965, nvc0, r600, radeonsi, softpipe)
+  GL_ARB_texture_cube_map_array                        DONE (i965, nv50, nvc0, r600, softpipe)
+  GL_ARB_texture_gather                                DONE (i965, nv50, nvc0)
+  GL_ARB_transform_feedback2                           DONE (i965, nv50, nvc0, r600, radeonsi)
+  GL_ARB_transform_feedback3                           DONE (i965, nv50, nvc0, r600, radeonsi)
 
 
-GL 4.1, GLSL 4.10:
+GL 4.1:
 
-  GL_ARB_ES2_compatibility                             DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
+  GLSL 4.1                                             not started
+  GL_ARB_ES2_compatibility                             DONE (i965, nv50, nvc0, r300, r600, radeonsi)
   GL_ARB_get_program_binary                            DONE (0 binary formats)
   GL_ARB_separate_shader_objects                       DONE (all drivers)
-  GL_ARB_shader_precision                              started (Micah)
-  GL_ARB_vertex_attrib_64bit                           DONE (nvc0, softpipe)
-  GL_ARB_viewport_array                                DONE (i965, nv50, nvc0, r600, llvmpipe)
+  GL_ARB_shader_precision                              not started
+  GL_ARB_vertex_attrib_64bit                           not started
+  GL_ARB_viewport_array                                DONE (i965, nv50, r600)
 
 
-GL 4.2, GLSL 4.20:
+GL 4.2:
 
-  GL_ARB_texture_compression_bptc                      DONE (i965, nvc0, r600, radeonsi)
-  GL_ARB_compressed_texture_pixel_storage              DONE (all drivers)
+  GLSL 4.2                                             not started
+  GL_ARB_texture_compression_bptc                      not started
+  GL_ARB_compressed_texture_pixel_storage              not started
   GL_ARB_shader_atomic_counters                        DONE (i965)
   GL_ARB_texture_storage                               DONE (all drivers)
-  GL_ARB_transform_feedback_instanced                  DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_base_instance                                 DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
+  GL_ARB_transform_feedback_instanced                  DONE (i965, nv50, nvc0, r600, radeonsi)
+  GL_ARB_base_instance                                 DONE (i965, nv50, nvc0, r600, radeonsi)
   GL_ARB_shader_image_load_store                       in progress (curro)
   GL_ARB_conservative_depth                            DONE (all drivers that support GLSL 1.30)
   GL_ARB_shading_language_420pack                      DONE (all drivers that support GLSL 1.30)
-  GL_ARB_shading_language_packing                      DONE (all drivers)
-  GL_ARB_internalformat_query                          DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
+  GL_ARB_internalformat_query                          DONE (i965, nv50, nvc0, r300, r600, radeonsi)
   GL_ARB_map_buffer_alignment                          DONE (all drivers)
 
 
-GL 4.3, GLSL 4.30:
+GL 4.3:
 
-  GL_ARB_arrays_of_arrays                              started (Timothy)
-  GL_ARB_ES3_compatibility                             DONE (all drivers that support GLSL 3.30)
+  GLSL 4.3                                             not started
+  GL_ARB_arrays_of_arrays                              started
+  GL_ARB_ES3_compatibility                             DONE (i965)
   GL_ARB_clear_buffer_object                           DONE (all drivers)
-  GL_ARB_compute_shader                                in progress (jljusten)
-  GL_ARB_copy_image                                    DONE (i965)
+  GL_ARB_compute_shader                                started (Paul Berry)
+  GL_ARB_copy_image                                    not started
   GL_KHR_debug                                         DONE (all drivers)
-  GL_ARB_explicit_uniform_location                     DONE (all drivers that support GLSL)
-  GL_ARB_fragment_layer_viewport                       DONE (nv50, nvc0, r600, llvmpipe)
+  GL_ARB_explicit_uniform_location                     not started
+  GL_ARB_fragment_layer_viewport                       not started
   GL_ARB_framebuffer_no_attachments                    not started
   GL_ARB_internalformat_query2                         not started
   GL_ARB_invalidate_subdata                            DONE (all drivers)
-  GL_ARB_multi_draw_indirect                           DONE (i965, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_program_interface_query                       DONE (all drivers)
+  GL_ARB_multi_draw_indirect                           DONE (i965)
+  GL_ARB_program_interface_query                       not started
   GL_ARB_robust_buffer_access_behavior                 not started
-  GL_ARB_shader_image_size                             in progress (Martin Peres)
+  GL_ARB_shader_image_size                             not started
   GL_ARB_shader_storage_buffer_object                  not started
-  GL_ARB_stencil_texturing                             DONE (i965/gen8+, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_texture_buffer_range                          DONE (nv50, nvc0, i965, r600, radeonsi, llvmpipe)
-  GL_ARB_texture_query_levels                          DONE (all drivers that support GLSL 1.30)
+  GL_ARB_stencil_texturing                             DONE (i965/gen8+)
+  GL_ARB_texture_buffer_range                          DONE (nv50, nvc0, i965, r600, radeonsi)
+  GL_ARB_texture_query_levels                          DONE (i965)
   GL_ARB_texture_storage_multisample                   DONE (all drivers that support GL_ARB_texture_multisample)
-  GL_ARB_texture_view                                  DONE (i965, nv50, nvc0, llvmpipe, softpipe)
+  GL_ARB_texture_view                                  DONE (i965)
   GL_ARB_vertex_attrib_binding                         DONE (all drivers)
 
 
-GL 4.4, GLSL 4.40:
+GL 4.4:
 
-  GL_MAX_VERTEX_ATTRIB_STRIDE                          DONE (all drivers)
-  GL_ARB_buffer_storage                                DONE (i965, nv50, nvc0, r600, radeonsi)
-  GL_ARB_clear_texture                                 DONE (i965)
+  GLSL 4.4                                             not started
+  GL_MAX_VERTEX_ATTRIB_STRIDE                          not started
+  GL_ARB_buffer_storage                                DONE (i965, nv30, nv50, nvc0, r300, r600, radeonsi)
+  GL_ARB_clear_texture                                 not started
   GL_ARB_enhanced_layouts                              not started
   GL_ARB_multi_bind                                    DONE (all drivers)
   GL_ARB_query_buffer_object                           not started
-  GL_ARB_texture_mirror_clamp_to_edge                  DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_texture_stencil8                              DONE (nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_vertex_type_10f_11f_11f_rev                   DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
+  GL_ARB_texture_mirror_clamp_to_edge                  DONE (i965, nv30, nv50, nvc0, r300, r600, radeonsi, swrast)
+  GL_ARB_texture_stencil8                              not started
+  GL_ARB_vertex_type_10f_11f_11f_rev                   DONE (i965, nv50, nvc0, r600, radeonsi)
 
-GL 4.5, GLSL 4.50:
-
-  GL_ARB_ES3_1_compatibility                           not started
-  GL_ARB_clip_control                                  DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_conditional_render_inverted                   DONE (i965, nv50, nvc0, llvmpipe, softpipe)
-  GL_ARB_cull_distance                                 not started
-  GL_ARB_derivative_control                            DONE (i965, nv50, nvc0, r600)
-  GL_ARB_direct_state_access                           DONE (all drivers)
-  - Transform Feedback object                          DONE
-  - Buffer object                                      DONE
-  - Framebuffer object                                 DONE
-  - Renderbuffer object                                DONE
-  - Texture object                                     DONE
-  - Vertex array object                                DONE
-  - Sampler object                                     DONE
-  - Program Pipeline object                            DONE
-  - Query object                                       DONE (will require changes when GL_ARB_query_buffer_object lands)
-  GL_ARB_get_texture_sub_image                         started (Brian Paul)
-  GL_ARB_shader_texture_image_samples                  not started
-  GL_ARB_texture_barrier                               DONE (nv50, nvc0, r600, radeonsi)
-  GL_KHR_context_flush_control                         DONE (all - but needs GLX/EXT extension to be useful)
-  GL_KHR_robust_buffer_access_behavior                 not started
-  GL_KHR_robustness                                    90% done (the ARB variant)
-  GL_EXT_shader_integer_mix                            DONE (all drivers that support GLSL)
-
-These are the extensions cherry-picked to make GLES 3.1
-GLES3.1, GLSL ES 3.1
-  GL_ARB_arrays_of_arrays                              started (Timothy)
-  GL_ARB_compute_shader                                in progress (jljusten)
-  GL_ARB_draw_indirect                                 DONE (i965, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_explicit_uniform_location                     DONE (all drivers that support GLSL)
-  GL_ARB_framebuffer_no_attachments                    not started
-  GL_ARB_program_interface_query                       DONE (all drivers)
-  GL_ARB_shader_atomic_counters                        DONE (i965)
-  GL_ARB_shader_image_load_store                       in progress (curro)
-  GL_ARB_shader_image_size                             in progress (Martin Peres)
-  GL_ARB_shader_storage_buffer_object                  not started
-  GL_ARB_shading_language_packing                      DONE (all drivers)
-  GL_ARB_separate_shader_objects                       DONE (all drivers)
-  GL_ARB_stencil_texturing                             DONE (i965/gen8+, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  Multisample textures (GL_ARB_texture_multisample)    DONE (i965, nv50, nvc0, r600, radeonsi, llvmpipe, softpipe)
-  GL_ARB_texture_storage_multisample                   DONE (all drivers that support GL_ARB_texture_multisample)
-  GL_ARB_vertex_attrib_binding                         DONE (all drivers)
-  GS5 Enhanced textureGather                           DONE (i965, nvc0, r600, radeonsi)
-  GS5 Packing/bitfield/conversion functions            DONE (i965, nvc0, r600, radeonsi)
-  GL_EXT_shader_integer_mix                            DONE (all drivers that support GLSL)
-
-  Additional functions not covered above:
-      glMemoryBarrierByRegion
-      glGetTexLevelParameter[fi]v - needs updates to restrict to GLES enums
-      glGetBooleani_v - needs updates to restrict to GLES enums
 
 More info about these features and the work involved can be found at
 http://dri.freedesktop.org/wiki/MissingFunctionality

docs/README.WIN32

@@ -11,6 +11,10 @@ no longer shipped or supported.
 
 Run
 
+  scons osmesa mesagdi
+
+to build classic mesa Windows GDI drivers; or
+
   scons libgl-gdi
 
 to build gallium based GDI driver.

docs/VERSIONS

@@ -103,7 +103,7 @@ Mesa Version History
 	- Stencil-related functions now work in display lists
     Changes:
 	- renamed aux.h as glaux.h (MS-DOS names can't start with aux)
-	- most filenames are in 8.3 format to accommodate MS-DOS
+	- most filenames are in 8.3 format to accomodate MS-DOS
 	- use GLubytes to store arrays of colors instead of GLints
 
 1.2.2   August 2, 1995
@@ -1007,7 +1007,7 @@ Mesa Version History
 	- glGetTexImage was using pixel unpacking instead of packing params
 	- auto-mipmap generation for cube maps was incorrect
     Changes:
-	- max texture units reduced to six to accommodate texture rectangles
+	- max texture units reduced to six to accomodate texture rectangles
 	- removed unfinished GL_MESA_sprite_point extension code
 
 

docs/autoconf.html

@@ -97,22 +97,20 @@ shared libraries in a single pass.</p>
 <dt><code>CC, CFLAGS, CXX, CXXFLAGS</code></dt>
 <dd><p>These environment variables
 control the C and C++ compilers used during the build. By default,
-<code>gcc</code> and <code>g++</code> are used and the debug/optimisation
-level is left unchanged.</p>
+<code>gcc</code> and <code>g++</code> are used with the options
+<code>"-g -O2"</code>.</p>
 </dd>
 
 <dt><code>LDFLAGS</code></dt>
 <dd><p>An environment variable specifying flags to
-pass when linking programs. These should be empty and
-<code>PKG_CONFIG_PATH</code> is recommended to be used instead. If needed
-it can be used to direct the linker to use libraries in nonstandard
-directories. For example, <code>LDFLAGS="-L/usr/X11R6/lib"</code>.</p>
+pass when linking programs. These are normally empty, but can be used
+to direct the linker to use libraries in nonstandard directories. For
+example, <code>LDFLAGS="-L/usr/X11R6/lib"</code>.</p>
 </dd>
 
 <dt><code>PKG_CONFIG_PATH</code></dt>
-<dd><p>The
-<code>pkg-config</code> utility is a hard requirement for cofiguring and
-building mesa. It is used to search for external libraries
+<dd><p>When available, the
+<code>pkg-config</code> utility is used to search for external libraries
 on the system. This environment variable is used to control the search
 path for <code>pkg-config</code>. For instance, setting
 <code>PKG_CONFIG_PATH=/usr/X11R6/lib/pkgconfig</code> will search for
@@ -137,32 +135,14 @@ one of these architectures is detected. This option ensures that
 assembly will not be used.</p>
 </dd>
 
-<dt><code>--build=</code></dt>
-<dt><code>--host=</code></dt>
-<dd><p>By default, the build will compile code for the architecture that
-it's running on. In order to build cross-compile Mesa on a x86-64 machine
-that is to run on a i686, one would need to set the options to:</p>
-
-<p><code>--build=x86_64-pc-linux-gnu --host=i686-pc-linux-gnu</code></p>
-
-Note that these can vary from distribution to distribution. For more
-information check with the
-<a href="https://www.gnu.org/savannah-checkouts/gnu/autoconf/manual/autoconf-2.69/html_node/Specifying-Target-Triplets.html">
-autoconf manual</a>.
-Note that you will need to correctly set <code>PKG_CONFIG_PATH</code> as well.
-
-
-<p>In some cases a single compiler is capable of handling both architectures
-(multilib) in that case one would need to set the <code>CC,CXX</code> variables
-appending the correct machine options. Seek your compiler documentation for
-further information -
-<a href="https://gcc.gnu.org/onlinedocs/gcc/Submodel-Options.html"> gcc
-machine dependent options</a></p>
-
-<p>In addition to specifying correct <code>PKG_CONFIG_PATH</code> for the target
-architecture, the following should be sufficient to configure multilib Mesa</p>
-
-<code>./configure CC="gcc -m32" CXX="g++ -m32" --build=x86_64-pc-linux-gnu --host=i686-pc-linux-gnu ...</code>
+<dt><code>--enable-32-bit</code></dt>
+<dt><code>--enable-64-bit</code></dt>
+<dd><p>By default, the build will compile code as directed by the environment
+variables
+<code>CC</code>, <code>CFLAGS</code>, etc. If the compiler is
+<code>gcc</code>, these options offer a helper to add the compiler flags
+to force 32- or 64-bit code generation as used on the x86 and x86_64
+architectures. Note that these options are mutually exclusive.</p>
 </dd>
 </dl>
 
@@ -214,9 +194,7 @@ kernel DRM modules are not available.
 <dt><code>--enable-glx-tls</code> <dd><p>
 Enable Thread Local Storage (TLS) in
 GLX.
-<dt><code>--with-expat=DIR</code>
-<dd><p><strong>DEPRECATED</strong>, use <code>PKG_CONFIG_PATH</code> instead.</p>
-<p>The DRI-enabled libGL uses expat to
+<dt><code>--with-expat=DIR</code> <dd> The DRI-enabled libGL uses expat to
 parse the DRI configuration files in <code>/etc/drirc</code> and
 <code>~/.drirc</code>. This option allows a specific expat installation
 to be used. For example, <code>--with-expat=/usr/local</code> will

docs/contents.html

@@ -61,6 +61,7 @@
 <li><a href="shading.html" target="_parent">Shading Language</a>
 <li><a href="egl.html" target="_parent">EGL</a>
 <li><a href="opengles.html" target="_parent">OpenGL ES</a>
+<li><a href="openvg.html" target="_parent">OpenVG / Vega</a>
 <li><a href="envvars.html" target="_parent">Environment Variables</a>
 <li><a href="osmesa.html" target="_parent">Off-Screen Rendering</a>
 <li><a href="debugging.html" target="_parent">Debugging Tips</a>

docs/devinfo.html

@@ -218,93 +218,15 @@ commit ID of the commit of interest (as it appears in the mesa master branch).
 
 The latest set of patches that have been nominated, accepted, or rejected for
 the upcoming stable release can always be seen on the
-<a href="http://cworth.org/~cworth/mesa-stable-queue/">Mesa Stable Queue</a>
+<a href=http://cworth.org/~cworth/mesa-stable-queue/">Mesa Stable Queue</a>
 page.
 
-<h2>Criteria for accepting patches to the stable branch</h2>
+<h2>Cherry-picking candidates for a stable branch</h2>
 
-Mesa has a designated release manager for each stable branch, and the release
-manager is the only developer that should be pushing changes to these
-branches. Everyone else should simply nominate patches using the mechanism
-described above.
-
-The stable-release manager will work with the list of nominated patches, and
-for each patch that meets the crtieria below will cherry-pick the patch with:
-<code>git cherry-pick -x &lt;commit&gt;</code>. The <code>-x</code> option is
-important so that the picked patch references the comit ID of the original
-patch.
-
-The stable-release manager may at times need to force-push changes to the
-stable branches, for example, to drop a previously-picked patch that was later
-identified as causing a regression). These force-pushes may cause changes to
-be lost from the stable branch if developers push things directly. Consider
-yourself warned.
-
-The stable-release manager is also given broad discretion in rejecting patches
-that have been nominated for the stable branch. The most basic rule is that
-the stable branch is for bug fixes only, (no new features, no
-regressions). Here is a non-exhaustive list of some reasons that a patch may
-be rejected:
-
-<ul>
-  <li>Patch introduces a regression. Any reported build breakage or other
-  regression caused by a particular patch, (game no longer work, piglit test
-  changes from PASS to FAIL), is justification for rejecting a patch.</li>
-
-  <li>Patch is too large, (say, larger than 100 lines)</li>
-
-  <li>Patch is not a fix. For example, a commit that moves code around with no
-  functional change should be rejected.</li>
-
-  <li>Patch fix is not clearly described. For example, a commit message
-  of only a single line, no description of the bug, no mention of bugzilla,
-  etc.</li>
-
-  <li>Patch has not obviously been reviewed, For example, the commit message
-  has no Reviewed-by, Signed-off-by, nor Tested-by tags from anyone but the
-  author.</li>
-
-  <li>Patch has not already been merged to the master branch. As a rule, bug
-  fixes should never be applied first to a stable branch. Patches should land
-  first on the master branch and then be cherry-picked to a stable
-  branch. (This is to avoid future releases causing regressions if the patch
-  is not also applied to master.) The only things that might look like
-  exceptions would be backports of patches from master that happen to look
-  significantly different.</li>
-
-  <li>Patch depends on too many other patches. Ideally, all stable-branch
-  patches should be self-contained. It sometimes occurs that a single, logical
-  bug-fix occurs as two separate patches on master, (such as an original
-  patch, then a subsequent fix-up to that patch). In such a case, these two
-  patches should be squashed into a single, self-contained patch for the
-  stable branch. (Of course, if the squashing makes the patch too large, then
-  that could be a reason to reject the patch.)</li>
-
-  <li>Patch includes new feature development, not bug fixes. New OpenGL
-  features, extensions, etc. should be applied to Mesa master and included in
-  the next major release. Stable releases are intended only for bug fixes.
-
-  Note: As an exception to this rule, the stable-release manager may accept
-  hardware-enabling "features". For example, backports of new code to support
-  a newly-developed hardware product can be accepted if they can be reasonably
-  determined to not have effects on other hardware.</li>
-
-  <li>Patch is a performance optimization. As a rule, performance patches are
-  not candidates for the stable branch. The only exception might be a case
-  where an application's performance was recently severely impacted so as to
-  become unusable. The fix for this performance regression could then be
-  considered for a stable branch. The optimization must also be
-  non-controversial and the patches still need to meet the other criteria of
-  being simple and self-contained</li>
-
-  <li>Patch introduces a new failure mode (such as an assert). While the new
-  assert might technically be correct, for example to make Mesa more
-  conformant, this is not the kind of "bug fix" we want in a stable
-  release. The potential problem here is that an OpenGL program that was
-  previously working, (even if technically non-compliant with the
-  specification), could stop working after this patch. So that would be a
-  regression that is unaacceptable for the stable branch.</li>
-</ul>
+<p>
+Please use <code>git cherry-pick -x &lt;commit&gt;</code> for cherry-picking a commit
+from master to a stable branch.
+</p>
 
 <h2>Making a New Mesa Release</h2>
 
@@ -315,205 +237,64 @@ These are the instructions for making a new Mesa release.
 <h3>Get latest source files</h3>
 <p>
 Use git to get the latest Mesa files from the git repository, from whatever
-branch is relevant. This document uses the convention X.Y.Z for the release
-being created, which should be created from a branch named X.Y.
+branch is relevant.
 </p>
 
-<h3>Perform basic testing</h3>
+
+<h3>Verify and update version info in VERSION</h3>
+
 <p>
-The release manager should, at the very least, test the code by compiling it,
-installing it, and running the latest piglit to ensure that no piglit tests
-have regressed since the previous release.
+Create a docs/relnotes/x.y.z.html file.
+The bin/bugzilla_mesa.sh and bin/shortlog_mesa.sh scripts can be used to
+create the HTML-formatted lists of bugfixes and changes to include in the file.
+Link the new docs/relnotes/x.y.z.html file into the main <a href="relnotes.html">relnotes.html</a> file.
 </p>
 
 <p>
-The release manager should do this testing with at least one hardware driver,
-(say, whatever is contained in the local development machine), as well as on
-both Gallium and non-Gallium software drivers. The software testing can be
-performed by running piglit with the following environment-variable set:
-</p>
-
-<pre>
-LIBGL_ALWAYS_SOFTWARE=1
-</pre>
-
-And Gallium vs. non-Gallium software drivers can be obtained by using the
-following configure flags on separate builds:
-
-<pre>
---with-dri-drivers=swrast
---with-gallium-drivers=swrast
-</pre>
-
-<p>
-Note: If both options are given in one build, both swrast_dri.so drivers will
-be compiled, but only one will be installed. The following command can be used
-to ensure the correct driver is being tested:
-</p>
-
-<pre>
-LIBGL_ALWAYS_SOFTWARE=1 glxinfo | grep "renderer string"
-</pre>
-
-If any regressions are found in this testing with piglit, stop here, and do
-not perform a release until regressions are fixed.
-
-<h3>Update version in file VERSION</h3>
-
-<p>
-Increment the version contained in the file VERSION at Mesa's top-level, then
-commit this change.
-</p>
-
-<h3>Create release notes for the new release</h3>
-
-<p>
-Create a new file docs/relnotes/X.Y.Z.html, (follow the style of the previous
-release notes). Note that the sha256sums section of the release notes should
-be empty at this point.
+Update <a href="index.html">docs/index.html</a>.
 </p>
 
 <p>
-Two scripts are available to help generate portions of the release notes:
-
-<pre>
-	./bin/bugzilla_mesa.sh
-	./bin/shortlog_mesa.sh
-</pre>
-
-<p>
-The first script identifies commits that reference bugzilla bugs and obtains
-the descriptions of those bugs from bugzilla. The second script generates a
-log of all commits. In both cases, HTML-formatted lists are printed to stdout
-to be included in the release notes.
+Tag the files with the release name (in the form <b>mesa-x.y</b>)
+with: <code>git tag -s mesa-x.y -m "Mesa x.y Release"</code>
+Then: <code>git push origin mesa-x.y</code>
 </p>
 
-<p>
-Commit these changes
-</p>
 
-<h3>Make the release archives, signatures, and the release tag</h3>
+<h3>Make the tarballs</h3>
 <p>
-From inside the Mesa directory:
+Make the distribution files.  From inside the Mesa directory:
 <pre>
 	./autogen.sh
-	make -j1 tarballs
+	make tarballs
 </pre>
 
 <p>
-After the tarballs are created, the sha256 checksums for the files will
-be computed and printed. These will be used in a step below.
+After the tarballs are created, the md5 checksums for the files will
+be computed.
+Add them to the docs/relnotes/x.y.html file.
 </p>
 
 <p>
-It's important at this point to also verify that the constructed tar file
-actually builds:
+Copy the distribution files to a temporary directory, unpack them,
+compile everything, and run some demos to be sure everything works.
 </p>
 
-<pre>
-	tar xjf MesaLib-X.Y.Z.tar.bz2
-	cd Mesa-X.Y.Z
-	./configure --enable-gallium-llvm
-	make -j6
-	make install
-</pre>
-
+<h3>Update the website and announce the release</h3>
 <p>
-Some touch testing should also be performed at this point, (run glxgears or
-more involved OpenGL programs against the installed Mesa).
+Make a new directory for the release on annarchy.freedesktop.org with:
+<br>
+<code>
+mkdir /srv/ftp.freedesktop.org/pub/mesa/x.y
+</code>
 </p>
 
 <p>
-Create detached GPG signatures for each of the archive files created above:
-</p>
-
-<pre>
-	gpg --sign --detach MesaLib-X.Y.Z.tar.gz
-	gpg --sign --detach MesaLib-X.Y.Z.tar.bz2
-	gpg --sign --detach MesaLib-X.Y.Z.zip
-</pre>
-
-<p>
-Tag the commit used for the build:
-</p>
-
-<pre>
-	git tag -s mesa-X.Y.X -m "Mesa X.Y.Z release"
-</pre>
-
-<p>
-Note: It would be nice to investigate and fix the issue that causes the
-tarballs target to fail with multiple build process, such as with "-j4". It
-would also be nice to incorporate all of the above commands into a single
-makefile target. And instead of a custom "tarballs" target, we should
-incorporate things into the standard "make dist" and "make distcheck" targets.
-</p>
-
-<h3>Add the sha256sums to the release notes</h3>
-
-<p>
-Edit docs/relnotes/X.Y.Z.html to add the sha256sums printed as part of "make
-tarballs" in the previous step. Commit this change.
-</p>
-
-<h3>Push all commits and the tag creates above</h3>
-
-<p>
-This is the first step that cannot easily be undone. The release is going
-forward from this point:
-</p>
-
-<pre>
-	git push origin X.Y --tags
-</pre>
-
-<h3>Install the release files and signatures on the distribution server</h3>
-
-<p>
-The following commands can be used to copy the release archive files and
-signatures to the freedesktop.org server:
-</p>
-
-<pre>
-	scp MesaLib-X.Y.Z* people.freedesktop.org:
-	ssh people.freedesktop.org
-	cd /srv/ftp.freedesktop.org/pub/mesa
-	mkdir X.Y.Z
-	cd X.Y.Z
-	mv ~/MesaLib-X.Y.Z* .
-</pre>
-
-<h3>Back on mesa master, andd the new release notes into the tree</h3>
-
-<p>
-Something like the following steps will do the trick:
-</p>
-
-<pre>
-	cp docs/relnotes/X.Y.Z.html /tmp
-        git checkout master
-        cp /tmp/X.Y.Z.html docs/relnotes
-        git add docs/relnotes/X.Y.Z.html
-</pre>
-
-<p>
-Also, edit docs/relnotes.html to add a link to the new release notes, and edit
-docs/index.html to add a news entry. Then commit and push:
-</p>
-
-<pre>
-	git commit -a -m "docs: Import X.Y.Z release notes, add news item."
-        git push origin
-</pre>
-
-<h3>Update the mesa3d.org website</h3>
-
-<p>
-NOTE: The recent release managers have not been performing this step
-themselves, but leaving this to Brian Paul, (who has access to the
-sourceforge.net hosting for mesa3d.org). Brian is more than willing to grant
-the permission necessary to future release managers to do this step on their
-own.
+Basically, to upload the tarball files with:
+<br>
+<code>
+rsync -avP -e ssh MesaLib-x.y.* USERNAME@annarchy.freedesktop.org:/srv/ftp.freedesktop.org/pub/mesa/x.y/
+</code>
 </p>
 
 <p>
@@ -525,22 +306,13 @@ sftp USERNAME,mesa3d@web.sourceforge.net
 </code>
 </p>
 
-
-<h3>Announce the release</h3>
 <p>
 Make an announcement on the mailing lists:
 
 <em>mesa-dev@lists.freedesktop.org</em>,
+<em>mesa-users@lists.freedesktop.org</em>
 and
 <em>mesa-announce@lists.freedesktop.org</em>
-
-Follow the template of previously-sent release announcements. The following
-command can be used to generate the log of changes to be included in the
-release announcement:
-
-<pre>
-	git shortlog mesa-X.Y.Z-1..mesa-X.Y.Z
-</pre>
 </p>
 
 </div>

docs/dispatch.html

@@ -204,8 +204,9 @@ terribly relevant.</p>
 few preprocessor defines.</p>
 
 <ul>
-<li>If <tt>GLX_USE_TLS</tt> is defined, method #3 is used.</li>
-<li>If <tt>HAVE_PTHREAD</tt> is defined, method #2 is used.</li>
+<li>If <tt>GLX_USE_TLS</tt> is defined, method #4 is used.</li>
+<li>If <tt>HAVE_PTHREAD</tt> is defined, method #3 is used.</li>
+<li>If <tt>WIN32_THREADS</tt> is defined, method #2 is used.</li>
 <li>If none of the preceding are defined, method #1 is used.</li>
 </ul>
 

docs/egl.html

@@ -77,6 +77,13 @@ drivers will be installed to <code>${libdir}/egl</code>.</p>
 
 </dd>
 
+<dt><code>--enable-gallium-egl</code></dt>
+<dd>
+
+<p>Enable the optional <code>egl_gallium</code> driver.</p>
+
+</dd>
+
 <dt><code>--with-egl-platforms</code></dt>
 <dd>
 
@@ -88,11 +95,8 @@ types such as <code>EGLNativeDisplayType</code> or
 <code>EGLNativeWindowType</code> defined for.</p>
 
 <p>The available platforms are <code>x11</code>, <code>drm</code>,
-<code>wayland</code>, <code>null</code>, <code>android</code>,
-<code>haiku</code>, and <code>gdi</code>.  The <code>android</code> platform
-can only be built as a system component, part of AOSP, while the
-<code>haiku</code> and <code>gdi</code> platforms can only be built with SCons.
-Unless for special needs, the build system should
+<code>fbdev</code>, and <code>gdi</code>.  The <code>gdi</code> platform can
+only be built with SCons.  Unless for special needs, the build system should
 select the right platforms automatically.</p>
 
 </dd>
@@ -115,6 +119,13 @@ is required if applications mix OpenGL and OpenGL ES.</p>
 
 </dd>
 
+<dt><code>--enable-openvg</code></dt>
+<dd>
+
+<p>OpenVG must be explicitly enabled by this option.</p>
+
+</dd>
+
 </dl>
 
 <h2>Use EGL</h2>
@@ -183,6 +194,14 @@ probably required only for some of the demos found in mesa/demo repository.</p>
 values are: <code>debug</code>, <code>info</code>, <code>warning</code>, and
 <code>fatal</code>.</p>
 
+</dd>
+
+<dt><code>EGL_SOFTWARE</code></dt>
+<dd>
+
+<p>For drivers that support both hardware and software rendering, setting this
+variable to true forces the use of software rendering.</p>
+
 </dd>
 </dl>
 
@@ -200,15 +219,38 @@ the X server directly using (XCB-)DRI2 protocol.</p>
 
 </dd>
 
+<dt><code>egl_gallium</code></dt>
+<dd>
+
+<p>This driver is based on Gallium3D.  It supports all rendering APIs and
+hardware supported by Gallium3D.  It is the only driver that supports OpenVG.
+The supported platforms are X11, DRM, FBDEV, and GDI.</p>
+
+<p>This driver comes with its own hardware drivers
+(<code>pipe_&lt;hw&gt;</code>) and client API modules
+(<code>st_&lt;api&gt;</code>).</p>
+
+</dd>
+
 <h2>Packaging</h2>
 
 <p>The ABI between the main library and its drivers are not stable.  Nor is
-there a plan to stabilize it at the moment.</p>
+there a plan to stabilize it at the moment.  Of the EGL drivers,
+<code>egl_gallium</code> has its own hardware drivers and client API modules.
+They are considered internal to <code>egl_gallium</code> and there is also no
+stable ABI between them.  These should be kept in mind when packaging for
+distribution.</p>
+
+<p>Generally, <code>egl_dri2</code> is preferred over <code>egl_gallium</code>
+when the system already has DRI drivers.  As <code>egl_gallium</code> is loaded
+before <code>egl_dri2</code> when both are available, <code>egl_gallium</code>
+is disabled by default.</p>
 
 <h2>Developers</h2>
 
-<p>The sources of the main library and drivers can be found at
-<code>src/egl/</code>.</p>
+<p>The sources of the main library and the classic drivers can be found at
+<code>src/egl/</code>.  The sources of the <code>egl</code> state tracker can
+be found at <code>src/gallium/state_trackers/egl/</code>.</p>
 
 <h3>Lifetime of Display Resources</h3>
 

docs/envvars.html

@@ -34,7 +34,6 @@ sometimes be useful for debugging end-user issues.
 <li>LIBGL_NO_DRAWARRAYS - if set do not use DrawArrays GLX protocol (for debugging)
 <li>LIBGL_SHOW_FPS - print framerate to stdout based on the number of glXSwapBuffers
     calls per second.
-<li>LIBGL_DRI3_DISABLE - disable DRI3 if set (the value does not matter)
 </ul>
 
 

docs/faq.html

@@ -327,6 +327,19 @@ Basically, applying a translation of (0.375, 0.375, 0.0) to your coordinates
 will fix the problem.
 </p>
 
+<h2>3.6 How can I change the maximum framebuffer size in Mesa's
+<tt>swrast</tt> backend?</h2>
+<p>
+These can be overridden by using the <tt>--with-max-width</tt> and
+<tt>--with-max-height</tt> options.  The two need not be equal.
+</p><p>
+Do note that Mesa uses these values to size some internal buffers,
+so increasing these sizes will cause Mesa to require additional
+memory.  Furthermore, increasing these limits beyond <tt>4096</tt>
+may introduce rasterization artifacts; see the leading comments in
+<tt>src/mesa/swrast/s_tritemp.h</tt>.
+</p>
+
 <br>
 <br>
 

docs/index.html

@@ -16,193 +16,6 @@
 
 <h1>News</h1>
 
-<h2>May 11, 2015</h2>
-<p>
-<a href="relnotes/10.5.5.html">Mesa 10.5.5</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>April 24, 2015</h2>
-<p>
-<a href="relnotes/10.5.4.html">Mesa 10.5.4</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>April 12, 2015</h2>
-<p>
-<a href="relnotes/10.5.3.html">Mesa 10.5.3</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>March 28, 2015</h2>
-<p>
-<a href="relnotes/10.5.2.html">Mesa 10.5.2</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>March 20, 2015</h2>
-<p>
-<a href="relnotes/10.4.7.html">Mesa 10.4.7</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>March 13, 2015</h2>
-<p>
-<a href="relnotes/10.5.1.html">Mesa 10.5.1</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>March 06, 2015</h2>
-<p>
-<a href="relnotes/10.5.0.html">Mesa 10.5.0</a> is released.  This is a new
-development release.  See the release notes for more information about
-the release.
-</p>
-
-<h2>March 06, 2015</h2>
-<p>
-<a href="relnotes/10.4.6.html">Mesa 10.4.6</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>February 21, 2015</h2>
-<p>
-<a href="relnotes/10.4.5.html">Mesa 10.4.5</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>February 06, 2015</h2>
-<p>
-<a href="relnotes/10.4.4.html">Mesa 10.4.4</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>January 24, 2015</h2>
-<p>
-<a href="relnotes/10.4.3.html">Mesa 10.4.3</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>January 12, 2015</h2>
-<p>
-<a href="relnotes/10.3.7.html">Mesa 10.3.7</a>
-and <a href="relnotes/10.4.2.html">Mesa 10.4.2</a> are released.
-
-These are bug-fix releases from the 10.3 and 10.4 branches, respectively.
-<br>
-NOTE: It is anticipated that 10.3.7 will be the final release in the 10.3
-series. Users of 10.3 are encouraged to migrate to the 10.4 series in order
-to obtain future fixes.
-</p>
-
-<h2>December 29, 2014</h2>
-<p>
-<a href="relnotes/10.3.6.html">Mesa 10.3.6</a>
-and <a href="relnotes/10.4.1.html">Mesa 10.4.1</a> are released.
-
-These are bug-fix releases from the 10.3 and 10.4 branches, respectively.
-</p>
-
-<h2>December 14, 2014</h2>
-<p>
-<a href="relnotes/10.4.html">Mesa 10.4</a> is released.  This is a new
-development release.  See the release notes for more information about
-the release.
-</p>
-
-<h2>December 5, 2014</h2>
-<p>
-<a href="relnotes/10.3.5.html">Mesa 10.3.5</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>November 21, 2014</h2>
-<p>
-<a href="relnotes/10.3.4.html">Mesa 10.3.4</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>November 8, 2014</h2>
-<p>
-<a href="relnotes/10.3.3.html">Mesa 10.3.3</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>October 24, 2014</h2>
-<p>
-<a href="relnotes/10.3.2.html">Mesa 10.3.2</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>October 12, 2014</h2>
-<p>
-<a href="relnotes/10.2.9.html">Mesa 10.2.9</a>
-and <a href="relnotes/10.3.1.html">Mesa 10.3.1</a> are released.
-
-These are bug-fix releases from the 10.2 and 10.3 branches, respectively.
-<br>
-NOTE: It is anticipated that 10.2.9 will be the final release in the 10.2
-series. Users of 10.2 are encouraged to migrate to the 10.3 series in order
-to obtain future fixes.
-</p>
-
-<h2>September 19, 2014</h2>
-<p>
-<a href="relnotes/10.3.html">Mesa 10.3</a> is released.  This is a new
-development release.  See the release notes for more information about
-the release.
-</p>
-<p>
-Also, <a href="relnotes/10.2.8.html">Mesa 10.2.8</a> is released.
-This is a bug fix release from the 10.2 branch.
-</p>
-
-<h2>September 6, 2014</h2>
-<p>
-<a href="relnotes/10.2.7.html">Mesa 10.2.7</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>August 19, 2014</h2>
-<p>
-<a href="relnotes/10.2.6.html">Mesa 10.2.6</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>August 2, 2014</h2>
-<p>
-<a href="relnotes/10.2.5.html">Mesa 10.2.5</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>July 18, 2014</h2>
-<p>
-<a href="relnotes/10.2.4.html">Mesa 10.2.4</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>July 7, 2014</h2>
-<p>
-<a href="relnotes/10.2.3.html">Mesa 10.2.3</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>July 5, 2014</h2>
-
-<p>
-Mesa demos 8.2.0 is released.
-See the <a href="http://lists.freedesktop.org/archives/mesa-announce/2014-July/000100.html">announcement</a> for more information about the release.
-You can download it from <a href="ftp://ftp.freedesktop.org/pub/mesa/demos/8.2.0/">ftp.freedesktop.org/pub/mesa/demos/8.2.0/</a>.
-</p>
-
-<h2>June 24, 2014</h2>
-<p>
-<a href="relnotes/10.1.6.html">Mesa 10.1.6</a>
-and <a href="relnotes/10.2.2.html">Mesa 10.2.2</a> are released.
-
-These are bug-fix releases from the 10.1 and 10.2 branches, respectively.
-</p>
-
 <h2>June 6, 2014</h2>
 <p>
 <a href="relnotes/10.2.1.html">Mesa 10.2.1</a> is released.  This release
@@ -216,31 +29,6 @@ only fixes a build error in the radeonsi driver that was introduced between
 development release.  See the release notes for more information about
 the release.
 </p>
-<p>
-Also, <a href="relnotes/10.1.5.html">Mesa 10.1.5</a> is released.
-This is a bug fix release from the 10.1 branch.
-</p>
-
-<h2>May 20, 2014</h2>
-<p>
-<a href="relnotes/10.1.4.html">Mesa 10.1.4</a> is released.
-This is a bug-fix release.
-</p>
-
-<h2>May 9, 2014</h2>
-<p>
-<a href="relnotes/10.1.3.html">Mesa 10.1.3</a> is released.
-This is a bug-fix release, and is being released sooner than
-originally scheduled to fix a performance regression (vmware
-swapbuffers falling back to software) introduced to the
-10.1.2 release.
-</p>
-
-<h2>May 5, 2014</h2>
-<p>
-<a href="relnotes/10.1.2.html">Mesa 10.1.2</a> is released.
-This is a bug-fix release.
-</p>
 
 <h2>April 18, 2014</h2>
 <p>
@@ -1372,7 +1160,7 @@ The <a href="faq.html">Mesa FAQ</a> has been rewritten.
 	- glGetTexImage was using pixel unpacking instead of packing params
 	- auto-mipmap generation for cube maps was incorrect
     Changes:
-	- max texture units reduced to six to accommodate texture rectangles
+	- max texture units reduced to six to accomodate texture rectangles
 	- removed unfinished GL_MESA_sprite_point extension code
 </pre>
 

docs/install.html

@@ -34,29 +34,16 @@
 
 <h2>1.1 General</h2>
 <ul>
-<li><a href="http://www.python.org/">Python</a> - Python is required.
-Version 2.6.4 or later should work.
-</li>
-<br>
-<li><a href="http://www.makotemplates.org/">Python Mako module</a> -
-Python Mako module is required. Version 0.7.3 or later should work.
-</li>
-</br>
-<li><a href="http://www.scons.org/">SCons</a> is required for building on
-Windows and optional for Linux (it's an alternative to autoconf/automake.)
-</li>
-<br>
 <li>lex / yacc - for building the GLSL compiler.
-<br>
-<br>
 On Linux systems, flex and bison are used.
 Versions 2.5.35 and 2.4.1, respectively, (or later) should work.
 <br>
 <br>
 On Windows with MinGW, install flex and bison with:
 <pre>mingw-get install msys-flex msys-bison</pre>
-For MSVC on Windows, install
-<a href="http://winflexbison.sourceforge.net/">Win flex-bison</a>.
+</li>
+<li>python - Python is needed for building the Gallium components.
+Version 2.6.4 or later should work.
 </li>
 </ul>
 
@@ -82,7 +69,7 @@ the needed dependencies:
 <pre>
   sudo yum install flex bison imake libtool xorg-x11-proto-devel libdrm-devel \
   gcc-c++ xorg-x11-server-devel libXi-devel libXmu-devel libXdamage-devel git \
-  expat-devel llvm-devel python-mako
+  expat-devel llvm-devel
 </pre>
 
 
@@ -127,13 +114,14 @@ by -debug for debug builds.
 To build Mesa with SCons for Windows on Linux using the MinGW crosscompiler toolchain do
 </p>
 <pre>
-    scons platform=windows toolchain=crossmingw machine=x86 libgl-gdi
+    scons platform=windows toolchain=crossmingw machine=x86 mesagdi libgl-gdi
 </pre>
 <p>
 This will create:
 </p>
 <ul>
-<li>build/windows-x86-debug/gallium/targets/libgl-gdi/opengl32.dll &mdash; Mesa + Gallium + softpipe (or llvmpipe), binary compatible with Windows's opengl32.dll
+<li>build/windows-x86-debug/mesa/drivers/windows/gdi/opengl32.dll &mdash; Mesa + swrast, binary compatible with Windows's opengl32.dll
+<li>build/windows-x86-debug/gallium/targets/libgl-gdi/opengl32.dll &mdash; Mesa + Gallium + softpipe, binary compatible with Windows's opengl32.dll
 </ul>
 <p>
 Put them all in the same directory to test them.

docs/libGL.txt

@@ -49,7 +49,7 @@ stderr if the LIBGL_DEBUG environment variable is defined.
 libGL.so is thread safe.  The overhead of thread safety for common,
 single-thread clients is negligible.  However, the overhead of thread
 safety for multi-threaded clients is significant.  Each GL API call
-requires two calls to pthread_get_specific() which can noticeably
+requires two calls to pthread_get_specific() which can noticably
 impact performance.  Warning:  libGL.so is thread safe but individual
 DRI drivers may not be.  Please consult the documentation for a driver
 to learn if it is thread safe.

docs/llvmpipe.html

@@ -43,7 +43,11 @@ It's the fastest software rasterizer for Mesa.
    </p>
 </li>
 <li>
-   <p>LLVM: version 3.4 recommended; 3.3 or later required.</p>
+   <p>LLVM: version 2.9 recommended; 2.6 or later required.</p>
+   <p><b>NOTE</b>: LLVM 2.8 and earlier will not work on systems that support the
+   Intel AVX extensions (e.g. Sandybridge).  LLVM's code generator will
+   fail when trying to emit AVX instructions.  This was fixed in LLVM 2.9.
+   </p>
    <p>
    For Linux, on a recent Debian based distribution do:
    </p>
@@ -58,37 +62,15 @@ It's the fastest software rasterizer for Mesa.
 </pre>
 
    <p>
-   For Windows you will need to build LLVM from source with MSVC or MINGW
-   (either natively or through cross compilers) and CMake, and set the LLVM
-   environment variable to the directory you installed it to.
+	 For Windows you will need to build LLVM from source with MSVC or MINGW
+	 (either natively or through cross compilers) and CMake, and set the LLVM
+	 environment variable to the directory you installed it to.
 
    LLVM will be statically linked, so when building on MSVC it needs to be
    built with a matching CRT as Mesa, and you'll need to pass
-   <code>-DLLVM_USE_CRT_xxx=yyy</code> as described below.
-   </p>
+   -DLLVM_USE_CRT_RELEASE=MTd for debug and checked builds,
+   -DLLVM_USE_CRT_RELEASE=MTd for profile and release builds.
 
-   <table border="1">
-     <tr>
-       <th rowspan="2">LLVM build-type</th>
-       <th colspan="2" align="center">Mesa build-type</th>
-     </tr>
-     <tr>
-       <th>debug,checked</th>
-       <th>release,profile</th>
-     </tr>
-     <tr>
-       <th>Debug</th>
-       <td><code>-DLLVM_USE_CRT_DEBUG=MTd</code></td>
-       <td><code>-DLLVM_USE_CRT_DEBUG=MT</code></td>
-     </tr>
-     <tr>
-       <th>Release</th>
-       <td><code>-DLLVM_USE_CRT_RELEASE=MTd</code></td>
-       <td><code>-DLLVM_USE_CRT_RELEASE=MT</code></td>
-     </tr>
-   </table>
-
-   <p>
    You can build only the x86 target by passing -DLLVM_TARGETS_TO_BUILD=X86
    to cmake.
    </p>
@@ -119,15 +101,13 @@ but the rest of these instructions assume that scons is used.
 For Windows the procedure is similar except the target:
 
 <pre>
-  scons platform=windows build=debug libgl-gdi
+  scons build=debug libgl-gdi
 </pre>
 
 
 <h1>Using</h1>
 
-<h2>Linux</h2>
-
-<p>On Linux, building will create a drop-in alternative for libGL.so into</p>
+On Linux, building will create a drop-in alternative for libGL.so into
 
 <pre>
   build/foo/gallium/targets/libgl-xlib/libGL.so
@@ -137,45 +117,15 @@ or
   lib/gallium/libGL.so
 </pre>
 
-<p>To use it set the LD_LIBRARY_PATH environment variable accordingly.</p>
+To use it set the LD_LIBRARY_PATH environment variable accordingly.
 
-<p>For performance evaluation pass build=release to scons, and use the corresponding
-lib directory without the "-debug" suffix.</p>
+For performance evaluation pass debug=no to scons, and use the corresponding
+lib directory without the "-debug" suffix.
 
-
-<h2>Windows</h2>
-
-<p>
-On Windows, building will create
-<code>build/windows-x86-debug/gallium/targets/libgl-gdi/opengl32.dll</code>
-which is a drop-in alternative for system's <code>opengl32.dll</code>.  To use
-it put it in the same directory as your application.  It can also be used by
+On Windows, building will create a drop-in alternative for opengl32.dll. To use
+it put it in the same directory as the application. It can also be used by
 replacing the native ICD driver, but it's quite an advanced usage, so if you
 need to ask, don't even try it.
-</p>
-
-<p>
-There is however an easy way to replace the OpenGL software renderer that comes
-with Microsoft Windows 7 (or later) with llvmpipe (that is, on systems without
-any OpenGL drivers):
-</p>
-
-<ul>
-  <li><p>copy build/windows-x86-debug/gallium/targets/libgl-gdi/opengl32.dll to C:\Windows\SysWOW64\mesadrv.dll</p></li>
-  <li><p>load this registry settings:</p>
-  <pre>REGEDIT4
-
-; http://technet.microsoft.com/en-us/library/cc749368.aspx
-; http://www.msfn.org/board/topic/143241-portable-windows-7-build-from-winpe-30/page-5#entry942596
-[HKEY_LOCAL_MACHINE\SOFTWARE\Wow6432Node\Microsoft\Windows NT\CurrentVersion\OpenGLDrivers\MSOGL]
-"DLL"="mesadrv.dll"
-"DriverVersion"=dword:00000001
-"Flags"=dword:00000001
-"Version"=dword:00000002
-</pre>
-  </li>
-  <li>Ditto for 64 bits drivers if you need them.</li>
-</ul>
 
 
 <h1>Profiling</h1>

docs/openvg.html

@@ -0,0 +1,59 @@
+<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
+<html lang="en">
+<head>
+  <meta http-equiv="content-type" content="text/html; charset=utf-8">
+  <title>OpenVG State Tracker</title>
+  <link rel="stylesheet" type="text/css" href="mesa.css">
+</head>
+<body>
+
+<div class="header">
+  <h1>The Mesa 3D Graphics Library</h1>
+</div>
+
+<iframe src="contents.html"></iframe>
+<div class="content">
+
+<h1>OpenVG State Tracker</h1>
+
+<p>
+The current version of the OpenVG state tracker implements OpenVG 1.1.
+</p>
+<p>
+More information about OpenVG can be found at
+<a href="http://www.khronos.org/openvg/">
+http://www.khronos.org/openvg/</a> .
+</p>
+<p>
+The OpenVG state tracker depends on the Gallium architecture and a working EGL implementation.
+Please refer to <a href="egl.html">Mesa EGL</a> for more information about EGL.
+</p>
+
+
+<h2>Building the library</h2>
+<ol>
+<li>Run <code>configure</code> with <code>--enable-openvg</code> and
+<code>--enable-gallium-egl</code>.  If you do not need OpenGL, you can add
+<code>--disable-opengl</code> to save the compilation time.</li>
+
+<li>Build and install Mesa as usual.</li>
+</ol>
+
+<h3>Sample build</h3>
+A sample build looks as follows:
+<pre>
+  $ ./configure --disable-opengl --enable-openvg --enable-gallium-egl
+  $ make
+  $ make install
+</pre>
+
+<p>It will install <code>libOpenVG.so</code>, <code>libEGL.so</code>, and one
+or more EGL drivers.</p>
+
+<h2>OpenVG Demos</h2>
+
+<p>OpenVG demos can be found in mesa/demos repository.</p>
+
+</div>
+</body>
+</html>

docs/relnotes.html

@@ -21,43 +21,8 @@ The release notes summarize what's new or changed in each Mesa release.
 </p>
 
 <ul>
-<li><a href="relnotes/10.5.5.html">10.5.5 release notes</a>
-<li><a href="relnotes/10.5.4.html">10.5.4 release notes</a>
-<li><a href="relnotes/10.5.3.html">10.5.3 release notes</a>
-<li><a href="relnotes/10.5.2.html">10.5.2 release notes</a>
-<li><a href="relnotes/10.4.7.html">10.4.7 release notes</a>
-<li><a href="relnotes/10.5.1.html">10.5.1 release notes</a>
-<li><a href="relnotes/10.5.0.html">10.5.0 release notes</a>
-<li><a href="relnotes/10.4.6.html">10.4.6 release notes</a>
-<li><a href="relnotes/10.4.5.html">10.4.5 release notes</a>
-<li><a href="relnotes/10.4.4.html">10.4.4 release notes</a>
-<li><a href="relnotes/10.4.3.html">10.4.3 release notes</a>
-<li><a href="relnotes/10.4.2.html">10.4.2 release notes</a>
-<li><a href="relnotes/10.3.7.html">10.3.7 release notes</a>
-<li><a href="relnotes/10.4.1.html">10.4.1 release notes</a>
-<li><a href="relnotes/10.3.6.html">10.3.6 release notes</a>
-<li><a href="relnotes/10.4.html">10.4 release notes</a>
-<li><a href="relnotes/10.3.5.html">10.3.5 release notes</a>
-<li><a href="relnotes/10.3.4.html">10.3.4 release notes</a>
-<li><a href="relnotes/10.3.3.html">10.3.3 release notes</a>
-<li><a href="relnotes/10.3.2.html">10.3.2 release notes</a>
-<li><a href="relnotes/10.3.1.html">10.3.1 release notes</a>
-<li><a href="relnotes/10.2.9.html">10.2.9 release notes</a>
-<li><a href="relnotes/10.3.html">10.3 release notes</a>
-<li><a href="relnotes/10.2.8.html">10.2.8 release notes</a>
-<li><a href="relnotes/10.2.7.html">10.2.7 release notes</a>
-<li><a href="relnotes/10.2.6.html">10.2.6 release notes</a>
-<li><a href="relnotes/10.2.5.html">10.2.5 release notes</a>
-<li><a href="relnotes/10.2.4.html">10.2.4 release notes</a>
-<li><a href="relnotes/10.2.3.html">10.2.3 release notes</a>
-<li><a href="relnotes/10.2.2.html">10.2.2 release notes</a>
 <li><a href="relnotes/10.2.1.html">10.2.1 release notes</a>
 <li><a href="relnotes/10.2.html">10.2 release notes</a>
-<li><a href="relnotes/10.1.6.html">10.1.6 release notes</a>
-<li><a href="relnotes/10.1.5.html">10.1.5 release notes</a>
-<li><a href="relnotes/10.1.4.html">10.1.4 release notes</a>
-<li><a href="relnotes/10.1.3.html">10.1.3 release notes</a>
-<li><a href="relnotes/10.1.2.html">10.1.2 release notes</a>
 <li><a href="relnotes/10.1.1.html">10.1.1 release notes</a>
 <li><a href="relnotes/10.1.html">10.1 release notes</a>
 <li><a href="relnotes/10.0.5.html">10.0.5 release notes</a>

docs/relnotes/10.0.3.html

@@ -104,7 +104,7 @@ a07b4b6b9eb449b88a6cb5061e51c331  MesaLib-10.0.3.zip
   <li>Add md5sums for 10.0.2. release.</li>
   <li>cherry-ignore: Ignore several patches not yet ready for the stable branch</li>
   <li>Drop another couple of patches.</li>
-  <li>cherry-ignore: Ignore 4 patches at the request of the author, (Anuj).</li>
+  <li>cherry-ignore: Ignore 4 patches at teh request of the author, (Anuj).</li>
   <li>Update version to 10.0.3</li>
 </ul>
 

docs/relnotes/10.1.2.html

@@ -1,179 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.1.2 Release Notes / (May 5, 2014)</h1>
-
-<p>
-Mesa 10.1.2 is a bug fix release which fixes bugs found since the 10.1.1 release.
-</p>
-<p>
-Mesa 10.1.2 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>MD5 checksums</h2>
-<pre>
-37d79f94b1f41852a89d1fc3900bea76  MesaLib-10.1.2.tar.gz
-28b60d15ac9f364da1e0155911eaf44e  MesaLib-10.1.2.tar.bz2
-05300039085a65fc53c5472c4bb5747a  MesaLib-10.1.2.zip
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=27499">Bug 27499</a> - [855GM i915] GL_LINE_STIPPLE displays incorrect colors</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=75723">Bug 75723</a> - (regression since Linux 3.14?) brw_get_graphics_reset_status: Assertion `brw-&gt;hw_ctx != ((void *)0)' failed</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76894">Bug 76894</a> - Piglit/spec/EXT_framebuffer_object/fbo-bind-renderbuffer failed</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77702">Bug 77702</a> - [i965 Bisected]Piglit spec/NV_conditional_render_blitframebuffer fails</li>
-
-</ul>
-
-<h2>Changes</h2>
-
-<p>Ander Conselvan de Oliveira (2):</p>
-<ul>
-  <li>gbm/dri: Fix out-of-memory error path in dri_device_create()</li>
-  <li>egl: Protect use of gbm_dri with ifdef HAVE_DRM_PLATFORM</li>
-</ul>
-
-<p>Anuj Phogat (27):</p>
-<ul>
-  <li>mesa: Fix glGetVertexAttribi(GL_VERTEX_ATTRIB_ARRAY_SIZE)</li>
-  <li>swrast: Add glBlitFramebuffer to commands affected by conditional rendering</li>
-  <li>mesa: Fix error condition for multisample proxy texture targets</li>
-  <li>i965: Put an assertion to check valid varying_to_slot[varying]</li>
-  <li>i965: Fix component mask and varying_to_slot mapping for gl_Layer</li>
-  <li>i965: Fix component mask and varying_to_slot mapping for gl_ViewportIndex</li>
-  <li>mesa: Add helper function _mesa_is_format_integer()</li>
-  <li>mesa: Add error condition for integer formats in glGetTexImage()</li>
-  <li>mesa: Add an error condition in glGetFramebufferAttachmentParameteriv()</li>
-  <li>mesa: Fix error code generation in glReadPixels()</li>
-  <li>glsl: Allow overlapping locations for vertex input attributes</li>
-  <li>mesa: Fix querying location of nth element of an array variable</li>
-  <li>mesa: Use location VERT_ATTRIB_GENERIC0 for vertex attribute 0</li>
-  <li>glsl: Compile error if fs defines conflicting qualifiers for gl_FragCoord</li>
-  <li>glsl: Compile error if fs uses gl_FragCoord before first redeclaration</li>
-  <li>mesa: Add entry for extension ARB_texture_stencil8</li>
-  <li>mesa: Add error condition for format=STENCIL_INDEX in glGetTexImage()</li>
-  <li>i965: Fix crash in do_blit_readpixels()</li>
-  <li>mesa: Add missing types in _mesa_texstore_xx_xx() functions</li>
-  <li>mesa: Allow srcFormat=GL_DEPTH_STENCIL in _mesa_texstore_xx_xx() functions</li>
-  <li>mesa: Add new helper function _mesa_unpack_depth_stencil_row()</li>
-  <li>mesa: Add support to unpack depth-stencil texture in to FLOAT_32_UNSIGNED_INT_24_8_REV</li>
-  <li>mesa: Allow FLOAT_32_UNSIGNED_INT_24_8_REV in get_tex_depth_stencil()</li>
-  <li>i965: Add glBlitFramebuffer to commands affected by conditional rendering</li>
-  <li>glsl: Use switch to allow adding more shader types</li>
-  <li>glsl: Link error if fs defines conflicting qualifiers for gl_FragCoord</li>
-  <li>glsl: Apply the link error conditions to GL_ARB_fragment_coord_conventions</li>
-</ul>
-
-<p>Benjamin Bellec (1):</p>
-<ul>
-  <li>mesa: fix GetStringi error message with correct function name</li>
-</ul>
-
-<p>Brian Paul (1):</p>
-<ul>
-  <li>swrast: allocate swrast_texture_image::ImageSlices array if needed</li>
-</ul>
-
-<p>Carl Worth (4):</p>
-<ul>
-  <li>docs: Add the MD5 sums for the 10.1.1 release tar files.</li>
-  <li>cherry-ignore: Ignore a patch causing a regression</li>
-  <li>cherry-ignore: Drop an ignored patch now that piglit has been updated.</li>
-  <li>Update VERSION to 10.1.2</li>
-</ul>
-
-<p>Chris Forbes (1):</p>
-<ul>
-  <li>glsl: Only allow `invariant` on shader in/out between stages.</li>
-</ul>
-
-<p>Eric Anholt (1):</p>
-<ul>
-  <li>i965: Fix render-to-texture in non-FinishRenderTexture cases.</li>
-</ul>
-
-<p>Ian Romanick (1):</p>
-<ul>
-  <li>dri3: Enable GLX_MESA_query_renderer on DRI3 too</li>
-</ul>
-
-<p>Kenneth Graunke (2):</p>
-<ul>
-  <li>i965: Don't enable reset notification support on Gen4-5.</li>
-  <li>i965: Actually emit PIPELINE_SELECT and 3DSTATE_VF_STATISTICS.</li>
-</ul>
-
-<p>Marek Olšák (10):</p>
-<ul>
-  <li>r300g: don't crash when getting NULL colorbuffers</li>
-  <li>st/mesa: remove trailing NULL colorbuffers</li>
-  <li>r600g: fix edge flags and layered rendering on R600-R700</li>
-  <li>r600g: disable async DMA on R700</li>
-  <li>r600g: fix MSAA resolve on R6xx when the destination is 1D-tiled</li>
-  <li>r600g: fix flushing on RV670, RS780, RS880 again</li>
-  <li>r600g: fix buffer copying on R600-R700</li>
-  <li>r600g: fix for broken CULL_FRONT behavior on R6xx</li>
-  <li>r600g: fix for an MSAA hang on RV770</li>
-  <li>r600g: fix hang on RV740 by using DX_RASTERIZATION_KILL instead of SX_MISC</li>
-</ul>
-
-<p>Michel Dänzer (2):</p>
-<ul>
-  <li>r600g: Disable LLVM by default at runtime for graphics</li>
-  <li>st/mesa: Fix NULL pointer dereference for incomplete framebuffers</li>
-</ul>
-
-<p>Neil Roberts (1):</p>
-<ul>
-  <li>wayland: Fix the logic in disabling the prime capability</li>
-</ul>
-
-<p>Samuel Iglesias Gonsalvez (1):</p>
-<ul>
-  <li>mesa: fix check for dummy renderbuffer in _mesa_FramebufferRenderbufferEXT()</li>
-</ul>
-
-<p>Thomas Hellstrom (1):</p>
-<ul>
-  <li>st/xa: Cache render target surface</li>
-</ul>
-
-<p>nick (1):</p>
-<ul>
-  <li>swrast: Fix vertex color in _swsetup_Translate()</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.1.3.html

@@ -1,90 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.1.3 Release Notes / (May 9, 2014)</h1>
-
-<p>
-Mesa 10.1.3 is a bug fix release which fixes bugs found since the 10.1.2 release.
-</p>
-
-<p>
-Note: Mesa 10.1.3 is being released sooner than originally scheduled to make
-available a fix for a performance rgression that was inadvertently introduced
-to Mesa 10.1.2. The performance regression is reported to make vmware
-swapbuffers fall back to software. 
-</p>
-
-<p>
-Mesa 10.1.3 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>MD5 checksums</h2>
-<pre>
-665fe1656aaa2c37b32042068aff92cb  MesaLib-10.1.3.tar.gz
-ba6dbe2b9cab0b4de840c996b9b6a3ad  MesaLib-10.1.3.tar.bz2
-4e6f26330a63d3c47e62ac4bdead39e8  MesaLib-10.1.3.zip
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77245">Bug 77245</a> - Bogus GL_ARB_explicit_attrib_location layout identifier warnings</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Carl Worth (3):</p>
-<ul>
-  <li>docs: Add MD5 sums for Mesa 10.1.2</li>
-  <li>get-pick-list.sh: Require explicit "10.1" for nominating stable patches</li>
-  <li>VERSION: Update to 10.1.3</li>
-</ul>
-
-<p>Kenneth Graunke (2):</p>
-<ul>
-  <li>mesa: Fix MaxNumLayers for 1D array textures.</li>
-  <li>i965: Fix depth (array slices) computation for 1D_ARRAY render targets.</li>
-</ul>
-
-<p>Tapani Pälli (1):</p>
-<ul>
-  <li>glsl: fix bogus layout qualifier warnings</li>
-</ul>
-
-<p>Thomas Hellstrom (1):</p>
-<ul>
-  <li>st/xa: Fix performance regression introduced by commit "Cache render target surface"</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.1.4.html

@@ -1,100 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.1.4 Release Notes / (May 20, 2014)</h1>
-
-<p>
-Mesa 10.1.4 is a bug fix release which fixes bugs found since the 10.1.3 release.
-</p>
-
-<p>
-Mesa 10.1.4 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>MD5 checksums</h2>
-<pre>
-e934365d77f384bfaec844999440bef8  MesaLib-10.1.4.tar.gz
-6fddee101f49b7409cd29994c34ddee7  MesaLib-10.1.4.tar.bz2
-ba5f48e7d5e373922c804c2651fec6c1  MesaLib-10.1.4.zip
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78225">Bug 78225</a> - Compile error due to undefined reference to `gbm_dri_backend', fix attached</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78537">Bug 78537</a> - no anisotropic filtering in a native Half-Life 2</li>
-
-</ul>
-
-<h2>Changes</h2>
-
-<p>Brian Paul (1):</p>
-<ul>
-  <li>mesa: fix double-freeing of dispatch tables inside glBegin/End.</li>
-</ul>
-
-<p>Carl Worth (3):</p>
-<ul>
-  <li>docs: Add MD5 sums for 10.1.3</li>
-  <li>cherry-ignore: Roland and Michel agreed to drop these patches.</li>
-  <li>VERSION: Update to 10.1.4</li>
-</ul>
-
-<p>Emil Velikov (1):</p>
-<ul>
-  <li>configure: error out if building GBM without dri</li>
-</ul>
-
-<p>Eric Anholt (1):</p>
-<ul>
-  <li>i965/vs: Use samplers for UBOs in the VS like we do for non-UBO pulls.</li>
-</ul>
-
-<p>Ilia Mirkin (3):</p>
-<ul>
-  <li>nv50/ir: make sure to reverse cond codes on all the OP_SET variants</li>
-  <li>nv50: fix setting of texture ms info to be per-stage</li>
-  <li>nv50/ir: fix integer mul lowering for u32 x u32 -&gt; high u32</li>
-</ul>
-
-<p>Michel Dänzer (1):</p>
-<ul>
-  <li>radeonsi: Fix anisotropic filtering state setup</li>
-</ul>
-
-<p>Tom Stellard (2):</p>
-<ul>
-  <li>configure.ac: Add LLVM_VERSION_PATCH to DEFINES</li>
-  <li>radeonsi: Enable geometry shaders with LLVM 3.4.1</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.1.5.html

@@ -1,105 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.1.5 Release Notes / (June 6, 2014)</h1>
-
-<p>
-Mesa 10.1.5 is a bug fix release which fixes bugs found since the 10.1.4 release.
-</p>
-
-<p>
-Mesa 10.1.5 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-b0aceaa75bc9a9b2d9215a113e2ad488b5cf85c99005a7624f8cf7c37c5d0eaa  MesaLib-10.1.5.tar.gz
-bc6c5ec7836f254a49d055a29d9aa34c97c54c038f47ad3a00fa57a5fef15bbc  MesaLib-10.1.5.tar.bz2
-78b7255cab0af7918945452a84de7989096ebcdd27e99b31c56c0589274cbc77  MesaLib-10.1.5.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79115">Bug 79115</a> - </li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79421">Bug 79421</a> - </li>
-
-</ul>
-
-<h2>Changes</h2>
-
-<p>Brian Paul (1):</p>
-<ul>
-  <li>glsl: fix use-after free bug/crash in ast_declarator_list::hir()</li>
-</ul>
-
-<p>Carl Worth (5):</p>
-<ul>
-  <li>docs: Add md5sums for 10.1.4 release</li>
-  <li>Merge remote-tracking branch 'origin/10.1' into 10.1</li>
-  <li>cherry-ignore: Ignore two commits.</li>
-  <li>Ignore a patch that is not needed for the 10.1 branch.</li>
-  <li>Update version to 10.1.5</li>
-</ul>
-
-<p>Emil Velikov (1):</p>
-<ul>
-  <li>glx: do not leak dri3Display</li>
-</ul>
-
-<p>Ilia Mirkin (2):</p>
-<ul>
-  <li>nv50/ir: fix s32 x s32 -&gt; high s32 multiply logic</li>
-  <li>nv50/ir: fix constant folding for OP_MUL subop HIGH</li>
-</ul>
-
-<p>James Legg (1):</p>
-<ul>
-  <li>mesa: Fix unbinding GL_DEPTH_STENCIL_ATTACHMENT</li>
-</ul>
-
-<p>Jeremy Huddleston Sequoia (2):</p>
-<ul>
-  <li>glapi: Avoid heap corruption in _glapi_table</li>
-  <li>darwin: Fix test for kCGLPFAOpenGLProfile support at runtime</li>
-</ul>
-
-<p>Pavel Popov (2):</p>
-<ul>
-  <li>i965: Properly return *RESET* status in glGetGraphicsResetStatusARB</li>
-  <li>i965: Fix Line Stipple enable bit in 3DSTATE_SF for Haswell.</li>
-</ul>
-
-<p>Roland Scheidegger (1):</p>
-<ul>
-  <li>llvmpipe: fix crash when not all attachments are populated in a fb</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.1.6.html

@@ -1,138 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.1.6 Release Notes / (June 24, 2014)</h1>
-
-<p>
-Mesa 10.1.6 is a bug fix release which fixes bugs found since the 10.1.5 release.
-</p>
-
-<p>
-Mesa 10.1.6 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-cde60e06b340d7598802fe4a4484b3fb8befd714f9ab9caabe1f27d3149e8815  MesaLib-10.1.6.tar.bz2
-e4e726d7805a442f7ed07d12f71335e6126796ec85328a5989eb5348a8042d00  MesaLib-10.1.6.tar.gz
-bf7e3f721a7ad0c2057a034834b6fea688e64f26a66cf8d1caa2827e405e72dd  MesaLib-10.1.6.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=54372">Bug 54372</a> - GLX_INTEL_swap_event crashes driver when swapping window buffers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=74005">Bug 74005</a> - [i965 Bisected]Piglit/glx_glx-make-glxdrawable-current fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78581">Bug 78581</a> - </li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79729">Bug 79729</a> - [i965] glClear on a multisample texture doesn't work</li>
-
-</ul>
-
-<h2>Changes</h2>
-
-<p>Adrian Negreanu (7):</p>
-<ul>
-  <li>add megadriver_stub_FILES</li>
-  <li>android: adapt to the megadriver mechanism</li>
-  <li>android: add libloader to libGLES_mesa and libmesa_egl_dri2</li>
-  <li>android: add src/gallium/auxiliary as include path for libmesa_dricore</li>
-  <li>android, egl: add correct drm include for libmesa_egl_dri2</li>
-  <li>android, mesa_gen_matypes: pull in timespec POSIX definition</li>
-  <li>android, dricore: undefined reference to _mesa_streaming_load_memcpy</li>
-</ul>
-
-<p>Beren Minor (1):</p>
-<ul>
-  <li>egl/main: Fix eglMakeCurrent when releasing context from current thread.</li>
-</ul>
-
-<p>Carl Worth (3):</p>
-<ul>
-  <li>docs: Add SHA256 checksums for the 10.1.5 release</li>
-  <li>cherry-ignore: Add a patch to ignore</li>
-  <li>Update VERSION to 10.1.6</li>
-</ul>
-
-<p>Daniel Manjarres (1):</p>
-<ul>
-  <li>glx: Don't crash on swap event for a Window (non-GLXWindow)</li>
-</ul>
-
-<p>Emil Velikov (1):</p>
-<ul>
-  <li>configure: error out when building opencl without LLVM</li>
-</ul>
-
-<p>Iago Toral Quiroga (1):</p>
-<ul>
-  <li>mesa: Copy Geom.UsesEndPrimitive when cloning a geometry program.</li>
-</ul>
-
-<p>José Fonseca (3):</p>
-<ul>
-  <li>mesa/main: Make get_hash.c values constant.</li>
-  <li>mesa: Make glGetIntegerv(GL_*_ARRAY_SIZE) return GL_BGRA.</li>
-  <li>mesa/main: Prevent sefgault on glGetIntegerv(GL_ATOMIC_COUNTER_BUFFER_BINDING).</li>
-</ul>
-
-<p>Kristian Høgsberg (1):</p>
-<ul>
-  <li>mesa: Remove glClear optimization based on drawable size</li>
-</ul>
-
-<p>Michel Dänzer (1):</p>
-<ul>
-  <li>configure: Only check for OpenCL without LLVM when the latter is certain</li>
-</ul>
-
-<p>Neil Roberts (1):</p>
-<ul>
-  <li>i965: Set the fast clear color value for texture surfaces</li>
-</ul>
-
-<p>Roland Scheidegger (1):</p>
-<ul>
-  <li>draw: (trivial) fix clamping of viewport index</li>
-</ul>
-
-<p>Tobias Klausmann (1):</p>
-<ul>
-  <li>nv50/ir: clear subop when folding constant expressions</li>
-</ul>
-
-<p>Tom Stellard (2):</p>
-<ul>
-  <li>clover: Prevent Clang from printing number of errors and warnings to stderr.</li>
-  <li>clover: Don't use llvm's global context</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.2.1.html

@@ -17,7 +17,7 @@
 <h1>Mesa 10.2.1 Release Notes / June 6, 2014</h1>
 
 <p>
-Mesa 10.2.1 is a bug fix release which fixes bugs found since the 10.2 release.
+Mesa 10.2.1 is a bug fix release which fixes bugs found since the 10.1 release.
 </p>
 <p>
 Mesa 10.2.1 implements the OpenGL 3.3 API, but the version reported by

docs/relnotes/10.2.html

@@ -88,8 +88,6 @@ following options during configure, if you would like support for svga driver
 Note: The files are installed in $(libdir)/gallium-pipe/ and the interface
 between them and libxatracker.so is <strong>not</strong> stable.
 </p>
-
-<li>The environment variable GALLIUM_MSAA that forced a multisample GLX visual was removed.</li>
 </ul>
 
 </div>

docs/relnotes/10.3.1.html

@@ -1,158 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.3.1 Release Notes / October 12, 2014</h1>
-
-<p>
-Mesa 10.3.1 is a bug fix release which fixes bugs found since the 10.3 release.
-</p>
-<p>
-Mesa 10.3.1 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-155afcbad17be8bb80282c761b957d5cc716c14a1fa16c4f5ee04e76df729c6d  MesaLib-10.3.1.tar.gz
-b081d077d717e5d56f2d59677490856052c41573e50378ff86d6c72456714add  MesaLib-10.3.1.tar.bz2
-07a14febfed06412d519e091a62d24513fee6745f1a6f8a8f1956bfe04b77d15  MesaLib-10.3.1.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79462">Bug 79462</a> - [NVC0/Codegen] Shader compilation falis in spill logic</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82932">Bug 82932</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.shaders.indexing.vector_subscript.vec3_static_loop_subscript_write_direct_read_vertex fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83506">Bug 83506</a> - [UBO] row_major layout ignored inside structures</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83533">Bug 83533</a> - [UBO] nested structures don't get appropriate padding</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83570">Bug 83570</a> - Glyphy demo throws unhandled Integer division by zero exception</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83741">Bug 83741</a> - [UBO] row_major layout partially ignored for arrays of structures</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84178">Bug 84178</a> - Big glamor regression in Xorg server 1.6.99.1 GIT: x11perf 1.5 Test: PutImage XY 500x500 Square</li>
-
-</ul>
-
-<h2>Changes</h2>
-
-<p>Andreas Pokorny (2):</p>
-<ul>
-  <li>egl/drm: expose KHR_image_pixmap extension</li>
-  <li>i915: Fix black buffers when importing prime fds</li>
-</ul>
-
-<p>Brian Paul (1):</p>
-<ul>
-  <li>mesa: fix prog_optimize.c assertions triggered by SWZ opcode</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: Add 10.3 sha256 sums, news item and link release notes</li>
-  <li>Update VERSION to 10.3.1</li>
-</ul>
-
-<p>Ian Romanick (4):</p>
-<ul>
-  <li>glsl: Make sure fields after small structs have correct padding</li>
-  <li>glsl: Make sure row-major array-of-structure get correct layout</li>
-  <li>glsl: Round struct size up to at least 16 bytes</li>
-  <li>glsl: Strip arrayness from ir_type_dereference_variable too</li>
-</ul>
-
-<p>Ilia Mirkin (5):</p>
-<ul>
-  <li>nv50/ir: avoid deleting pseudo instructions too early</li>
-  <li>gm107/ir: fix manual TXD for array targets</li>
-  <li>gm107/ir: fix texture argument order</li>
-  <li>gm107/ir: add support for indirect const buffer selection</li>
-  <li>gm107/ir: take relative pfetch offset into account</li>
-</ul>
-
-<p>Keith Packard (1):</p>
-<ul>
-  <li>glx/dri3: Provide error diagnostics when DRI3 allocation fails</li>
-</ul>
-
-<p>Kenneth Graunke (2):</p>
-<ul>
-  <li>mesa: Use proper structure for glGet*(GL_TEXTURE_COORD_ARRAY*).</li>
-  <li>mesa: Set correct array element in vbo_exec_vtx_init.</li>
-</ul>
-
-<p>Marek Olšák (3):</p>
-<ul>
-  <li>radeonsi: release GS rings at context destruction</li>
-  <li>radeonsi: properly destroy the GS copy shader and scratch_bo for compute</li>
-  <li>st/dri: remove GALLIUM_MSAA and __GL_FSAA_MODE environment variables</li>
-</ul>
-
-<p>Michel Dänzer (1):</p>
-<ul>
-  <li>st/mesa: Use PIPE_USAGE_STAGING for GL_STATIC/DYNAMIC/STREAM_READ buffers</li>
-</ul>
-
-<p>Richard Sandiford (2):</p>
-<ul>
-  <li>mesa: Fix alpha component in unpack_R8G8B8X8_SRGB.</li>
-  <li>swrast: Fix handling of MESA_FORMAT_L8A8_SRGB for big-endian</li>
-</ul>
-
-<p>Roland Scheidegger (1):</p>
-<ul>
-  <li>gallivm: fix idiv</li>
-</ul>
-
-<p>Thomas Hellstrom (1):</p>
-<ul>
-  <li>st/xa: Fix regression in xa_yuv_planar_blit()</li>
-</ul>
-
-<p>Tom Stellard (2):</p>
-<ul>
-  <li>clover: Add support to mem objects for multiple destructor callbacks v2</li>
-  <li>configure.ac: Compute LLVM_VERSION_PATCH using llvm-config</li>
-</ul>
-
-<p>Tomasz Figa (3):</p>
-<ul>
-  <li>util: Include in Android builds</li>
-  <li>st/mesa: Generate format_info.c in Android builds</li>
-  <li>st/mesa: Fix paths used in Android builds</li>
-</ul>
-
-<p>rconde (1):</p>
-<ul>
-  <li>gallivm,tgsi: fix idiv by zero crash</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.3.2.html

@@ -1,115 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.3.2 Release Notes / October 24, 2014</h1>
-
-<p>
-Mesa 10.3.2 is a bug fix release which fixes bugs found since the 10.3 release.
-</p>
-<p>
-Mesa 10.3.2 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-e65f8e691f06f111c1aeb3a376b13c9cc88cb162bee2709e0e7e6b0e6628ca75  MesaLib-10.3.2.tar.gz
-e9849bcb9aa9acd98a753d6d46d2e7d7238d3367036e11357a60efd16de8bea3  MesaLib-10.3.2.tar.bz2
-427dc0d670d38e713ebff2675665ec2fe4ff7d04ce227bd54de946999fc1d234  MesaLib-10.3.2.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=54372">Bug 54372</a> - GLX_INTEL_swap_event crashes driver when swapping window buffers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81680">Bug 81680</a> - [r600g] Firefox crashes with hardware acceleration turned on</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84140">Bug 84140</a> - mplayer crashes playing some files using vdpau output</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84662">Bug 84662</a> - Long pauses with Unreal demo Elemental on R9270X since : Always flush the HDP cache before submitting a CS to the GPU</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85267">Bug 85267</a> - vlc crashes with vdpau (Radeon 3850HD) [r600]</li>
-
-</ul>
-
-<h2>Changes</h2>
-
-<p>Brian Paul (3):</p>
-<ul>
-  <li>mesa: fix spurious wglGetProcAddress / GL_INVALID_OPERATION error</li>
-  <li>st/wgl: add WINAPI qualifiers on wgl function typedefs</li>
-  <li>glsl: fix several use-after-free bugs</li>
-</ul>
-
-<p>Daniel Manjarres (1):</p>
-<ul>
-  <li>glx: Fix glxUseXFont for glxWindow and glxPixmaps</li>
-</ul>
-
-<p>Dave Airlie (1):</p>
-<ul>
-  <li>mesa: fix GetTexImage for 1D array depth textures</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.3.1 release</li>
-  <li>Update VERSION to 10.3.2</li>
-</ul>
-
-<p>Ilia Mirkin (4):</p>
-<ul>
-  <li>gm107/ir: add dnz emission for fmul</li>
-  <li>gk110/ir: add dnz flag emission for fmul/fmad</li>
-  <li>nouveau: 3d textures are unsupported, limit 3d levels to 1</li>
-  <li>st/gbm: fix order of arguments passed to is_format_supported</li>
-</ul>
-
-<p>Kenneth Graunke (3):</p>
-<ul>
-  <li>i965: Add a BRW_MOCS_PTE #define.</li>
-  <li>i965: Use BDW_MOCS_PTE for renderbuffers.</li>
-  <li>i965: Fix register write checks.</li>
-</ul>
-
-<p>Marek Olšák (2):</p>
-<ul>
-  <li>st/mesa: use pipe_sampler_view_release for releasing sampler views</li>
-  <li>glsl_to_tgsi: fix the value of gl_FrontFacing with native integers</li>
-</ul>
-
-<p>Michel Dänzer (4):</p>
-<ul>
-  <li>radeonsi: Clear sampler view flags when binding a buffer</li>
-  <li>r600g,radeonsi: Always use GTT again for PIPE_USAGE_STREAM buffers</li>
-  <li>winsys/radeon: Use separate caching buffer manager for each set of flags</li>
-  <li>r600g: Drop references to destroyed blend state</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.3.3.html

@@ -1,209 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.3.3 Release Notes / November 8, 2014</h1>
-
-<p>
-Mesa 10.3.3 is a bug fix release which fixes bugs found since the 10.3.2 release.
-</p>
-<p>
-Mesa 10.3.3 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-23a0c36d88cd5d8968ae6454160de2878192fd1d37b5d606adca1f1b7e788b79  MesaLib-10.3.3.tar.gz
-0e4eee4a2ddf86456eed2fc44da367f95471f74249636710491e85cc256c4753  MesaLib-10.3.3.tar.bz2
-a83648f17d776b7cf6c813fbb15782d2644b937dc6a7c53d8c0d1b35411f4840  MesaLib-10.3.3.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=70410">Bug 70410</a> - egl-static/Makefile: linking fails with llvm &gt;= 3.4</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82921">Bug 82921</a> - layout(location=0) emits error &gt;= MAX_UNIFORM_LOCATIONS due to integer underflow</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83574">Bug 83574</a> - [llvmpipe] [softpipe] piglit arb_explicit_uniform_location-use-of-unused-loc regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85454">Bug 85454</a> - Unigine Sanctuary with Wine crashes on Mesa Git</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85918">Bug 85918</a> - Mesa: MSVC 2010/2012 Compile error</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Anuj Phogat (2):</p>
-<ul>
-  <li>glsl: Fix crash due to negative array index</li>
-  <li>glsl: Use signed array index in update_max_array_access()</li>
-</ul>
-
-<p>Brian Paul (1):</p>
-<ul>
-  <li>mesa: fix UNCLAMPED_FLOAT_TO_UBYTE() macro for MSVC</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.3.2 release</li>
-  <li>Update version to 10.3.3</li>
-</ul>
-
-<p>Ilia Mirkin (27):</p>
-<ul>
-  <li>freedreno/ir3: fix FSLT/etc handling to return 0/-1 instead of 0/1.0</li>
-  <li>freedreno/ir3: INEG operates on src0, not src1</li>
-  <li>freedreno/ir3: add UARL support</li>
-  <li>freedreno/ir3: negate result of USLT/etc</li>
-  <li>freedreno/ir3: use unsigned comparison for UIF</li>
-  <li>freedreno/ir3: add TXL support</li>
-  <li>freedreno/ir3: fix UCMP handling</li>
-  <li>freedreno/ir3: implement UMUL correctly</li>
-  <li>freedreno: add default .dir-locals.el for emacs settings</li>
-  <li>freedreno/ir3: make texture instruction construction more dynamic</li>
-  <li>freedreno/ir3: fix TXB/TXL to actually pull the bias/lod argument</li>
-  <li>freedreno/ir3: add TXQ support</li>
-  <li>freedreno/ir3: add TXB2 support</li>
-  <li>freedreno: dual-source render targets are not supported</li>
-  <li>freedreno: instanced drawing/compute not yet supported</li>
-  <li>freedreno/ir3: avoid fan-in sources referring to same instruction</li>
-  <li>freedreno/ir3: add IDIV/UDIV support</li>
-  <li>freedreno/ir3: add UMOD support, based on UDIV</li>
-  <li>freedreno/ir3: add MOD support</li>
-  <li>freedreno/ir3: add ISSG support</li>
-  <li>freedreno/ir3: add UMAD support</li>
-  <li>freedreno/ir3: make TXQ return integers, not floats</li>
-  <li>freedreno/ir3: shadow comes before array</li>
-  <li>freedreno/ir3: add texture offset support</li>
-  <li>freedreno/ir3: add TXD support and expose ARB_shader_texture_lod</li>
-  <li>freedreno/ir3: add TXF support</li>
-  <li>freedreno: positions come out as integers, not half-integers</li>
-</ul>
-
-<p>Jan Vesely (1):</p>
-<ul>
-  <li>configure: include llvm systemlibs when using static llvm</li>
-</ul>
-
-<p>Marek Olšák (5):</p>
-<ul>
-  <li>r600g: fix polygon mode for points and lines and point/line fill modes</li>
-  <li>radeonsi: fix polygon mode for points and lines and point/line fill modes</li>
-  <li>radeonsi: fix incorrect index buffer max size for lowered 8-bit indices</li>
-  <li>Revert "st/mesa: set MaxUnrollIterations = 255"</li>
-  <li>r300g: remove enabled/disabled hyperz and AA compression messages</li>
-</ul>
-
-<p>Mauro Rossi (1):</p>
-<ul>
-  <li>gallium/nouveau: fully build the driver under android</li>
-</ul>
-
-<p>Michel Dänzer (1):</p>
-<ul>
-  <li>radeon/llvm: Dynamically allocate branch/loop stack arrays</li>
-</ul>
-
-<p>Rob Clark (62):</p>
-<ul>
-  <li>freedreno/ir3: detect scheduler fail</li>
-  <li>freedreno/ir3: add TXB</li>
-  <li>freedreno/ir3: add DDX/DDY</li>
-  <li>freedreno/ir3: bit of debug</li>
-  <li>freedreno/ir3: fix error in bail logic</li>
-  <li>freedreno/ir3: fix constlen with relative addressing</li>
-  <li>freedreno/ir3: add no-copy-propagate fallback step</li>
-  <li>freedreno: don't overflow cmdstream buffer so much</li>
-  <li>freedreno/ir3: fix potential segfault in RA</li>
-  <li>freedreno: update generated headers</li>
-  <li>freedreno/a3xx: enable hw primitive-restart</li>
-  <li>freedreno/a3xx: handle rendering to layer != 0</li>
-  <li>freedreno: update generated headers</li>
-  <li>freedreno/a3xx: format fixes</li>
-  <li>util/u_format: add _is_alpha()</li>
-  <li>freedreno/a3xx: alpha render-target shenanigans</li>
-  <li>freedreno/ir3: catch incorrect usage of tmp-dst</li>
-  <li>freedreno/ir3: add missing put_dst</li>
-  <li>freedreno: "fix" problems with excessive flushes</li>
-  <li>freedreno: update generated headers</li>
-  <li>freedreno/a3xx: 3d/array textures</li>
-  <li>freedreno: add DRM_CONF_SHARE_FD</li>
-  <li>freedreno/a3xx: more texture array fixes</li>
-  <li>freedreno/a3xx: initial texture border-color</li>
-  <li>freedreno: fix compiler warning</li>
-  <li>freedreno: don't advertise mirror-clamp support</li>
-  <li>freedreno: update generated headers</li>
-  <li>freedreno: we have more than 0 viewports!</li>
-  <li>freedreno: turn missing caps into compile warnings</li>
-  <li>freedreno/a3xx: add LOD_BIAS</li>
-  <li>freedreno/a3xx: add flat interpolation mode</li>
-  <li>freedreno/a3xx: add 32bit integer vtx formats</li>
-  <li>freedreno/a3xx: fix border color order</li>
-  <li>freedreno: move bind_sampler_states to per-generation</li>
-  <li>freedreno: add texcoord clamp support to lowering</li>
-  <li>freedreno/a3xx: add support to emulate GL_CLAMP</li>
-  <li>freedreno/a3xx: re-emit shaders on variant change</li>
-  <li>freedreno/lowering: fix token calculation for lowering</li>
-  <li>freedreno: destroy transfer pool after blitter</li>
-  <li>freedreno: max-texture-lod-bias should be 15.0f</li>
-  <li>freedreno: update generated headers</li>
-  <li>freedreno/a3xx: handle large shader program sizes</li>
-  <li>freedreno/a3xx: emit all immediates in one shot</li>
-  <li>freedreno/ir3: fix lockups with lame FRAG shaders</li>
-  <li>freedreno/a3xx: handle VS only outputting BCOLOR</li>
-  <li>freedreno: query fixes</li>
-  <li>freedreno/a3xx: refactor vertex state emit</li>
-  <li>freedreno/a3xx: refactor/optimize emit</li>
-  <li>freedreno/ir3: optimize shader key comparision</li>
-  <li>freedreno: inline fd_draw_emit()</li>
-  <li>freedreno: fix layer_stride</li>
-  <li>freedreno: update generated headers</li>
-  <li>freedreno/ir3: large const support</li>
-  <li>freedreno/a3xx: more layer/level fixes</li>
-  <li>freedreno/ir3: comment + better fxn name</li>
-  <li>freedreno/ir3: fix potential gpu lockup with kill</li>
-  <li>freedreno/a3xx: disable early-z when we have kill's</li>
-  <li>freedreno/ir3: add debug flag to disable cp</li>
-  <li>freedreno: clear vs scissor</li>
-  <li>freedreno: mark scissor state dirty when enable bit changes</li>
-  <li>freedreno/a3xx: fix viewport state during clear</li>
-  <li>freedreno/a3xx: fix depth/stencil restore format</li>
-</ul>
-
-<p>Tapani Pälli (2):</p>
-<ul>
-  <li>glsl: fix uniform location count used for glsl types</li>
-  <li>mesa: check that uniform exists in glUniform* functions</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.3.4.html

@@ -1,106 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.3.4 Release Notes / November 21, 2014</h1>
-
-<p>
-Mesa 10.3.4 is a bug fix release which fixes bugs found since the 10.3.3 release.
-</p>
-<p>
-Mesa 10.3.4 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-26482495ef6177f889dbd87c7edcccfedd995598785bbbd7e3e066352574c8e0  MesaLib-10.3.4.tar.gz
-e6373913142338d10515daf619d659433bfd2989988198930c13b0945a15e98a  MesaLib-10.3.4.tar.bz2
-8c3ebbb6535daf3414305860ebca6ac67dbb6e3d35058c7a6ce18b84b5945b7f  MesaLib-10.3.4.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76252">Bug 76252</a> - Dynamic loading/unloading of opengl32.dll results in a deadlock</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78770">Bug 78770</a> - [SNB bisected]Webglc conformance/textures/texture-size-limit.html fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83500">Bug 83500</a> - si_dma_copy_tile causes GPU hangs</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85647">Bug 85647</a> - Random radeonsi crashes with mesa 10.3.x</li>
-
-</ul>
-
-<h2>Changes</h2>
-<p>Brian Paul (1):</p>
-<ul>
-  <li>st/mesa: copy sampler_array_size field when copying instructions</li>
-</ul>
-
-<p>Chad Versace (1):</p>
-<ul>
-  <li>i965: Fix segfault in WebGL Conformance on Ivybridge</li>
-</ul>
-
-<p>Dave Airlie (5):</p>
-<ul>
-  <li>r600g/cayman: fix integer multiplication output overwrite (v2)</li>
-  <li>r600g/cayman: fix texture gather tests</li>
-  <li>r600g/cayman: handle empty vertex shaders</li>
-  <li>r600g: geom shaders: always load texture src regs from inputs</li>
-  <li>r600g: limit texture offset application to specific types (v2)</li>
-</ul>
-
-<p>Emil Velikov (3):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.3.3 release</li>
-  <li>configure.ac: roll up a program for the sse4.1 check</li>
-  <li>get-pick-list.sh: Require explicit "10.3" for nominating stable patches</li>
-</ul>
-
-<p>Ilia Mirkin (1):</p>
-<ul>
-  <li>st/mesa: add a fallback for clear_with_quad when no vs_layer</li>
-</ul>
-
-<p>José Fonseca (1):</p>
-<ul>
-  <li>llvmpipe: Avoid deadlock when unloading opengl32.dll</li>
-</ul>
-
-<p>Kenneth Graunke (1):</p>
-<ul>
-  <li>i915g: we also have more than 0 viewports!</li>
-</ul>
-
-<p>Michel Dänzer (1):</p>
-<ul>
-  <li>radeonsi: Disable asynchronous DMA except for PIPE_BUFFER</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.3.5.html

@@ -1,88 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.3.5 Release Notes / December 5, 2014</h1>
-
-<p>
-Mesa 10.3.5 is a bug fix release which fixes bugs found since the 10.3.4 release.
-</p>
-<p>
-Mesa 10.3.5 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-7ea71c3cce89114df3dc050376afa1c6f6bf235d77a68f9703273603d6a90621  MesaLib-10.3.5.tar.gz
-eb75d2790f1606d59d50a6acaa637b6c75f2155b3e0eca3d5099165c0d9556ae  MesaLib-10.3.5.tar.bz2
-164bc64ba63fb07ff255ff8de6ed3c95ff545dfe8f864c44c33abe94788da910  MesaLib-10.3.5.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86618">Bug 86618</a> - [NV96] neg modifiers not working in MIN and MAX operations</li>
-
-</ul>
-
-<h2>Changes</h2>
-<p>Brian Paul (2):</p>
-<ul>
-  <li>mesa: fix arithmetic error in _mesa_compute_compressed_pixelstore()</li>
-  <li>mesa: fix height error check for 1D array textures</li>
-</ul>
-
-<p>Chris Forbes (2):</p>
-<ul>
-  <li>i965: Handle nested uniform array indexing</li>
-  <li>mesa: Fix Get(GL_TRANSPOSE_CURRENT_MATRIX_ARB) to transpose</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.3.5 release</li>
-  <li>Update version to 10.3.5</li>
-</ul>
-
-<p>Ilia Mirkin (6):</p>
-<ul>
-  <li>nv50/ir: set neg modifiers on min/max args</li>
-  <li>nv50,nvc0: actually check constbufs for invalidation</li>
-  <li>nv50,nvc0: buffer resources can be bound as other things down the line</li>
-  <li>freedreno/ir3: don't pass consts to madsh.m16 in MOD logic</li>
-  <li>freedreno/a3xx: only enable blend clamp for non-float formats</li>
-  <li>freedreno/ir3: fix UMAD</li>
-</ul>
-
-<p>Rob Clark (1):</p>
-<ul>
-  <li>configure.ac: bump libdrm_freedreno requirement</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.3.6.html

@@ -1,124 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.3.6 Release Notes / December 29, 2014</h1>
-
-<p>
-Mesa 10.3.6 is a bug fix release which fixes bugs found since the 10.3.5 release.
-</p>
-<p>
-Mesa 10.3.6 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-c4d053d6bc6604cb5c93c99e0ef2e815c539f26dc5a03737eb3809bc1767d12f  MesaLib-10.3.6.tar.gz
-8d43673c6788fbf85f9c36c3a95c61ccf46f8835fc9c0d85d34474490d80572b  MesaLib-10.3.6.tar.bz2
-6b5b1e9a13949cfdb76fe51e8dcc3ea71e464a5ca73d11fdc29c20c4ba3f411a  MesaLib-10.3.6.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=60879">Bug 60879</a> - [radeonsi] X11 can't start with acceleration enabled</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82585">Bug 82585</a> - geometry shader with optional out variable segfaults</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82991">Bug 82991</a> - Inverted bumpmap in webgl applications</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84777">Bug 84777</a> - [BSW]Piglit spec_glsl-1.50_execution_geometry-basic fails</li>
-
-</ul>
-
-<h2>Changes</h2>
-
-<p>Andres Gomez (1):</p>
-<ul>
-  <li>i965/brw_reg: struct constructor now needs explicit negate and abs values.</li>
-</ul>
-
-<p>Ben Widawsky (1):</p>
-<ul>
-  <li>i965/gs: Avoid DW * DW mul</li>
-</ul>
-
-<p>Dave Airlie (1):</p>
-<ul>
-  <li>r600g: only init GS_VERT_ITEMSIZE on r600</li>
-</ul>
-
-<p>Emil Velikov (3):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.3.5 release</li>
-  <li>Revert "glx/dri3: Request non-vsynced Present for swapinterval zero. (v3)"</li>
-  <li>Update version to 10.3.6</li>
-</ul>
-
-<p>Ian Romanick (2):</p>
-<ul>
-  <li>linker: Wrap access of producer_var with a NULL check</li>
-  <li>linker: Assign varying locations geometry shader inputs for SSO</li>
-</ul>
-
-<p>Ilia Mirkin (3):</p>
-<ul>
-  <li>util/primconvert: pass index bias through</li>
-  <li>util/primconvert: support instanced rendering</li>
-  <li>util/primconvert: take ib offset into account</li>
-</ul>
-
-<p>José Fonseca (1):</p>
-<ul>
-  <li>util/primconvert: Avoid point arithmetic; apply offset on all cases.</li>
-</ul>
-
-<p>Marek Olšák (1):</p>
-<ul>
-  <li>docs/relnotes: document the removal of GALLIUM_MSAA</li>
-</ul>
-
-<p>Mario Kleiner (4):</p>
-<ul>
-  <li>glx/dri3: Fix glXWaitForSbcOML() to handle targetSBC==0 correctly. (v2)</li>
-  <li>glx/dri3: Track separate (ust, msc) for PresentPixmap vs. PresentNotifyMsc (v2)</li>
-  <li>glx/dri3: Request non-vsynced Present for swapinterval zero. (v3)</li>
-  <li>glx/dri3: Don't fail on glXSwapBuffersMscOML(dpy, window, 0, 0, 0) (v2)</li>
-</ul>
-
-<p>Maxence Le Doré (1):</p>
-<ul>
-  <li>glsl: Add gl_MaxViewports to available builtin constants</li>
-</ul>
-
-<p>Tom Stellard (1):</p>
-<ul>
-  <li>radeonsi: Program RASTER_CONFIG for harvested GPUs v5</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.3.7.html

@@ -1,93 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.3.7 Release Notes / January 12, 2015</h1>
-
-<p>
-Mesa 10.3.7 is a bug fix release which fixes bugs found since the 10.3.6 release.
-</p>
-<p>
-Mesa 10.3.7 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-bc13f33c19bc9f44a0565fdd51a8f9d1c0153a3365c429ceaf4ef43b7022b052  MesaLib-10.3.7.tar.gz
-43c6ced15e237cbb21b3082d7c0b42777c50c1f731d0d4b5efb5231063fb6a5b  MesaLib-10.3.7.tar.bz2
-d821fd46baf804fecfcf403e901800a4b996c7dd1c83f20a354b46566a49026f  MesaLib-10.3.7.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85529">Bug 85529</a> - Surfaces not drawn in Unvanquished</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87619">Bug 87619</a> - Changes to state such as render targets change fragment shader without marking it dirty.</li>
-
-</ul>
-
-<h2>Changes</h2>
-
-<p>Chad Versace (2):</p>
-<ul>
-  <li>i965: Use safer pointer arithmetic in intel_texsubimage_tiled_memcpy()</li>
-  <li>i965: Use safer pointer arithmetic in gather_oa_results()</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.3.6 release</li>
-  <li>Update version to 10.3.7</li>
-</ul>
-
-<p>Ilia Mirkin (2):</p>
-<ul>
-  <li>nv50,nvc0: set vertex id base to index_bias</li>
-  <li>nv50/ir: fix texture offsets in release builds</li>
-</ul>
-
-<p>Kenneth Graunke (2):</p>
-<ul>
-  <li>i965: Add missing BRW_NEW_*_PROG_DATA to texture/renderbuffer atoms.</li>
-  <li>i965: Fix start/base_vertex_location for &gt;1 prims but !BRW_NEW_VERTICES.</li>
-</ul>
-
-<p>Marek Olšák (3):</p>
-<ul>
-  <li>glsl_to_tgsi: fix a bug in copy propagation</li>
-  <li>vbo: ignore primitive restart if FixedIndex is enabled in DrawArrays</li>
-  <li>st/mesa: fix GL_PRIMITIVE_RESTART_FIXED_INDEX</li>
-</ul>
-
-<p>Michel Dänzer (1):</p>
-<ul>
-  <li>radeonsi: Don't modify PA_SC_RASTER_CONFIG register value if rb_mask == 0</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.3.html

@@ -1,335 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.3 Release Notes / September 19, 2014</h1>
-
-<p>
-Mesa 10.3 is a new development release.
-People who are concerned with stability and reliability should stick
-with a previous release or wait for Mesa 10.3.1.
-</p>
-<p>
-Mesa 10.3 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-9a1bf52040fc3dda81e83a35f944f1c3f532847dbe9fdf57161265cf71ea1bae  MesaLib-10.3.0.tar.gz
-0283bfe710fa449ed82e465cfa09612a269e19abb7e0382082608062ce7960b5  MesaLib-10.3.0.tar.bz2
-221420763c2c3a244836a736e735612c4a6a0377b4e5223fca1e612f49906789  MesaLib-10.3.0.zip
-</pre>
-
-
-<h2>New features</h2>
-
-<p>
-Note: some of the new features are only available with certain drivers.
-</p>
-
-<ul>
-<li>GL_ARB_ES3_compatibility on nv50, nvc0, r600, radeonsi, softpipe, llvmpipe</li>
-<li>GL_ARB_clear_texture on i965</li>
-<li>GL_ARB_compressed_texture_pixel_storage on all drivers</li>
-<li>GL_ARB_conditional_render_inverted on i965, nvc0, softpipe, llvmpipe</li>
-<li>GL_ARB_derivative_control on i965, nv50, nvc0, r600</li>
-<li>GL_ARB_draw_indirect on nvc0, radeonsi</li>
-<li>GL_ARB_explicit_uniform_location (all drivers that support GLSL)</li>
-<li>GL_ARB_fragment_layer_viewport on nv50, nvc0, llvmpipe, r600</li>
-<li>GL_ARB_gpu_shader5 on i965/gen7, nvc0</li>
-<li>GL_ARB_multi_draw_indirect on nvc0, radeonsi</li>
-<li>GL_ARB_sample_shading on radeonsi</li>
-<li>GL_ARB_seamless_cubemap_per_texture on i965, llvmpipe, nvc0, r600, radeonsi, softpipe</li>
-<li>GL_ARB_stencil_texturing on nv50, nvc0, r600, and radeonsi</li>
-<li>GL_ARB_texture_barrier on nv50, nvc0, r300, r600, radeonsi</li>
-<li>GL_ARB_texture_compression_bptc on i965/gen7+, nvc0, r600/evergreen+, radeonsi</li>
-<li>GL_ARB_texture_cube_map_array on radeonsi</li>
-<li>GL_ARB_texture_gather on r600, radeonsi</li>
-<li>GL_ARB_texture_query_levels on nv50, nvc0, llvmpipe, r600, radeonsi, softpipe</li>
-<li>GL_ARB_texture_query_lod on r600, radeonsi</li>
-<li>GL_ARB_viewport_array on nvc0</li>
-<li>GL_AMD_vertex_shader_viewport_index on i965/gen7+, r600</li>
-<li>GL_OES_compressed_ETC1_RGB8_texture on nv30, nv50, nvc0, r300, r600, radeonsi, softpipe, llvmpipe</li>
-<li>GLX_MESA_query_renderer on nv30, nv50, nvc0, r300, r600, radeonsi, softpipe, llvmpipe</li>
-<li>A new software rasterizer driver (kms_swrast_dri.so) that works with
-DRM drivers that don't have a full-fledged GEM (such as qxl or simpledrm)</li>
-<li>Distribute the Khronos GL/glcorearb.h header file.</li>
-</ul>
-
-
-<h2>Bug fixes</h2>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=50754">Bug 50754</a> - Building 32 bit mesa on 64 bit OS fails since change for automake</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=53617">Bug 53617</a> - [llvmpipe] piglit fbo-depthtex regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=54372">Bug 54372</a> - GLX_INTEL_swap_event crashes driver when swapping window buffers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=56127">Bug 56127</a> - [ILK bisected]unigine-sanctruary performance reduced by 98%</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=66184">Bug 66184</a> - src/mesa/state_tracker/st_glsl_to_tgsi.cpp:3216:simplify_cmp: Assertion `inst-&gt;dst.index &lt; 4096' failed.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=66452">Bug 66452</a> - JUNIPER UVD accelerated playback of WMV3 streams does not work</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=68365">Bug 68365</a> - [SNB Bisected]Piglit spec_ARB_framebuffer_object_fbo-blit-stretch  fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=70441">Bug 70441</a> - [Gen4-5 clip] Piglit spec_OpenGL_1.1_polygon-offset hits (execsize &gt;= width) assertion</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=73846">Bug 73846</a> - [llvmpipe] lp_test_format fails with llvm-3.5svn &gt;= r199602</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=74005">Bug 74005</a> - [i965 Bisected]Piglit/glx_glx-make-glxdrawable-current fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=74863">Bug 74863</a> - [r600g] HyperZ broken on RV770 and CYPRESS (Left 4 Dead 2 trees corruption) bisected!</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=75010">Bug 75010</a> - clang: error: unknown argument: '-fstack-protector-strong'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=75478">Bug 75478</a> - [BDW]Some Piglit and Ogles2conform cases cause GPU hang</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=75664">Bug 75664</a> - Unigine Valley &amp; Heaven &quot;error: syntax error, unexpected EXTENSION, expecting $end&quot; IVB HD4000</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=75878">Bug 75878</a> - [BDW] GPU hang running Raytracer WebGL demo</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76188">Bug 76188</a> - EGL_EXT_image_dma_buf_import fd ownership is incorrect</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76223">Bug 76223</a> - [radeonsi] luxmark segfault</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76939">Bug 76939</a> - [BDW] GPU hang when running “Metro:Last Light “ /“Crusader Kings II”</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77245">Bug 77245</a> - Bogus GL_ARB_explicit_attrib_location layout identifier warnings</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77493">Bug 77493</a> - lp_test_arit fails with llvm &gt;= llvm-3.5svn r206094</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77703">Bug 77703</a> - [ILK Bisected]Piglit glean_texCombine4 fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77704">Bug 77704</a> - [IVB/HSW Bisected]Ogles3conform GL3Tests_shadow_shadow_execution_frag.test fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77705">Bug 77705</a> - [SNB/IVB/HSW/BYT/BDW Bisected]Ogles3conform GL3Tests/packed_pixels/packed_pixels_pixelstore.test  segfault</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77707">Bug 77707</a> - [ILK Bisected]Ogles2conform GL_sin_sin_float_frag_xvary.test fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77740">Bug 77740</a> - i965: Relax accumulator dependency scheduling on Gen &lt; 6</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77852">Bug 77852</a> - [BDW]Piglit spec_ARB_framebuffer_object_fbo-drawbuffers-none_glBlitFramebuffer fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77856">Bug 77856</a> - [BDW]Piglit spec_OpenGL_3.0_clearbuffer-mixed-format fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77865">Bug 77865</a> - [BDW] Many Ogles3conform framebuffer_blit cases fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78225">Bug 78225</a> - Compile error due to undefined reference to `gbm_dri_backend', fix attached</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78258">Bug 78258</a> - make check link_varyings.gl_ClipDistance failure</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78403">Bug 78403</a> - query_renderer_implementation_unittest.cpp:144:4: error: expected primary-expression before ‘.’ token</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78468">Bug 78468</a> - Compiling of shader gets stuck in infinite loop</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78537">Bug 78537</a> - no anisotropic filtering in a native Half-Life 2</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78546">Bug 78546</a> - [swrast] piglit copyteximage-border regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78581">Bug 78581</a> - OpenCL: clBuildProgram prints error messages directly rather than storing them</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78648">Bug 78648</a> - Texture artifacts in Kerbal Space Program</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78665">Bug 78665</a> - macros in builtin_functions.cpp make invalid assumptions about M_PI definitions</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78679">Bug 78679</a> - Gen4-5 code lost: runtime_check_aads_emit</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78691">Bug 78691</a> - [G45 - Tesseract] Mesa 10.1.2 implementation error: Unsupported opcode 169872468 in FS</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78692">Bug 78692</a> - Football Manager 2014, gameplay rendered black &amp; white</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78716">Bug 78716</a> - Fix Mesa bugs for running Unreal Engine 4.1 Cave effects demo compiled for Linux</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78803">Bug 78803</a> - gallivm/lp_bld_debug.cpp:42:28: fatal error: llvm/IR/Module.h: No such file or directory</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78842">Bug 78842</a> - [swrast] piglit fcc-read-after-clear copy rb regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78843">Bug 78843</a> - [swrast] piglit copyteximage 1D regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78872">Bug 78872</a> - [ILK Bisected]Piglit spec_ARB_depth_buffer_float_fbo-depthstencil-GL_DEPTH32F_STENCIL8-blit Aborted</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78875">Bug 78875</a> - [ILK Bisected]Webglc conformance/uniforms/uniform-default-values.html fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78888">Bug 78888</a> - test_eu_compact.c:54:3: error: implicit declaration of function ‘brw_disasm’ [-Werror=implicit-function-declaration]</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79029">Bug 79029</a> - INTEL_DEBUG=shader_time is full of lies</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79095">Bug 79095</a> - x86/common_x86.c:348:14: error: use of undeclared identifier 'bit_SSE4_1'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79115">Bug 79115</a> - glFramebufferRenderbuffer(GL_DRAW_FRAMEBUFFER, GL_DEPTH_STENCIL_ATTACHMENT, GL_RENDERBUFFER, 0) doesn't unbind stencil buffer</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79263">Bug 79263</a> - Linking error in egl_gallium.la when compiling 32 bit on multiarch</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79294">Bug 79294</a> - Xlib-based build broken on non x86/x86-64 architectures</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79373">Bug 79373</a> - Non-const initializers for matrix and vector constructors</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79382">Bug 79382</a> - build error: multiple definition of `loader_get_pci_id_for_fd'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79421">Bug 79421</a> - [llvmpipe] SIGSEGV src/gallium/drivers/llvmpipe/lp_rast_priv.h:218</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79440">Bug 79440</a> - prog_hash_table.c:146: undefined reference to `_mesa_error_no_memory'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79469">Bug 79469</a> - Commit e3cc0d90e14e62a0a787b6c07a6df0f5c84039be breaks unigine heaven</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79534">Bug 79534</a> - gen&lt;7 renders garbage</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79616">Bug 79616</a> - L4D2 crash on startup</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79724">Bug 79724</a> - switch statement type check</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79729">Bug 79729</a> - [i965] glClear on a multisample texture doesn't work</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79809">Bug 79809</a> - radeonsi: mouse cursor corruption using weston on AMD Kaveri</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79823">Bug 79823</a> - [NV30/gallium] Mozilla apps freeze on startup with nouveau-dri-10.2.1 libs on dual-screen</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79885">Bug 79885</a> - commit b52a530 (gallium/egl: st_profiles are build time decision, treat them as such) broke egl</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79903">Bug 79903</a> - [HSW Bisected]Some Piglit and Ogles2conform cases fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79907">Bug 79907</a> - Mesa 10.2.1 --enable-vdpau default=auto broken</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79948">Bug 79948</a> - [i965] Incorrect pixels when using discard and uniform loads</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80015">Bug 80015</a> - Transparency glitches in native Civilization 5 (Civ5) port</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80115">Bug 80115</a> - MESA_META_DRAW_BUFFERS induced GL_INVALID_VALUE errors</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80211">Bug 80211</a> - [ILK/SNB Bisected]Piglit shaders_glsl-fs-copy-propagation-texcoords-1 fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80247">Bug 80247</a> - Khronos conformance test  ES3-CTS.gtf.GL3Tests.transform_feedback.transform_feedback_vertex_id  fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80254">Bug 80254</a> - pipe_loader_sw.c:90: undefined reference to `dri_create_sw_winsys'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80541">Bug 80541</a> - [softpipe] piglit levelclamp regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80561">Bug 80561</a> - Incorrect implementation of some VDPAU APIs.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80614">Bug 80614</a> - [regression] Error in `omxregister-bellagio': munmap_chunk(): invalid pointer: 0x00007f5f76626dab</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80778">Bug 80778</a> - [bisected regression] piglit spec/glsl-1.50/compiler/incorrect-in-layout-qualifier-repeated-prim.geom</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80827">Bug 80827</a> - [radeonsi,R9 270X] Corruptions in window menus in KDE</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80880">Bug 80880</a> - Unreal Engine 4 demos fail GLSL compiler assertion</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80991">Bug 80991</a> - [BDW]Piglit spec_ARB_sample_shading_builtin-gl-sample-mask_2 fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81020">Bug 81020</a> - [radeonsi][regresssion] Wireframe of background rendered through objects in Half-Life 2: Episode 2 with MSAA enabled</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81150">Bug 81150</a> - [SNB]Piglit spec_arb_shading_language_packing_execution_built-in-functions_fs-packSnorm4x8 fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81157">Bug 81157</a> - [BDW]Piglit some spec_glsl-1.50_execution_built-in-functions* cases fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81450">Bug 81450</a> - [BDW]Piglit spec_glsl-1.30_execution_tex-miplevel-selection_textureGrad_1DArray cases intel_do_flush_locked failed</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81828">Bug 81828</a> - [BDW Bisected]Ogles3conform GL3Tests_packed_pixels_packed_pixels_pbo.test fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81834">Bug 81834</a> - TGSI constant buffer overrun causes assertion failure</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81857">Bug 81857</a> - [SNB+]Piglit spec_glsl-1.30_execution_switch_fs-default_last sporadically fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81967">Bug 81967</a> - [regression] Selections in Blender renders wrong</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82139">Bug 82139</a> - [r600g, bisected] multiple ubo piglit regressions</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82159">Bug 82159</a> - No rule to make target `../../../../src/mesa/libmesa.la', needed by `collision'.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82255">Bug 82255</a> - [VP2] Chroma planes are vertically stretched during VDPAU playback</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82268">Bug 82268</a> - Add support for the OpenRISC architecture (or1k)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82428">Bug 82428</a> - [radeonsi,R9 270X] System lockup when using mplayer/mpv with VDPAU</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82472">Bug 82472</a> - piglit 16385-consecutive-chars regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82483">Bug 82483</a> - format_srgb.h:145: undefined reference to `util_format_srgb_to_linear_8unorm_table'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82517">Bug 82517</a> - [RADEONSI,VDPAU] SIGSEGV in map_msg_fb_buf called from ruvd_destroy, when closing a Tab with accelerated video player</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82534">Bug 82534</a> - src\egl\main\eglapi.h : fatal error LNK1107: invalid or corrupt file: cannot read at 0x2E02</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82536">Bug 82536</a> - u_current.h:72: undefined reference to `__imp__glapi_Dispatch'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82538">Bug 82538</a> - Super Maryo Chronicles fails with st/mesa assertion failure</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82539">Bug 82539</a> - vmw_screen_dri.lo In file included from vmw_screen_dri.c:41: vmwgfx_drm.h:32:17: error: drm.h: No such file or directory</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82546">Bug 82546</a> - [regression] libOSMesa build failure</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82574">Bug 82574</a> - GLSL: opt_vectorize goes wrong on texture lookups</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82628">Bug 82628</a> - bisected: GALLIUM_HUD hangs radeon 7970M (PRIME)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82671">Bug 82671</a> - [r600g-evergreen][compute]Empty kernel execution causes crash</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82709">Bug 82709</a> - OpenCL not working on radeon hainan</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82796">Bug 82796</a> - [IVB/BYT-M/HSW/BDW Bisected]Synmark2_v6.0_OglTerrainFlyInst/OglTerrainPanInst cannot run as image validation failed</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82804">Bug 82804</a> - unreal engine 4 rendering errors</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82814">Bug 82814</a> - glDrawBuffers(0, NULL) segfaults in _mesa_drawbuffers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82828">Bug 82828</a> - Regression: Crash in 3Dmark2001</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82846">Bug 82846</a> - [BDW Bisected] Gpu hang when running Lightsmark v2008/Warsow v1.0/Xonotic v0.7/unigine-demos</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82881">Bug 82881</a> - test_vec4_register_coalesce regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82882">Bug 82882</a> - [swrast] piglit glsl-fs-uniform-bool-1 regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82929">Bug 82929</a> - [BDW Bisected]glxgears causes X hang</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82932">Bug 82932</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.shaders.indexing.vector_subscript.vec3_static_loop_subscript_write_direct_read_vertex fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83046">Bug 83046</a> - [BDW bisected]] Warsow v1.0/Xonotic v0.7/Gputest v0.5_triangle_fullscreen/synmark2_v6/GLBenchmark v2.5.0/GLBenchmark v2.7.0/Ungine-demos performance reduced 30%~60%</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83079">Bug 83079</a> - [NVC0] Dota 2 (Linux native and Wine) crash with Nouveau Drivers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83081">Bug 83081</a> - [BDW Bisected]Piglit spec_ARB_sample_shading_builtin-gl-sample-mask_2 is core dumped</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83127">Bug 83127</a> - [ILK Bisected]Piglit glean_texCombine fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83355">Bug 83355</a> - FTBFS: src/mesa/program/program_lexer.l:122:64: error: unknown type name 'YYSTYPE'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83432">Bug 83432</a> - r600_query.c:269:r600_emit_query_end: Assertion `ctx-&gt;num_pipelinestat_queries &gt; 0' failed [Gallium HUD]</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83468">Bug 83468</a> - [UBO] Using bool from UBO as if-statement condition asserts</li>
-
-</ul>
-
-<h2>Changes</h2>
-
-<ul>
-<li>Removed support for the GL_ATI_envmap_bumpmap extension</li>
-<li>The hacky --enable-32/64-bit is no longer available in configure. To build
-32/64 bit mesa refer to the default method recommended by your distribution</li>
-</li>The environment variable GALLIUM_MSAA that forced a multisample GLX visual was removed.</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.4.1.html

@@ -1,97 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.4.1 Release Notes / December 29, 2014</h1>
-
-<p>
-Mesa 10.4.1 is a bug fix release which fixes bugs found since the 10.4.0 release.
-</p>
-<p>
-Mesa 10.4.1 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-5311285e791a6bfaa468ad002bd1e1164acb3eaa040b5a1bf958bdb7c27e0a9d  MesaLib-10.4.1.tar.gz
-91e8b71c8aff4cb92022a09a872b1c5d1ae5bfec8c6c84dbc4221333da5bf1ca  MesaLib-10.4.1.tar.bz2
-e09c8135f5a86ecb21182c6f8959aafd39ae2f98858fdf7c0e25df65b5abcdb8  MesaLib-10.4.1.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82585">Bug 82585</a> - geometry shader with optional out variable segfaults</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82991">Bug 82991</a> - Inverted bumpmap in webgl applications</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83908">Bug 83908</a> - [i965] Incorrect icon colors in Steam Big Picture</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Andres Gomez (1):</p>
-<ul>
-  <li>i965/brw_reg: struct constructor now needs explicit negate and abs values.</li>
-</ul>
-
-<p>Cody Northrop (1):</p>
-<ul>
-  <li>i965: Require pixel alignment for GPU copy blit</li>
-</ul>
-
-<p>Emil Velikov (3):</p>
-<ul>
-  <li>docs: Add 10.4 sha256 sums, news item and link release notes</li>
-  <li>Revert "glx/dri3: Request non-vsynced Present for swapinterval zero. (v3)"</li>
-  <li>Update version to 10.4.1</li>
-</ul>
-
-<p>Ian Romanick (2):</p>
-<ul>
-  <li>linker: Wrap access of producer_var with a NULL check</li>
-  <li>linker: Assign varying locations geometry shader inputs for SSO</li>
-</ul>
-
-<p>Mario Kleiner (4):</p>
-<ul>
-  <li>glx/dri3: Fix glXWaitForSbcOML() to handle targetSBC==0 correctly. (v2)</li>
-  <li>glx/dri3: Track separate (ust, msc) for PresentPixmap vs. PresentNotifyMsc (v2)</li>
-  <li>glx/dri3: Request non-vsynced Present for swapinterval zero. (v3)</li>
-  <li>glx/dri3: Don't fail on glXSwapBuffersMscOML(dpy, window, 0, 0, 0) (v2)</li>
-</ul>
-
-<p>Maxence Le Doré (1):</p>
-<ul>
-  <li>glsl: Add gl_MaxViewports to available builtin constants</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.4.2.html

@@ -1,127 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.4.2 Release Notes / January 12, 2015</h1>
-
-<p>
-Mesa 10.4.2 is a bug fix release which fixes bugs found since the 10.4.1 release.
-</p>
-<p>
-Mesa 10.4.2 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-e303e77dd774df0d051b2870b165f98c97084a55980f884731df89c1b56a6146  MesaLib-10.4.2.tar.gz
-08a119937d9f2aa2f66dd5de97baffc2a6e675f549e40e699a31f5485d15327f  MesaLib-10.4.2.tar.bz2
-c2c2921a80a3395824f02bee4572a6a17d6a12a928a3e497618eeea04fb06490  MesaLib-10.4.2.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85529">Bug 85529</a> - Surfaces not drawn in Unvanquished</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87619">Bug 87619</a> - Changes to state such as render targets change fragment shader without marking it dirty.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87658">Bug 87658</a> - [llvmpipe] SEGV in sse2_has_daz on ancient Pentium4-M</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87913">Bug 87913</a> - CPU cacheline size of 0 can be returned by CPUID leaf 0x80000006 in some virtual machines</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Chad Versace (2):</p>
-<ul>
-  <li>i965: Use safer pointer arithmetic in intel_texsubimage_tiled_memcpy()</li>
-  <li>i965: Use safer pointer arithmetic in gather_oa_results()</li>
-</ul>
-
-<p>Dave Airlie (3):</p>
-<ul>
-  <li>Revert "r600g/sb: fix issues cause by GLSL switching to loops for switch"</li>
-  <li>r600g: fix regression since UCMP change</li>
-  <li>r600g/sb: implement r600 gpr index workaround. (v3.1)</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.4.1 release</li>
-  <li>Update version to 10.4.2</li>
-</ul>
-
-<p>Ilia Mirkin (2):</p>
-<ul>
-  <li>nv50,nvc0: set vertex id base to index_bias</li>
-  <li>nv50/ir: fix texture offsets in release builds</li>
-</ul>
-
-<p>Kenneth Graunke (2):</p>
-<ul>
-  <li>i965: Add missing BRW_NEW_*_PROG_DATA to texture/renderbuffer atoms.</li>
-  <li>i965: Fix start/base_vertex_location for &gt;1 prims but !BRW_NEW_VERTICES.</li>
-</ul>
-
-<p>Leonid Shatz (1):</p>
-<ul>
-  <li>gallium/util: make sure cache line size is not zero</li>
-</ul>
-
-<p>Marek Olšák (4):</p>
-<ul>
-  <li>glsl_to_tgsi: fix a bug in copy propagation</li>
-  <li>vbo: ignore primitive restart if FixedIndex is enabled in DrawArrays</li>
-  <li>st/mesa: fix GL_PRIMITIVE_RESTART_FIXED_INDEX</li>
-  <li>radeonsi: fix VertexID for OpenGL</li>
-</ul>
-
-<p>Michel Dänzer (1):</p>
-<ul>
-  <li>radeonsi: Don't modify PA_SC_RASTER_CONFIG register value if rb_mask == 0</li>
-</ul>
-
-<p>Roland Scheidegger (1):</p>
-<ul>
-  <li>gallium/util: fix crash with daz detection on x86</li>
-</ul>
-
-<p>Tiziano Bacocco (1):</p>
-<ul>
-  <li>nv50,nvc0: implement half_pixel_center</li>
-</ul>
-
-<p>Vadim Girlin (1):</p>
-<ul>
-  <li>r600g/sb: fix issues with loops created for switch</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.4.3.html

@@ -1,145 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.4.3 Release Notes / January 24, 2015</h1>
-
-<p>
-Mesa 10.4.3 is a bug fix release which fixes bugs found since the 10.4.2 release.
-</p>
-<p>
-Mesa 10.4.3 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-c53eaafc83d9c6315f63e0904d9954d929b841b0b2be7a328eeb6e14f1376129  MesaLib-10.4.3.tar.gz
-ef6ecc9c2f36c9f78d1662382a69ae961f38f03af3a0c3268e53f351aa1978ad  MesaLib-10.4.3.tar.bz2
-179325fc8ec66529d3b0d0c43ef61a33a44d91daa126c3bbdd1efdfd25a7db1d  MesaLib-10.4.3.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80568">Bug 80568</a> - [gen4] GPU Crash During Google Chrome Operation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85367">Bug 85367</a> - [gen4] GPU hang in glmark-es2</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85696">Bug 85696</a> - r600g+nine: Bioshock shader failure after 7b1c0cbc90d456384b0950ad21faa3c61a6b43ff</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88219">Bug 88219</a> - include/c11/threads_posix.h:197: undefined reference to `pthread_mutex_lock'</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Axel Davy (39):</p>
-<ul>
-  <li>st/nine: Add new texture format strings</li>
-  <li>st/nine: Correctly advertise D3DPMISCCAPS_CLIPTLVERTS</li>
-  <li>st/nine: NineBaseTexture9: fix setting of last_layer</li>
-  <li>st/nine: CubeTexture: fix GetLevelDesc</li>
-  <li>st/nine: Fix crash when deleting non-implicit swapchain</li>
-  <li>st/nine: Return D3DERR_INVALIDCALL when trying to create a texture of bad format</li>
-  <li>st/nine: NineBaseTexture9: update sampler view creation</li>
-  <li>st/nine: Check if srgb format is supported before trying to use it.</li>
-  <li>st/nine: Add ATI1 and ATI2 support</li>
-  <li>st/nine: Rework of boolean constants</li>
-  <li>st/nine: Convert integer constants to floats before storing them when cards don't support integers</li>
-  <li>st/nine: Remove some shader unused code</li>
-  <li>st/nine: Saturate oFog and oPts vs outputs</li>
-  <li>st/nine: Correctly declare NineTranslateInstruction_Mkxn inputs</li>
-  <li>st/nine: Fix typo for M4x4</li>
-  <li>st/nine: Fix POW implementation</li>
-  <li>st/nine: Handle RSQ special cases</li>
-  <li>st/nine: Handle NRM with input of null norm</li>
-  <li>st/nine: Correct LOG on negative values</li>
-  <li>st/nine: Rewrite LOOP implementation, and a0 aL handling</li>
-  <li>st/nine: Fix CND implementation</li>
-  <li>st/nine: Clamp ps 1.X constants</li>
-  <li>st/nine: Fix some fixed function pipeline operation</li>
-  <li>st/nine: Implement TEXCOORD special behaviours</li>
-  <li>st/nine: Fill missing dst and src number for some instructions.</li>
-  <li>st/nine: Fix TEXM3x3 and implement TEXM3x3VSPEC</li>
-  <li>st/nine: implement TEXM3x2DEPTH</li>
-  <li>st/nine: Implement TEXM3x2TEX</li>
-  <li>st/nine: Implement TEXM3x3SPEC</li>
-  <li>st/nine: Implement TEXDEPTH</li>
-  <li>st/nine: Implement TEXDP3</li>
-  <li>st/nine: Implement TEXDP3TEX</li>
-  <li>st/nine: Implement TEXREG2AR, TEXREG2GB and TEXREG2RGB</li>
-  <li>st/nine: Correct rules for relative adressing and constants.</li>
-  <li>st/nine: Remove unused code for ps</li>
-  <li>st/nine: Fix sm3 relative addressing for non-debug build</li>
-  <li>st/nine: Add variables containing the size of the constant buffers</li>
-  <li>st/nine: Allocate the correct size for the user constant buffer</li>
-  <li>st/nine: Allocate vs constbuf buffer for indirect addressing once.</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.4.2 release</li>
-  <li>Update version to 10.4.3</li>
-</ul>
-
-<p>Jason Ekstrand (1):</p>
-<ul>
-  <li>mesa: Fix clamping to -1.0 in snorm_to_float</li>
-</ul>
-
-<p>Jonathan Gray (1):</p>
-<ul>
-  <li>glsl: Link glsl_test with pthreads library.</li>
-</ul>
-
-<p>Jose Fonseca (1):</p>
-<ul>
-  <li>nine: Drop use of TGSI_OPCODE_CND.</li>
-</ul>
-
-<p>Kenneth Graunke (2):</p>
-<ul>
-  <li>i965: Respect the no_8 flag on Gen6, not just Gen7+.</li>
-  <li>i965: Work around mysterious Gen4 GPU hangs with minimal state changes.</li>
-</ul>
-
-<p>Stanislaw Halik (1):</p>
-<ul>
-  <li>st/nine: Hack to generate resource if it doesn't exist when getting view</li>
-</ul>
-
-<p>Xavier Bouchoux (3):</p>
-<ul>
-  <li>st/nine: Additional defines to d3dtypes.h</li>
-  <li>st/nine: Add missing c++ declaration for IDirect3DVolumeTexture9</li>
-  <li>st/nine: Fix D3DRS_POINTSPRITE support</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.4.4.html

@@ -1,100 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.4.4 Release Notes / February 06, 2015</h1>
-
-<p>
-Mesa 10.4.4 is a bug fix release which fixes bugs found since the 10.4.3 release.
-</p>
-<p>
-Mesa 10.4.4 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-5cb427eaf980cb8555953e9928f5797979ed783e277745d5f8cbae8bc5364086  MesaLib-10.4.4.tar.gz
-f18a967e9c4d80e054b2fdff8c130ce6e6d1f8eecfc42c9f354f8628d8b4df1c  MesaLib-10.4.4.tar.bz2
-86baad73b77920c80fe58402a905e7dd17e3ea10ead6ea7d3afdc0a56c860bd7  MesaLib-10.4.4.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88662">Bug 88662</a> - unaligned access to gl_dlist_node</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88930">Bug 88930</a> - [osmesa] osbuffer-&gt;textures should be indexed by attachment type</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Brian Paul (1):</p>
-<ul>
-  <li>mesa: fix display list 8-byte alignment issue</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.4.3 release</li>
-  <li>Update version to 10.4.4</li>
-</ul>
-
-<p>José Fonseca (1):</p>
-<ul>
-  <li>egl: Pass the correct X visual depth to xcb_put_image().</li>
-</ul>
-
-<p>Mario Kleiner (1):</p>
-<ul>
-  <li>glx/dri3: Request non-vsynced Present for swapinterval zero. (v3)</li>
-</ul>
-
-<p>Matt Turner (1):</p>
-<ul>
-  <li>gallium/util: Don't use __builtin_clrsb in util_last_bit().</li>
-</ul>
-
-<p>Niels Ole Salscheider (1):</p>
-<ul>
-  <li>configure: Link against all LLVM targets when building clover</li>
-</ul>
-
-<p>Park, Jeongmin (1):</p>
-<ul>
-  <li>st/osmesa: Fix osbuffer-&gt;textures indexing</li>
-</ul>
-
-<p>Ville Syrjälä (1):</p>
-<ul>
-  <li>i965: Fix max_wm_threads for CHV</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.4.5.html

@@ -1,114 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.4.5 Release Notes / February 21, 2015</h1>
-
-<p>
-Mesa 10.4.5 is a bug fix release which fixes bugs found since the 10.4.4 release.
-</p>
-<p>
-Mesa 10.4.5 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-e12bbdaee9a758617e8ebd0bb0e987f72addd11db2e4da25ba695e386cd63843  MesaLib-10.4.5.tar.gz
-bf60000700a9d58e3aca2bfeee7e781053b0d839e61a95b1883e05a2dee247a0  MesaLib-10.4.5.tar.bz2
-3b926de8eee500bb67cf85332c51292f826cc539b8636382aadbb8e70c76527a  MesaLib-10.4.5.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82477">Bug 82477</a> - [softpipe] piglit fp-long-alu regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88658">Bug 88658</a> - (bisected) Slow video playback on Kabini</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89069">Bug 89069</a> - Lack of grass in The Talos Principle on radeonsi (native\wine\nine)</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Carl Worth (1):</p>
-<ul>
-  <li>Revert use of Mesa IR optimizer for ARB_fragment_programs</li>
-</ul>
-
-<p>Emil Velikov (3):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.4.4 release</li>
-  <li>get-pick-list.sh: Require explicit "10.4" for nominating stable patches</li>
-  <li>Update version to 10.4.5</li>
-</ul>
-
-<p>Ilia Mirkin (3):</p>
-<ul>
-  <li>nvc0: bail out of 2d blits with non-A8_UNORM alpha formats</li>
-  <li>st/mesa: treat resource-less xfb buffers as if they weren't there</li>
-  <li>nvc0: allow holes in xfb target lists</li>
-</ul>
-
-<p>Jeremy Huddleston Sequoia (2):</p>
-<ul>
-  <li>darwin: build fix</li>
-  <li>darwin: build fix</li>
-</ul>
-
-<p>Kenneth Graunke (4):</p>
-<ul>
-  <li>i965: Override swizzles for integer luminance formats.</li>
-  <li>i965: Use a gl_color_union for sampler border color.</li>
-  <li>i965: Fix integer border color on Haswell.</li>
-  <li>glsl: Reduce memory consumption of copy propagation passes.</li>
-</ul>
-
-<p>Laura Ekstrand (1):</p>
-<ul>
-  <li>main: Fixed _mesa_GetCompressedTexImage_sw to copy slices correctly.</li>
-</ul>
-
-<p>Marek Olšák (5):</p>
-<ul>
-  <li>r600g,radeonsi: don't append to streamout buffers that haven't been used yet</li>
-  <li>radeonsi: fix instanced arrays with non-zero start instance</li>
-  <li>radeonsi: small fix in SPI state</li>
-  <li>mesa: fix AtomicBuffer typo in _mesa_DeleteBuffers</li>
-  <li>radeonsi: fix a crash if a stencil ref state is set before a DSA state</li>
-</ul>
-
-<p>Michel Dänzer (2):</p>
-<ul>
-  <li>st/mesa: Don't use PIPE_USAGE_STREAM for GL_PIXEL_UNPACK_BUFFER_ARB</li>
-  <li>Revert "radeon/llvm: enable unsafe math for graphics shaders"</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.4.6.html

@@ -1,143 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.4.6 Release Notes / March 06, 2015</h1>
-
-<p>
-Mesa 10.4.6 is a bug fix release which fixes bugs found since the 10.4.5 release.
-</p>
-<p>
-Mesa 10.4.6 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-46c9082142e811c01e49a2c332a9ac0a1eb98f2908985fb9df216539d7eaeaf4  MesaLib-10.4.6.tar.gz
-d8baedd20e79ccd98a5a7b05e23d59a30892e68de1fcc057ca6873dafca02735  MesaLib-10.4.6.tar.bz2
-6aded6eac7f0d4d55117b8b581d8424710bbb4c768fc90f7b881f29311a751aa  MesaLib-10.4.6.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=45348">Bug 45348</a> - [swrast] piglit fbo-drawbuffers-arbfp regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84613">Bug 84613</a> - [G965, bisected] piglit regressions : glslparsertest.glsl2</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87516">Bug 87516</a> - glProgramBinary violates spec</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88885">Bug 88885</a> - Transform feedback uses incorrect interleaving if a previous draw did not write gl_Position</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89180">Bug 89180</a> - [IVB regression] Rendering issues in Mass Effect through VMware Workstation</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Abdiel Janulgue (2):</p>
-<ul>
-  <li>glsl: Don't optimize min/max into saturate when EmitNoSat is set</li>
-  <li>st/mesa: For vertex shaders, don't emit saturate when SM 3.0 is unsupported</li>
-</ul>
-
-<p>Andreas Boll (1):</p>
-<ul>
-  <li>glx: Fix returned values of GLX_RENDERER_PREFERRED_PROFILE_MESA</li>
-</ul>
-
-<p>Brian Paul (2):</p>
-<ul>
-  <li>swrast: fix multiple color buffer writing</li>
-  <li>st/mesa: fix sampler view reference counting bug in glDraw/CopyPixels</li>
-</ul>
-
-<p>Chris Forbes (1):</p>
-<ul>
-  <li>i965/gs: Check newly-generated GS-out VUE map against correct stage</li>
-</ul>
-
-<p>Eduardo Lima Mitev (1):</p>
-<ul>
-  <li>mesa: Fix error validating args for TexSubImage3D</li>
-</ul>
-
-<p>Emil Velikov (6):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.4.5 release</li>
-  <li>install-lib-links: remove the .install-lib-links file</li>
-  <li>Revert "mesa: Correct backwards NULL check."</li>
-  <li>mesa: cherry-pick the second half of commit 2aa71e9485a</li>
-  <li>Revert "gallivm: Update for RTDyldMemoryManager becoming an unique_ptr."</li>
-  <li>Update version to 10.4.6</li>
-</ul>
-
-<p>Ian Romanick (3):</p>
-<ul>
-  <li>mesa: Add missing error checks in _mesa_ProgramBinary</li>
-  <li>mesa: Ensure that length is set to zero in _mesa_GetProgramBinary</li>
-  <li>mesa: Always generate GL_INVALID_OPERATION in _mesa_GetProgramBinary</li>
-</ul>
-
-<p>Jonathan Gray (1):</p>
-<ul>
-  <li>auxilary/os: correct sysctl use in os_get_total_physical_memory()</li>
-</ul>
-
-<p>José Fonseca (1):</p>
-<ul>
-  <li>gallivm: Update for RTDyldMemoryManager becoming an unique_ptr.</li>
-</ul>
-
-<p>Leo Liu (1):</p>
-<ul>
-  <li>st/omx/dec/h264: fix picture out-of-order with poc type 0 v2</li>
-</ul>
-
-<p>Lucas Stach (1):</p>
-<ul>
-  <li>install-lib-links: don't depend on .libs directory</li>
-</ul>
-
-<p>Marek Olšák (2):</p>
-<ul>
-  <li>vbo: fix an unitialized-variable warning</li>
-  <li>radeonsi: fix point sprites</li>
-</ul>
-
-<p>Matt Turner (4):</p>
-<ul>
-  <li>glsl: Rewrite and fix min/max to saturate optimization.</li>
-  <li>mesa: Correct backwards NULL check.</li>
-  <li>i965/fs: Don't use backend_visitor::instructions after creating the CFG.</li>
-  <li>mesa: Correct backwards NULL check.</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.4.7.html

@@ -1,134 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.4.7 Release Notes / March 20, 2015</h1>
-
-<p>
-Mesa 10.4.7 is a bug fix release which fixes bugs found since the 10.4.6 release.
-</p>
-<p>
-Mesa 10.4.7 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-<h2>SHA256 checksums</h2>
-<pre>
-9e7b59267199658808f8b33e0410b86fbafbdcd52378658b9df65fac9d24947f  MesaLib-10.4.7.tar.gz
-2c351c98671f9a7ab3fd9c601bb7a255801b1580f5dd0992639f99152801b0d2  MesaLib-10.4.7.tar.bz2
-d14ac578b5ce16560757b53fbd1cb4d6b34652f8e110e4b10a019adc82e67ffd  MesaLib-10.4.7.zip
-</pre>
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79202">Bug 79202</a> - valgrind errors in glsl-fs-uniform-array-loop-unroll.shader_test; random code generation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89156">Bug 89156</a> - r300g: GL_COMPRESSED_RED_RGTC1 / ATI1N support broken</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89224">Bug 89224</a> - Incorrect rendering of Unigine Valley running in VM on VMware Workstation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89530">Bug 89530</a> - FTBFS in loader: missing fstat</li>
-
-</ul>
-
-<h2>Changes</h2>
-
-<p>Andrey Sudnik (1):</p>
-<ul>
-  <li>i965/vec4: Don't lose the saturate modifier in copy propagation.</li>
-</ul>
-
-<p>Daniel Stone (1):</p>
-<ul>
-  <li>egl: Take alpha bits into account when selecting GBM formats</li>
-</ul>
-
-<p>Emil Velikov (6):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.4.6 release</li>
-  <li>cherry-ignore: add not applicable/rejected commits</li>
-  <li>mesa: rename format_info.c to format_info.h</li>
-  <li>loader: include &lt;sys/stat.h&gt; for non-sysfs builds</li>
-  <li>auxiliary/os: fix the android build - s/drm_munmap/os_munmap/</li>
-  <li>Update version to 10.4.7</li>
-</ul>
-
-<p>Iago Toral Quiroga (1):</p>
-<ul>
-  <li>i965: Fix out-of-bounds accesses into pull_constant_loc array</li>
-</ul>
-
-<p>Ilia Mirkin (4):</p>
-<ul>
-  <li>freedreno: move fb state copy after checking for size change</li>
-  <li>freedreno/ir3: fix array count returned by TXQ</li>
-  <li>freedreno/ir3: get the # of miplevels from getinfo</li>
-  <li>freedreno: fix slice pitch calculations</li>
-</ul>
-
-<p>Marc-Andre Lureau (1):</p>
-<ul>
-  <li>gallium/auxiliary/indices: fix start param</li>
-</ul>
-
-<p>Marek Olšák (4):</p>
-<ul>
-  <li>r300g: fix RGTC1 and LATC1 SNORM formats</li>
-  <li>r300g: fix a crash when resolving into an sRGB texture</li>
-  <li>r300g: fix sRGB-&gt;sRGB blits</li>
-  <li>radeonsi: increase coords array size for radeon_llvm_emit_prepare_cube_coords</li>
-</ul>
-
-<p>Mario Kleiner (1):</p>
-<ul>
-  <li>glx: Handle out-of-sequence swap completion events correctly. (v2)</li>
-</ul>
-
-<p>Matt Turner (2):</p>
-<ul>
-  <li>r300g: Use PATH_MAX instead of limiting ourselves to 100 chars.</li>
-  <li>r300g: Check return value of snprintf().</li>
-</ul>
-
-<p>Rob Clark (2):</p>
-<ul>
-  <li>freedreno/ir3: fix silly typo for binning pass shaders</li>
-  <li>freedreno: update generated headers</li>
-</ul>
-
-<p>Samuel Iglesias Gonsalvez (1):</p>
-<ul>
-  <li>glsl: optimize (0 cmp x + y) into (-x cmp y).</li>
-</ul>
-
-<p>Stefan Dösinger (1):</p>
-<ul>
-  <li>r300g: Fix the ATI1N swizzle (RGTC1 and LATC1)</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.4.html

@@ -1,259 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.4 Release Notes / December 14, 2014</h1>
-
-<p>
-Mesa 10.4 is a new development release.
-People who are concerned with stability and reliability should stick
-with a previous release or wait for Mesa 10.4.1.
-</p>
-<p>
-Mesa 10.4 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-abfbfd2d91ce81491c5bb6923ae649212ad5f82d0bee277de8704cc948dc221e  MesaLib-10.4.0.tar.gz
-98a7dff3a1a6708c79789de8b9a05d8042e867067f70e8f30387c15026233219  MesaLib-10.4.0.tar.bz2
-443a6d46d0691b5ac811d8d30091b1716c365689b16d49c57cf273c2b76086fe  MesaLib-10.4.0.zip
-</pre>
-
-
-<h2>New features</h2>
-
-<p>
-Note: some of the new features are only available with certain drivers.
-</p>
-
-<ul>
-<li>GL_ARB_conditional_render_inverted on nv50</li>
-<li>GL_ARB_sample_shading on r600</li>
-<li>GL_ARB_texture_view on nv50, nvc0</li>
-<li>GL_ARB_clip_control on nv50, nvc0, r300, r600, radeonsi, llvmpipe, softpipe</li>
-<li>GL_KHR_context_flush_control on all drivers</li>
-</ul>
-
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79963">Bug 79963</a> - [ILK Bisected]some piglit and ogles2conform cases fail </li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=29661">Bug 29661</a> - MSVC built u_format_test fails on Windows</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=38873">Bug 38873</a> - [855gm] gnome-shell misrendered</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=54372">Bug 54372</a> - GLX_INTEL_swap_event crashes driver when swapping window buffers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=60879">Bug 60879</a> - [radeonsi] X11 can't start with acceleration enabled</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=61415">Bug 61415</a> - Clover ignores --with-opencl-libdir path</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=64471">Bug 64471</a> - Radeon HD6570 lockup in Brütal Legend with HyperZ</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=66184">Bug 66184</a> - src/mesa/state_tracker/st_glsl_to_tgsi.cpp:3216:simplify_cmp: Assertion `inst-&gt;dst.index &lt; 4096' failed.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=67672">Bug 67672</a> - [llvmpipe] lp_test_arit fails on old CPUs</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=69200">Bug 69200</a> - [Bisected]Piglit glx/glx-multithread-shader-compile aborted</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=70410">Bug 70410</a> - egl-static/Makefile: linking fails with llvm &gt;= 3.4</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=72685">Bug 72685</a> - [radeonsi hyperz] Artifacts in Unigine Sanctuary</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=72819">Bug 72819</a> - [855GM] Incorrect drop shadow color on windows and strange white rectangle when showing/hiding GLX-dock...</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=74563">Bug 74563</a> - Surfaceless contexts are not properly released by DRI drivers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=74863">Bug 74863</a> - [r600g] HyperZ broken on RV770 and CYPRESS (Left 4 Dead 2 trees corruption) bisected!</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=75011">Bug 75011</a> - [hyperz] Performance drop since git-01e6371 (disable hyperz by default) with radeonsi</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=75112">Bug 75112</a> - Meta Bug for HyperZ issues on r600g and radeonsi</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76252">Bug 76252</a> - Dynamic loading/unloading of opengl32.dll results in a deadlock</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=76861">Bug 76861</a> - mid3 generates slow code for constant arguments</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77957">Bug 77957</a> - Variably-indexed constant arrays result in terrible shader code</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78468">Bug 78468</a> - Compiling of shader gets stuck in infinite loop</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78770">Bug 78770</a> - [SNB bisected]Webglc conformance/textures/texture-size-limit.html fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79155">Bug 79155</a> - [Tesseract Game] Global Illumination: Medium Causes Color Distortion</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79462">Bug 79462</a> - [NVC0/Codegen] Shader compilation falis in spill logic</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80011">Bug 80011</a> - [softpipe] tgsi/tgsi_exec.c:2023:exec_txf: Assertion `0' failed.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80012">Bug 80012</a> - [softpipe] draw/draw_gs.c:113:tgsi_fetch_gs_outputs: Assertion `!util_is_inf_or_nan(output[slot][0])' failed.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80050">Bug 80050</a> - [855GM] Incorrect drop shadow color under windows in Cinnamon persists with MESA 10.1.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80247">Bug 80247</a> - Khronos conformance test  ES3-CTS.gtf.GL3Tests.transform_feedback.transform_feedback_vertex_id  fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80561">Bug 80561</a> - Incorrect implementation of some VDPAU APIs.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80615">Bug 80615</a> - Files in bellagio directory [omx tracker] don't respect installation folder</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80848">Bug 80848</a> - [dri3] Building mesa fails with dri3 enabled</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81680">Bug 81680</a> - [r600g] Firefox crashes with hardware acceleration turned on</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82255">Bug 82255</a> - [VP2] Chroma planes are vertically stretched during VDPAU playback</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82472">Bug 82472</a> - piglit 16385-consecutive-chars regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82537">Bug 82537</a> - Stunt Rally GLSL compiler assertion failure</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82538">Bug 82538</a> - Super Maryo Chronicles fails with st/mesa assertion failure</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82539">Bug 82539</a> - vmw_screen_dri.lo In file included from vmw_screen_dri.c:41: vmwgfx_drm.h:32:17: error: drm.h: No such file or directory</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82796">Bug 82796</a> - [IVB/BYT-M/HSW/BDW Bisected]Synmark2_v6.0_OglTerrainFlyInst/OglTerrainPanInst cannot run as image validation failed</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82804">Bug 82804</a> - unreal engine 4 rendering errors</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82828">Bug 82828</a> - Regression: Crash in 3Dmark2001</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82846">Bug 82846</a> - [BDW Bisected] Gpu hang when running Lightsmark v2008/Warsow v1.0/Xonotic v0.7/unigine-demos</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82881">Bug 82881</a> - test_vec4_register_coalesce regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82882">Bug 82882</a> - [swrast] piglit glsl-fs-uniform-bool-1 regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82921">Bug 82921</a> - layout(location=0) emits error &gt;= MAX_UNIFORM_LOCATIONS due to integer underflow</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82929">Bug 82929</a> - [BDW Bisected]glxgears causes X hang</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82932">Bug 82932</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.shaders.indexing.vector_subscript.vec3_static_loop_subscript_write_direct_read_vertex fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83079">Bug 83079</a> - [NVC0] Dota 2 (Linux native and Wine) crash with Nouveau Drivers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83080">Bug 83080</a> - [SNB+ Bisected]ES3-CTS.shaders.loops.do_while_constant_iterations.mixed_break_continue_fragment fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83081">Bug 83081</a> - [BDW Bisected]Piglit spec_ARB_sample_shading_builtin-gl-sample-mask_2 is core dumped</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83127">Bug 83127</a> - [ILK Bisected]Piglit glean_texCombine fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83148">Bug 83148</a> - Unity invisible under Ubuntu 14.04 and 14.10</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83355">Bug 83355</a> - FTBFS: src/mesa/program/program_lexer.l:122:64: error: unknown type name 'YYSTYPE'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83380">Bug 83380</a> - Linking fails when not writing gl_Position.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83418">Bug 83418</a> - EU IV is incorrectly rendered after git1409011930.d571f2</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83432">Bug 83432</a> - r600_query.c:269:r600_emit_query_end: Assertion `ctx-&gt;num_pipelinestat_queries &gt; 0' failed [Gallium HUD]</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83463">Bug 83463</a> - [swrast] piglit glsl-vs-clamp-1 regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83468">Bug 83468</a> - [UBO] Using bool from UBO as if-statement condition asserts</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83500">Bug 83500</a> - si_dma_copy_tile causes GPU hangs</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83506">Bug 83506</a> - [UBO] row_major layout ignored inside structures</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83533">Bug 83533</a> - [UBO] nested structures don't get appropriate padding</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83573">Bug 83573</a> - [swrast] piglit fs-op-not-bool-using-if regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83574">Bug 83574</a> - [llvmpipe] [softpipe] piglit arb_explicit_uniform_location-use-of-unused-loc regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83741">Bug 83741</a> - [UBO] row_major layout partially ignored for arrays of structures</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83777">Bug 83777</a> - [regression] ilo fails to build</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83934">Bug 83934</a> - Structures must have same name to be considered same type.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84140">Bug 84140</a> - mplayer crashes playing some files using vdpau output</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84145">Bug 84145</a> - UE4: Realistic Rendering Demo render blue</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84178">Bug 84178</a> - Big glamor regression in Xorg server 1.6.99.1 GIT: x11perf 1.5 Test: PutImage XY 500x500 Square</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84355">Bug 84355</a> - texture2DProjLod and textureCubeLod are not supported when using GLES.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84529">Bug 84529</a> - [IVB bisected] glean fragProg1 CMP test failed</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84538">Bug 84538</a> - lp_test_format.c:226:4: error: too few arguments to function ‘gallivm_create’</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84539">Bug 84539</a> - brw_fs_register_coalesce.cpp:183: bool fs_visitor::register_coalesce(): Assertion `src_size &lt;= 11' failed.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84557">Bug 84557</a> - [HSW] &quot;Emit ELSE/ENDIF JIP with type D on Gen 7&quot; causes Atomic Afterlife and GPU hangs</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84651">Bug 84651</a> - Distorted graphics or black window when running Battle.net app on Intel hardware via wine</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84662">Bug 84662</a> - Long pauses with Unreal demo Elemental on R9270X since : Always flush the HDP cache before submitting a CS to the GPU</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84777">Bug 84777</a> - [BSW]Piglit spec_glsl-1.50_execution_geometry-basic fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84807">Bug 84807</a> - Build issue starting between bf4aecfb2acc8d0dc815105d2f36eccbc97c284b and a3e9582f09249ad27716ba82c7dfcee685b65d51</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85189">Bug 85189</a> - llvm/invocation.cpp: In function 'void {anonymous}::optimize(llvm::Module*, unsigned int, const std::vector&lt;llvm::Function*&gt;&amp;)': llvm/invocation.cpp:324:18: error: expected type-specifier</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85267">Bug 85267</a> - vlc crashes with vdpau (Radeon 3850HD) [r600]</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85377">Bug 85377</a> - lp_test_format failure with llvm-3.6</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85425">Bug 85425</a> - [bisected] Compiler error in clip control operations in meta</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85429">Bug 85429</a> - indirect.c:296: multiple definition of `__indirect_glNewList'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85454">Bug 85454</a> - Unigine Sanctuary with Wine crashes on Mesa Git</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85647">Bug 85647</a> - Random radeonsi crashes with mesa 10.3.x</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85683">Bug 85683</a> - [i965 Bisected]Piglit shaders_glsl-vs-raytrace-bug26691 segfault</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85691">Bug 85691</a> - 'glsl: Drop constant 0.0 components from dot products.' broke piglit shaders/glsl-gnome-shell-dim-window and a few others with Gallium</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86025">Bug 86025</a> - src\glsl\list.h(535) : error C2143: syntax error : missing ';' before 'type'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86089">Bug 86089</a> - [r600g][mesa 10.4.0-dev] shader failure - r600_sb::bc_finalizer::cf_peephole() when starting Second Life</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86145">Bug 86145</a> - Pipeline statistic counter values for VF always 0</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86618">Bug 86618</a> - [NV96] neg modifiers not working in MIN and MAX operations</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86760">Bug 86760</a> - mesa doesn't build: recipe for target 'r600_llvm.lo' failed</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86764">Bug 86764</a> - [SNB+ Bisected]Piglit glean/pointSprite fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86788">Bug 86788</a> - (bisected) 32bit UrbanTerror 4.1 timedemo sse4.1 segfault...</li>
-
-</ul>
-
-<h2>Changes</h2>
-
-<ul>
-<li>The environment variable GALLIUM_MSAA that forced a multisample GLX visual was removed.</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.5.0.html

@@ -1,212 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.5.0 Release Notes / March 06, 2015</h1>
-
-<p>
-Mesa 10.5.0 is a new development release.
-People who are concerned with stability and reliability should stick
-with a previous release or wait for Mesa 10.5.1.
-</p>
-<p>
-Mesa 10.5.0 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-2bb6e2e982ee4d8264d52d638c2a4e3f8a164190336d72d4e34ae1304d87ed91  mesa-10.5.0.tar.gz
-d7ca9f9044bbdd674377e3eebceef1fae339c8817b9aa435c2053e4fea44e5d3  mesa-10.5.0.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-
-<p>
-Note: some of the new features are only available with certain drivers.
-</p>
-
-<ul>
-<li>GL_ARB_framebuffer_sRGB on freedreno</li>
-<li>GL_ARB_texture_rg on freedreno</li>
-<li>GL_EXT_packed_float on freedreno</li>
-<li>GL_EXT_polygon_offset_clamp on i965, nv50, nvc0, r600, radeonsi, llvmpipe</li>
-<li>GL_EXT_texture_shared_exponent on freedreno</li>
-<li>GL_EXT_texture_snorm on freedreno</li>
-</ul>
-
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=10370">Bug 10370</a> - Incorrect pixels read back if draw bitmap texture through Display list</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=45348">Bug 45348</a> - [swrast] piglit fbo-drawbuffers-arbfp regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=60879">Bug 60879</a> - [radeonsi] X11 can't start with acceleration enabled</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=67672">Bug 67672</a> - [llvmpipe] lp_test_arit fails on old CPUs</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=77544">Bug 77544</a> - i965: Try to use LINE instructions to perform MAD with immediate arguments</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=78770">Bug 78770</a> - [SNB bisected]Webglc conformance/textures/texture-size-limit.html fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80568">Bug 80568</a> - [gen4] GPU Crash During Google Chrome Operation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82477">Bug 82477</a> - [softpipe] piglit fp-long-alu regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82585">Bug 82585</a> - geometry shader with optional out variable segfaults</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82991">Bug 82991</a> - Inverted bumpmap in webgl applications</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83463">Bug 83463</a> - [swrast] piglit glsl-vs-clamp-1 regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83500">Bug 83500</a> - si_dma_copy_tile causes GPU hangs</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83510">Bug 83510</a> - Graphical glitches in Unreal Engine 4</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83908">Bug 83908</a> - [i965] Incorrect icon colors in Steam Big Picture</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84212">Bug 84212</a> - [BSW]ES3-CTS.shaders.loops.do_while_dynamic_iterations.vector_counter_vertex fails and causes GPU hang</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84651">Bug 84651</a> - Distorted graphics or black window when running Battle.net app on Intel hardware via wine</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84777">Bug 84777</a> - [BSW]Piglit spec_glsl-1.50_execution_geometry-basic fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85367">Bug 85367</a> - [gen4] GPU hang in glmark-es2</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85467">Bug 85467</a> - [llvmpipe] piglit gl-1.0-dlist-beginend failure with llvm-3.6.0svn</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85529">Bug 85529</a> - Surfaces not drawn in Unvanquished</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85647">Bug 85647</a> - Random radeonsi crashes with mesa 10.3.x</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85696">Bug 85696</a> - r600g+nine: Bioshock shader failure after 7b1c0cbc90d456384b0950ad21faa3c61a6b43ff</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86089">Bug 86089</a> - [r600g][mesa 10.4.0-dev] shader failure - r600_sb::bc_finalizer::cf_peephole() when starting Second Life</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86618">Bug 86618</a> - [NV96] neg modifiers not working in MIN and MAX operations</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86760">Bug 86760</a> - mesa doesn't build: recipe for target 'r600_llvm.lo' failed</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86764">Bug 86764</a> - [SNB+ Bisected]Piglit glean/pointSprite fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86788">Bug 86788</a> - (bisected) 32bit UrbanTerror 4.1 timedemo sse4.1 segfault...</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86811">Bug 86811</a> - [BDW/BSW Bisected]Piglit spec_arb_shading_language_packing_execution_built-in-functions_vs-unpackSnorm4x8 fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86837">Bug 86837</a> - kodi segfault since auxiliary/vl: rework the build of the VL code</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86939">Bug 86939</a> - test_vf_float_conversions.cpp:63:12: error: expected primary-expression before ‘union’</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86944">Bug 86944</a> - glsl_parser_extras.cpp&quot;, line 1455: Error: Badly formed expression. (Oracle Studio)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86958">Bug 86958</a> - lp_bld_misc.cpp:503:40: error: no matching function for call to ‘llvm::EngineBuilder::setMCJITMemoryManager(ShaderMemoryManager*&amp;)’</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86969">Bug 86969</a> - _drm_intel_gem_bo_references() function takes half the CPU with Witcher2 game</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87076">Bug 87076</a> - Dead Island needs allow_glsl_extension_directive_midshader</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87516">Bug 87516</a> - glProgramBinary violates spec</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87619">Bug 87619</a> - Changes to state such as render targets change fragment shader without marking it dirty.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87658">Bug 87658</a> - [llvmpipe] SEGV in sse2_has_daz on ancient Pentium4-M</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87694">Bug 87694</a> - [SNB] Crash in brw_begin_transform_feedback</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87886">Bug 87886</a> - constant fps drops with Intel and Radeon</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87887">Bug 87887</a> - [i965 Bisected]ES2-CTS.gtf.GL.cos.cos_float_vert_xvary fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87913">Bug 87913</a> - CPU cacheline size of 0 can be returned by CPUID leaf 0x80000006 in some virtual machines</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88079">Bug 88079</a> - dEQP-GLES3.functional.fbo.completeness.renderable.renderbuffer.color0 tests fail due to enabling of GL_RGB and GL_RGBA</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88170">Bug 88170</a> - 32 bits opengl apps crash with latest llvm 3.6 git / mesa git / radeonsi</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88219">Bug 88219</a> - include/c11/threads_posix.h:197: undefined reference to `pthread_mutex_lock'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88227">Bug 88227</a> - Radeonsi: High GTT usage in Prison Architect large map</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88248">Bug 88248</a> - Calling glClear while there is an occlusion query in progress messes up the results</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88335">Bug 88335</a> - format_pack.c:9567:22: error: expected ')'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88385">Bug 88385</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.gtf.GL3Tests.packed_pixels.packed_pixels core dumped</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88467">Bug 88467</a> - nir.c:140: error: ‘nir_src’ has no member named ‘ssa’</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88478">Bug 88478</a> - #error &quot;&lt;malloc.h&gt; has been replaced by &lt;stdlib.h&gt;&quot;</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88519">Bug 88519</a> - sha1.c:210:22: error: 'grcy_md_hd_t' undeclared (first use in this function)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88523">Bug 88523</a> - sha1.c:37: error: 'SHA1_CTX' undeclared (first use in this function)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88561">Bug 88561</a> - [radeonsi][regression,bisected] Depth test/buffer issues in Portal</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88658">Bug 88658</a> - (bisected) Slow video playback on Kabini</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88662">Bug 88662</a> - unaligned access to gl_dlist_node</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88783">Bug 88783</a> - FTBFS: Clover: src/gallium/state_trackers/clover/llvm/invocation.cpp:335:49: error: no matching function for call to 'llvm::TargetLibraryInfo::TargetLibraryInfo(llvm::Triple)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88792">Bug 88792</a> - [BDW/BSW Bisected]Piglit spec_ARB_pixel_buffer_object_pbo-read-argb8888 fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88806">Bug 88806</a> - nir/nir_constant_expressions.c:2754:15: error: controlling expression type 'unsigned int' not compatible with any generic association type</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88841">Bug 88841</a> - [SNB/IVB/HSW/BDW Bisected]Piglit spec_EGL_NOK_texture_from_pixmap_basic fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88852">Bug 88852</a> - macros.h(181) : error C2143: syntax error : missing '{' before 'enum [tag]'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88905">Bug 88905</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.gtf.GL3Tests.packed_pixels.packed_pixels fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88930">Bug 88930</a> - [osmesa] osbuffer-&gt;textures should be indexed by attachment type</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88962">Bug 88962</a> - [osmesa] Crash on postprocessing if z buffer is NULL</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89032">Bug 89032</a> - [BDW/BSW/SKL Bisected]Piglit spec_OpenGL_1.1_infinite-spot-light fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89037">Bug 89037</a> - [SKL]Piglit spec_EXT_texture_array_copyteximage_1D_ARRAY_samples=2 sporadically causes GPU hang</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89068">Bug 89068</a> - glTexImage2D regression by texstore_rgba switch to _mesa_format_convert</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89069">Bug 89069</a> - Lack of grass in The Talos Principle on radeonsi (native\wine\nine)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89180">Bug 89180</a> - [IVB regression] Rendering issues in Mass Effect through VMware Workstation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86330">Bug 86330</a> - lp_bld_debug.cpp:112: multiple definition of `raw_debug_ostream::write_impl(char const*, unsigned long)'</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<ul>
-<li>Removed support for GCC versions earlier than 4.2.0.</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.5.1.html

@@ -1,217 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.5.1 Release Notes / March 13, 2015</h1>
-
-<p>
-Mesa 10.5.1 is a bug fix release which fixes bugs found since the 10.5.0 release.
-</p>
-<p>
-Mesa 10.5.1 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-b5b6256a6d46023e16a675257fd11a0f94d7b3e60a76cf112952da3d0fef8e9b  mesa-10.5.1.tar.gz
-ffc51943d15c6812ee7611d053d8980a683fbd6a4986cff567b12cc66637d679  mesa-10.5.1.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79202">Bug 79202</a> - valgrind errors in glsl-fs-uniform-array-loop-unroll.shader_test; random code generation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84613">Bug 84613</a> - [G965, bisected] piglit regressions : glslparsertest.glsl2</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86747">Bug 86747</a> - Noise in Football Manager 2014 textures</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86974">Bug 86974</a> - INTEL_DEBUG=shader_time always asserts in fs_generator::generate_code() when Mesa is built with --enable-debug (= with asserts)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88246">Bug 88246</a> - Commit 2881b12 causes 43 DrawElements test regressions</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88793">Bug 88793</a> - [BDW/BSW Bisected]Piglit/shaders_glsl-max-varyings fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88883">Bug 88883</a> - ir-a2xx.c: variable changed in assert statement</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88885">Bug 88885</a> - Transform feedback uses incorrect interleaving if a previous draw did not write gl_Position</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89095">Bug 89095</a> - [SNB/IVB/BYT Bisected]Webglc conformance/glsl/functions/glsl-function-mix-float.html fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89156">Bug 89156</a> - r300g: GL_COMPRESSED_RED_RGTC1 / ATI1N support broken</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89224">Bug 89224</a> - Incorrect rendering of Unigine Valley running in VM on VMware Workstation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89292">Bug 89292</a> - [regression,bisected] incomplete screenshots in some cases</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89311">Bug 89311</a> - [regression, bisected] dEQP: Added entry points for glCompressedTextureSubImage*D.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89312">Bug 89312</a> - [regression, bisected] main: Added entry points for CopyTextureSubImage*D. (d6b7c40cecfe01)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89315">Bug 89315</a> - [HSW, regression, bisected] i965/fs: Emit MAD instructions when possible.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89317">Bug 89317</a> - [HSW, regression, bisected] i965: Add LINTERP/CINTERP to can_do_cmod() (d91390634)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89416">Bug 89416</a> - UE4Editor crash after load project</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89430">Bug 89430</a> - [g965][bisected] arb_copy_image-targets gl_texture* tests fail</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Andrey Sudnik (1):</p>
-<ul>
-  <li>i965/vec4: Don't lose the saturate modifier in copy propagation.</li>
-</ul>
-
-<p>Chris Forbes (1):</p>
-<ul>
-  <li>i965/gs: Check newly-generated GS-out VUE map against correct stage</li>
-</ul>
-
-<p>Daniel Stone (1):</p>
-<ul>
-  <li>egl: Take alpha bits into account when selecting GBM formats</li>
-</ul>
-
-<p>Emil Velikov (5):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.5.0 release</li>
-  <li>egl/main: no longer export internal function</li>
-  <li>cherry-ignore: ignore a few more commits picked without -x</li>
-  <li>mapi: fix commit 90411b56f6bc817e229d8801ac0adad6d4e3fb7a</li>
-  <li>Update version to 10.5.1</li>
-</ul>
-
-<p>Frank Henigman (1):</p>
-<ul>
-  <li>intel: fix EGLImage renderbuffer _BaseFormat</li>
-</ul>
-
-<p>Iago Toral Quiroga (1):</p>
-<ul>
-  <li>i965: Fix out-of-bounds accesses into pull_constant_loc array</li>
-</ul>
-
-<p>Ian Romanick (1):</p>
-<ul>
-  <li>i965/fs/nir: Use emit_math for nir_op_fpow</li>
-</ul>
-
-<p>Ilia Mirkin (3):</p>
-<ul>
-  <li>freedreno: move fb state copy after checking for size change</li>
-  <li>freedreno/ir3: fix array count returned by TXQ</li>
-  <li>freedreno/ir3: get the # of miplevels from getinfo</li>
-</ul>
-
-<p>Jason Ekstrand (2):</p>
-<ul>
-  <li>meta/TexSubImage: Stash everything other than PIXEL_TRANSFER/store in meta_begin</li>
-  <li>main/base_tex_format: Properly handle STENCIL_INDEX1/4/16</li>
-</ul>
-
-<p>Kenneth Graunke (8):</p>
-<ul>
-  <li>i965: Split Gen4-5 BlitFramebuffer code; prefer BLT over Meta.</li>
-  <li>glsl: Mark array access when copying to a temporary for the ?: operator.</li>
-  <li>i965/fs: Set force_writemask_all on shader_time instructions.</li>
-  <li>i965/fs: Set smear on shader_time diff register.</li>
-  <li>i965/fs: Make emit_shader_time_write return rather than emit.</li>
-  <li>i965/fs: Make get_timestamp() pass back the MOV rather than emitting it.</li>
-  <li>i965/fs: Make emit_shader_time_end() insert before EOT.</li>
-  <li>i965/fs: Don't issue FB writes for bound but unwritten color targets.</li>
-</ul>
-
-<p>Laura Ekstrand (2):</p>
-<ul>
-  <li>main: Fix target checking for CompressedTexSubImage*D.</li>
-  <li>main: Fix target checking for CopyTexSubImage*D.</li>
-</ul>
-
-<p>Marc-Andre Lureau (1):</p>
-<ul>
-  <li>gallium/auxiliary/indices: fix start param</li>
-</ul>
-
-<p>Marek Olšák (3):</p>
-<ul>
-  <li>r300g: fix RGTC1 and LATC1 SNORM formats</li>
-  <li>r300g: fix a crash when resolving into an sRGB texture</li>
-  <li>r300g: fix sRGB-&gt;sRGB blits</li>
-</ul>
-
-<p>Matt Turner (12):</p>
-<ul>
-  <li>i965/vec4: Fix implementation of i2b.</li>
-  <li>mesa: Indent break statements and add a missing one.</li>
-  <li>mesa: Free memory allocated for luminance in readpixels.</li>
-  <li>mesa: Correct backwards NULL check.</li>
-  <li>i965: Consider scratch writes to have side effects.</li>
-  <li>i965/fs: Don't use backend_visitor::instructions after creating the CFG.</li>
-  <li>r300g: Use PATH_MAX instead of limiting ourselves to 100 chars.</li>
-  <li>r300g: Check return value of snprintf().</li>
-  <li>i965/fs: Don't propagate cmod to inst with different type.</li>
-  <li>i965: Tell intel_get_memcpy() which direction the memcpy() is going.</li>
-  <li>Revert SHA1 additions.</li>
-  <li>i965: Avoid applying negate to wrong MAD source.</li>
-</ul>
-
-<p>Neil Roberts (4):</p>
-<ul>
-  <li>meta: In pbo_{Get,}TexSubImage don't repeatedly rebind the source tex</li>
-  <li>Revert "common: Fix PBOs for 1D_ARRAY."</li>
-  <li>meta: Allow GL_UN/PACK_IMAGE_HEIGHT in _mesa_meta_pbo_Get/TexSubImage</li>
-  <li>meta: Fix the y offset for 1D_ARRAY in _mesa_meta_pbo_TexSubImage</li>
-</ul>
-
-<p>Rob Clark (11):</p>
-<ul>
-  <li>freedreno/ir3: fix silly typo for binning pass shaders</li>
-  <li>freedreno/a2xx: fix increment in assert</li>
-  <li>freedreno/a4xx: bit of cleanup</li>
-  <li>freedreno: update generated headers</li>
-  <li>freedreno/a4xx: set PC_PRIM_VTX_CNTL.VAROUT properly</li>
-  <li>freedreno: update generated headers</li>
-  <li>freedreno/a4xx: aniso filtering</li>
-  <li>freedreno/ir3: fix up cat6 instruction encodings</li>
-  <li>freedreno/ir3: add support for memory (cat6) instructions</li>
-  <li>freedreno/ir3: handle flat bypass for a4xx</li>
-  <li>freedreno/ir3: fix failed assert in grouping</li>
-</ul>
-
-<p>Stefan Dösinger (1):</p>
-<ul>
-  <li>r300g: Fix the ATI1N swizzle (RGTC1 and LATC1)</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.5.2.html

@@ -1,130 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.5.2 Release Notes / March 28, 2015</h1>
-
-<p>
-Mesa 10.5.2 is a bug fix release which fixes bugs found since the 10.5.1 release.
-</p>
-<p>
-Mesa 10.5.2 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-755220e160a9f22fda0dffd47746f997b6e196d03f8edc390df7793aecaaa541  mesa-10.5.2.tar.gz
-2f4b6fb77c3e7d6f861558d0884a3073f575e1e673dad8d1b0624e78e9c4dd44  mesa-10.5.2.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88534">Bug 88534</a> - include/c11/threads_posix.h PTHREAD_MUTEX_RECURSIVE_NP not defined</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89328">Bug 89328</a> - python required to build Mesa release tarballs</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89530">Bug 89530</a> - FTBFS in loader: missing fstat</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89590">Bug 89590</a> - Crash in glLinkProgram with shaders with multiple constant arrays</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89680">Bug 89680</a> - Hard link exist in Mesa 10.5.1 sources</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Anuj Phogat (1):</p>
-<ul>
-  <li>glsl: Generate link error for non-matching gl_FragCoord redeclarations</li>
-</ul>
-
-<p>Emil Velikov (7):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.5.1 release</li>
-  <li>automake: add missing egl files to the tarball</li>
-  <li>st/egl: don't ship the dri2.c link at the tarball</li>
-  <li>loader: include &lt;sys/stat.h&gt; for non-sysfs builds</li>
-  <li>auxiliary/os: fix the android build - s/drm_munmap/os_munmap/</li>
-  <li>cherry-ignore: add commit non applicable for 10.5</li>
-  <li>Update version to 10.5.2</li>
-</ul>
-
-<p>Felix Janda (1):</p>
-<ul>
-  <li>c11/threads: Use PTHREAD_MUTEX_RECURSIVE by default</li>
-</ul>
-
-<p>Francisco Jerez (1):</p>
-<ul>
-  <li>i965: Set nr_params to the number of uniform components in the VS/GS path.</li>
-</ul>
-
-<p>Ilia Mirkin (2):</p>
-<ul>
-  <li>freedreno/a3xx: use the same layer size for all slices</li>
-  <li>freedreno: fix slice pitch calculations</li>
-</ul>
-
-<p>Marek Olšák (1):</p>
-<ul>
-  <li>radeonsi: increase coords array size for radeon_llvm_emit_prepare_cube_coords</li>
-</ul>
-
-<p>Mario Kleiner (2):</p>
-<ul>
-  <li>glx: Handle out-of-sequence swap completion events correctly. (v2)</li>
-  <li>mapi: Make private copies of name strings provided by client.</li>
-</ul>
-
-<p>Rob Clark (1):</p>
-<ul>
-  <li>freedreno: update generated headers</li>
-</ul>
-
-<p>Samuel Iglesias Gonsalvez (2):</p>
-<ul>
-  <li>glsl: optimize (0 cmp x + y) into (-x cmp y).</li>
-  <li>configure: Introduce new output variable to ax_check_python_mako_module.m4</li>
-</ul>
-
-<p>Tapani Pälli (1):</p>
-<ul>
-  <li>glsl: fix names in lower_constant_arrays_to_uniforms</li>
-</ul>
-
-<p>Tom Stellard (1):</p>
-<ul>
-  <li>clover: Return 0 as storage size for local kernel args that are not set v2</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.5.3.html

@@ -1,125 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.5.3 Release Notes / April 12, 2015</h1>
-
-<p>
-Mesa 10.5.3 is a bug fix release which fixes bugs found since the 10.5.2 release.
-</p>
-<p>
-Mesa 10.5.3 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-2371b8e210ccd19f61dd94b6664d612e5a479ba7d431a074512d87633bd6aeb4  mesa-10.5.3.tar.gz
-8701ee1be4f5c03238f5e63c1a9bd4cc03a2f6c0155ed42a1ae7d58f18912ba2  mesa-10.5.3.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83962">Bug 83962</a> - [HSW/BYT]Piglit spec_ARB_gpu_shader5_arb_gpu_shader5-emitstreamvertex_nodraw fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89679">Bug 89679</a> - [NV50] Portal/Half-Life 2 will not start (native Steam)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89746">Bug 89746</a> - Mesa and LLVM 3.6+ break opengl for genymotion</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89754">Bug 89754</a> - vertexAttrib fails WebGL Conformance test with mesa drivers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89758">Bug 89758</a> - pow WebGL Conformance test with mesa drivers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89759">Bug 89759</a> - WebGL OGL ES GLSL conformance test with mesa drivers fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89905">Bug 89905</a> - scons build broken on 10.5.2 due to activated vega st</li>
-
-</ul>
-
-<h2>Changes</h2>
-
-<p>Dave Airlie (1):</p>
-<ul>
-  <li>st_glsl_to_tgsi: only do mov copy propagation on temps (v2)</li>
-</ul>
-
-<p>Emil Velikov (5):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.5.2 release</li>
-  <li>xmlpool: don't forget to ship the MOS</li>
-  <li>configure.ac: error out if python/mako is not found when required</li>
-  <li>dist: add the VG depedencies into the tarball</li>
-  <li>Update version to 10.5.3</li>
-</ul>
-
-<p>Iago Toral Quiroga (1):</p>
-<ul>
-  <li>i965: Do not render primitives in non-zero streams then TF is disabled</li>
-</ul>
-
-<p>Ilia Mirkin (7):</p>
-<ul>
-  <li>st/mesa: update arrays when the current attrib has been updated</li>
-  <li>nv50/ir: take postFactor into account when doing peephole optimizations</li>
-  <li>nv50/ir/gk110: fix offset flag position for TXD opcode</li>
-  <li>freedreno/a3xx: fix 3d texture layout</li>
-  <li>freedreno/a3xx: point size should not be divided by 2</li>
-  <li>nv50: allocate more offset space for occlusion queries</li>
-  <li>nv50,nvc0: limit the y-tiling of 3d textures to the first level's tiling</li>
-</ul>
-
-<p>Kenneth Graunke (2):</p>
-<ul>
-  <li>i965: Fix instanced geometry shaders on Gen8+.</li>
-  <li>i965: Add forgotten multi-stream code to Gen8 SOL state.</li>
-</ul>
-
-<p>Marcin Ślusarz (1):</p>
-<ul>
-  <li>nouveau: synchronize "scratch runout" destruction with the command stream</li>
-</ul>
-
-<p>Michel Dänzer (1):</p>
-<ul>
-  <li>radeonsi: Cache LLVMTargetMachineRef in context instead of in screen</li>
-</ul>
-
-<p>Tom Stellard (1):</p>
-<ul>
-  <li>clover: Return CL_BUILD_ERROR for CL_PROGRAM_BUILD_STATUS when compilation fails v2</li>
-</ul>
-
-<p>Ville Syrjälä (1):</p>
-<ul>
-  <li>i965: Fix URB size for CHV</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.5.4.html

@@ -1,125 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.5.4 Release Notes / April 24, 2015</h1>
-
-<p>
-Mesa 10.5.4 is a bug fix release which fixes bugs found since the 10.5.3 release.
-</p>
-<p>
-Mesa 10.5.4 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-e1089567fc7bf8d9b2d8badcc9f2fc3b758701c8c0ccfe7af1805549fea53f11  mesa-10.5.4.tar.gz
-b51e723f3a20d842c88a92d809435b229fc4744ca0dbec0317d9d4a3ac4c6803  mesa-10.5.4.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=69226">Bug 69226</a> - Cannot enable basic shaders with Second Life aborts attempt</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=71591">Bug 71591</a> - Second Life shaders fail to compile (extension declared in middle of shader)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81025">Bug 81025</a> - [IVB/BYT Bisected]Piglit spec_ARB_draw_indirect_arb_draw_indirect-draw-elements-prim-restart-ugly fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89457">Bug 89457</a> - [BSW Bisected]ogles3conform ES3-CTS.gtf.GL3Tests.shadow.shadow_execution_vert fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89957">Bug 89957</a> - vm protection faults in piglit lest: texsubimage cube_map_array pbo</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Brian Paul (1):</p>
-<ul>
-  <li>glsl: rewrite glsl_type::record_key_hash() to avoid buffer overflow</li>
-</ul>
-
-<p>Dave Airlie (2):</p>
-<ul>
-  <li>st/mesa: convert sub image for cube map arrays to 2d arrays for upload</li>
-  <li>st/mesa: align cube map arrays layers</li>
-</ul>
-
-<p>Emil Velikov (11):</p>
-<ul>
-  <li>docs: Add 256 sums for the 10.5.3 release</li>
-  <li>radeonsi: remove unused si_dump_key()</li>
-  <li>android: use LOCAL_SHARED_LIBRARIES over TARGET_OUT_HEADERS</li>
-  <li>android: add $(mesa_top)/src include to the whole of mesa</li>
-  <li>android: egl: add libsync_cflags to the build</li>
-  <li>android: dri/common: conditionally include drm_cflags/set __NOT_HAVE_DRM_H</li>
-  <li>android: add HAVE__BUILTIN_* and HAVE_FUNC_ATTRIBUTE_* defines</li>
-  <li>android: add $(mesa_top)/src/mesa/main to the includes list</li>
-  <li>android: dri: link against libmesa_util</li>
-  <li>android: mesa: fix the path of the SSE4_1 optimisations</li>
-  <li>Update version to 10.5.4</li>
-</ul>
-
-<p>Ian Romanick (1):</p>
-<ul>
-  <li>nir: Fix typo in "ushr by 0" algebraic replacement</li>
-</ul>
-
-<p>Kenneth Graunke (2):</p>
-<ul>
-  <li>i965: Fix software primitive restart with indirect draws.</li>
-  <li>drirc: Add "Second Life" quirk (allow_glsl_extension_directive_midshader).</li>
-</ul>
-
-<p>Kristian Høgsberg (1):</p>
-<ul>
-  <li>i965: Rewrite ir_tex to ir_txl with lod 0 for vertex shaders</li>
-</ul>
-
-<p>Marek Olšák (2):</p>
-<ul>
-  <li>glsl_to_tgsi: fix out-of-bounds constant access and crash for uniforms</li>
-  <li>glsl_to_tgsi: don't use a potentially-undefined immediate for ir_query_levels</li>
-</ul>
-
-<p>Mathias Froehlich (1):</p>
-<ul>
-  <li>i965: Flush batchbuffer containing the query on glQueryCounter.</li>
-</ul>
-
-<p>Mauro Rossi (2):</p>
-<ul>
-  <li>android: mesa: generate the format_{un,}pack.[ch] sources</li>
-  <li>android: add inital NIR build</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.5.5.html

@@ -1,95 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.5.5 Release Notes / May 11, 2015</h1>
-
-<p>
-Mesa 10.5.5 is a bug fix release which fixes bugs found since the 10.5.4 release.
-</p>
-<p>
-Mesa 10.5.5 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-c10f00fd792b8290dd51ebcc48a9016c4cafab19ec205423c6fcadfd7f3a59f2  mesa-10.5.5.tar.gz
-4ac4e4ea3414f1cadb1467f2f173f9e56170d31e8674f7953a46f0549d319f28  mesa-10.5.5.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88521">Bug 88521</a> - GLBenchmark 2.7 TRex renders with artifacts on Gen8 with !UXA</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89455">Bug 89455</a> - [NVC0/Gallium] Unigine Heaven black and white boxes</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89689">Bug 89689</a> - [Regression] Weston on DRM backend won't start with new version of mesa</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90130">Bug 90130</a> - gl_PrimitiveId seems to reset at 340</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Boyan Ding (1):</p>
-<ul>
-  <li>i965: Add XRGB8888 format to intel_screen_make_configs</li>
-</ul>
-
-<p>Emil Velikov (3):</p>
-<ul>
-  <li>docs: Add sha256 sums for the 10.5.4 release</li>
-  <li>r300: do not link against libdrm_intel</li>
-  <li>Update version to 10.5.5</li>
-</ul>
-
-<p>Ilia Mirkin (4):</p>
-<ul>
-  <li>nvc0/ir: flush denorms to zero in non-compute shaders</li>
-  <li>gk110/ir: fix set with a register dest to not auto-set the abs flag</li>
-  <li>nvc0/ir: fix predicated PFETCH emission</li>
-  <li>nv50/ir: fix asFlow() const helper for OP_JOIN</li>
-</ul>
-
-<p>Kenneth Graunke (2):</p>
-<ul>
-  <li>i965: Make intel_emit_linear_blit handle Gen8+ alignment restrictions.</li>
-  <li>i965: Disallow linear blits that are not cacheline aligned.</li>
-</ul>
-
-<p>Roland Scheidegger (1):</p>
-<ul>
-  <li>draw: fix prim ids when there's no gs</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.0.html

@@ -1,331 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.0 Release Notes / June 14, 2015</h1>
-
-<p>
-Mesa 10.6.0 is a new development release.
-People who are concerned with stability and reliability should stick
-with a previous release or wait for Mesa 10.6.1.
-</p>
-<p>
-Mesa 10.6.0 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-9bc659abdba26202509304f259723aaa4343dba6aac4bd87d5baea11d23c8c63  mesa-10.6.0.tar.gz
-f37e2633978deed02ff0522abc36c709586e2b555fd439a82ab71dce2c866c76  mesa-10.6.0.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-
-<p>
-Note: some of the new features are only available with certain drivers.
-</p>
-
-<ul>
-<li>GL_AMD_pinned_memory on r600, radeonsi</li>
-<li>GL_ARB_clip_control on i965</li>
-<li>GL_ARB_depth_buffer_float on freedreno</li>
-<li>GL_ARB_depth_clamp on freedreno</li>
-<li>GL_ARB_direct_state_access on all drivers that support GL 2.0+</li>
-<li>GL_ARB_draw_indirect, GL_ARB_multi_draw_indirect on r600</li>
-<li>GL_ARB_draw_instanced on freedreno</li>
-<li>GL_ARB_gpu_shader_fp64 on nvc0, softpipe</li>
-<li>GL_ARB_gpu_shader5 on i965/gen8+</li>
-<li>GL_ARB_instanced_arrays on freedreno</li>
-<li>GL_ARB_pipeline_statistics_query on i965, nv50, nvc0, r600, radeonsi, softpipe</li>
-<li>GL_ARB_program_interface_query (all drivers)</li>
-<li>GL_ARB_texture_stencil8 on nv50, nvc0, r600, radeonsi, softpipe</li>
-<li>GL_ARB_texture_view on llvmpipe, softpipe</li>
-<li>GL_ARB_uniform_buffer_object on freedreno</li>
-<li>GL_ARB_vertex_attrib_64bit on nvc0, softpipe</li>
-<li>GL_ARB_viewport_array, GL_AMD_vertex_shader_viewport_index on i965/gen6</li>
-<li>GL_EXT_draw_buffers2 on freedreno</li>
-<li>GL_OES_EGL_sync on all drivers</li>
-<li>EGL_KHR_fence_sync on i965, freedreno, nv50, nvc0, r600, radeonsi</li>
-<li>EGL_KHR_wait_sync on i965, freedreno, nv50, nvc0, r600, radeonsi</li>
-<li>EGL_KHR_cl_event2 on freedreno, nv50, nvc0, r600, radeonsi</li>
-<li>GL_AMD_performance_monitor on nvc0</li>
-</ul>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=15006">Bug 15006</a> - translate &amp; rotate the line cause Aliasing</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=27007">Bug 27007</a> - Lines disappear with GL_LINE_SMOOTH</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=28832">Bug 28832</a> - piglit/general/line-aa-width fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=45348">Bug 45348</a> - [swrast] piglit fbo-drawbuffers-arbfp regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=60797">Bug 60797</a> - 1px lines in octave plot aliased to 0</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=67564">Bug 67564</a> - HiZ buffers are much larger than necessary</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=69226">Bug 69226</a> - Cannot enable basic shaders with Second Life aborts attempt</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=71591">Bug 71591</a> - Second Life shaders fail to compile (extension declared in middle of shader)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=79202">Bug 79202</a> - valgrind errors in glsl-fs-uniform-array-loop-unroll.shader_test; random code generation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=81025">Bug 81025</a> - [IVB/BYT Bisected]Piglit spec_ARB_draw_indirect_arb_draw_indirect-draw-elements-prim-restart-ugly fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82477">Bug 82477</a> - [softpipe] piglit fp-long-alu regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82668">Bug 82668</a> - Can't set int attributes to certain values on 32-bit</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82831">Bug 82831</a> - i965: Support GL_ARB_blend_func_extended in SIMD16</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=83962">Bug 83962</a> - [HSW/BYT]Piglit spec_ARB_gpu_shader5_arb_gpu_shader5-emitstreamvertex_nodraw fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84613">Bug 84613</a> - [G965, bisected] piglit regressions : glslparsertest.glsl2</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86747">Bug 86747</a> - Noise in Football Manager 2014 textures</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86792">Bug 86792</a> - [NVC0] Portal 2 Crashes in Wine</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86811">Bug 86811</a> - [BDW/BSW Bisected]Piglit spec_arb_shading_language_packing_execution_built-in-functions_vs-unpackSnorm4x8 fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86837">Bug 86837</a> - kodi segfault since auxiliary/vl: rework the build of the VL code</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86944">Bug 86944</a> - glsl_parser_extras.cpp&quot;, line 1455: Error: Badly formed expression. (Oracle Studio)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86974">Bug 86974</a> - INTEL_DEBUG=shader_time always asserts in fs_generator::generate_code() when Mesa is built with --enable-debug (= with asserts)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86980">Bug 86980</a> - [swrast] piglit fp-rfl regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=87258">Bug 87258</a> - [BDW/BSW Bisected]Piglit spec_ARB_shader_atomic_counters_array-indexing fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88246">Bug 88246</a> - Commit 2881b12 causes 43 DrawElements test regressions</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88248">Bug 88248</a> - Calling glClear while there is an occlusion query in progress messes up the results</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88521">Bug 88521</a> - GLBenchmark 2.7 TRex renders with artifacts on Gen8 with !UXA</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88534">Bug 88534</a> - include/c11/threads_posix.h PTHREAD_MUTEX_RECURSIVE_NP not defined</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88561">Bug 88561</a> - [radeonsi][regression,bisected] Depth test/buffer issues in Portal</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88793">Bug 88793</a> - [BDW/BSW Bisected]Piglit/shaders_glsl-max-varyings fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88815">Bug 88815</a> - Incorrect handling of GLSL #line directive</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88883">Bug 88883</a> - ir-a2xx.c: variable changed in assert statement</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88885">Bug 88885</a> - Transform feedback uses incorrect interleaving if a previous draw did not write gl_Position</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88905">Bug 88905</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.gtf.GL3Tests.packed_pixels.packed_pixels fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=88999">Bug 88999</a> - [SKL] Compiz crashes after opening unity dash</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89014">Bug 89014</a> - PIPE_QUERY_GPU_FINISHED is not acting as expected on SI</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89026">Bug 89026</a> - Renderbuffer layered state used for framebuffer completeness test</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89032">Bug 89032</a> - [BDW/BSW/SKL Bisected]Piglit spec_OpenGL_1.1_infinite-spot-light fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89037">Bug 89037</a> - [SKL]Piglit spec_EXT_texture_array_copyteximage_1D_ARRAY_samples=2 sporadically causes GPU hang</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89039">Bug 89039</a> - [SKL]etqw system hang</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89058">Bug 89058</a> - [SKL]Render error in some games (etqw-demo, nexuiz, portal)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89068">Bug 89068</a> - glTexImage2D regression by texstore_rgba switch to _mesa_format_convert</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89069">Bug 89069</a> - Lack of grass in The Talos Principle on radeonsi (native\wine\nine)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89094">Bug 89094</a> - [SNB/IVB/HSW/BYT Bisected]Ogles3conform ES3-CTS.gtf.GL3Tests.shadow.shadow_execution_vert fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89095">Bug 89095</a> - [SNB/IVB/BYT Bisected]Webglc conformance/glsl/functions/glsl-function-mix-float.html fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89112">Bug 89112</a> - u_atomic_test: u_atomic_test.c:124: test_atomic_8bits_bool: Assertion `r == 65 &amp;&amp; &quot;p_atomic_add&quot;' failed.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89118">Bug 89118</a> - [SKL Bisected]many Ogles3conform cases core dumped</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89131">Bug 89131</a> - [Bisected] Graphical corruption in Weston,  shows old framebuffer pieces</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89156">Bug 89156</a> - r300g: GL_COMPRESSED_RED_RGTC1 / ATI1N support broken</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89180">Bug 89180</a> - [IVB regression] Rendering issues in Mass Effect through VMware Workstation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89210">Bug 89210</a> - GS statistics fail on SNB</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89218">Bug 89218</a> - lower_instructions.cpp:648:48: error: invalid suffix 'd' on floating constant</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89224">Bug 89224</a> - Incorrect rendering of Unigine Valley running in VM on VMware Workstation</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89260">Bug 89260</a> - macros.h:34:25: fatal error: util/u_math.h: No such file or directory</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89292">Bug 89292</a> - [regression,bisected] incomplete screenshots in some cases</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89311">Bug 89311</a> - [regression, bisected] dEQP: Added entry points for glCompressedTextureSubImage*D.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89312">Bug 89312</a> - [regression, bisected] main: Added entry points for CopyTextureSubImage*D. (d6b7c40cecfe01)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89315">Bug 89315</a> - [HSW, regression, bisected] i965/fs: Emit MAD instructions when possible.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89317">Bug 89317</a> - [HSW, regression, bisected] i965: Add LINTERP/CINTERP to can_do_cmod() (d91390634)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89328">Bug 89328</a> - python required to build Mesa release tarballs</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89342">Bug 89342</a> - main/light.c:159:62: error: 'M_PI' undeclared (first use in this function)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89343">Bug 89343</a> - compiler/tests/radeon_compiler_optimize_tests.c:43:3: error: implicit declaration of function ‘fprintf’ [-Werror=implicit-function-declaration]</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89345">Bug 89345</a> - imports.h:452:58: error: expected declaration specifiers or '...' before 'va_list'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89364">Bug 89364</a> - c99_alloca.h:40:22: fatal error: alloca.h: No such file or directory</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89372">Bug 89372</a> - [softpipe] piglit glsl-1.50 generate-zero-primitives regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89387">Bug 89387</a> - Double delete in lp_bld_misc.cpp</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89416">Bug 89416</a> - UE4Editor crash after load project</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89430">Bug 89430</a> - [g965][bisected] arb_copy_image-targets gl_texture* tests fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89433">Bug 89433</a> - GCC 4.2 does not support -Wvla</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89455">Bug 89455</a> - [NVC0/Gallium] Unigine Heaven black and white boxes</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89457">Bug 89457</a> - [BSW Bisected]ogles3conform ES3-CTS.gtf.GL3Tests.shadow.shadow_execution_vert fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89477">Bug 89477</a> - include/no_extern_c.h:47:1: error: template with C linkage</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89508">Bug 89508</a> - Bad int(floatBitsToInt(vec4))</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89530">Bug 89530</a> - FTBFS in loader: missing fstat</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89569">Bug 89569</a> - Papo &amp; Yo crash on startup [HSW]</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89590">Bug 89590</a> - Crash in glLinkProgram with shaders with multiple constant arrays</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89662">Bug 89662</a> - context.c:943: undefined reference to `_glapi_new_nop_table'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89670">Bug 89670</a> - cmod_propagation_test.andnz_one regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89679">Bug 89679</a> - [NV50] Portal/Half-Life 2 will not start (native Steam)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89689">Bug 89689</a> - [Regression] Weston on DRM backend won't start with new version of mesa</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89722">Bug 89722</a> - [ILK Bisected]Ogles2conform/ES2-CTS.gtf.GL.equal.equal_vec2_frag fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89726">Bug 89726</a> - [Bisected] dEQP-GLES3: uniform linking logic in the presence of structs</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89746">Bug 89746</a> - Mesa and LLVM 3.6+ break opengl for genymotion</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89754">Bug 89754</a> - vertexAttrib fails WebGL Conformance test with mesa drivers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89758">Bug 89758</a> - pow WebGL Conformance test with mesa drivers</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89759">Bug 89759</a> - WebGL OGL ES GLSL conformance test with mesa drivers fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89831">Bug 89831</a> - [r600] r600_asm.c:310:assign_alu_units: Assertion `0' failed.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89899">Bug 89899</a> - nir/nir_lower_tex_projector.c:112: error: unknown field ‘ssa’ specified in initializer</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89957">Bug 89957</a> - vm protection faults in piglit lest: texsubimage cube_map_array pbo</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89960">Bug 89960</a> - [softpipe] piglit copy-pixels regreession</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89961">Bug 89961</a> - [BDW/BSW Bisected]Synmark2_v6 OglDrvRes/OglDrvShComp/OglDrvState/OglPSPom Image Validation fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=89963">Bug 89963</a> - lp_bld_debug.cpp:100:31: error: no matching function for call to ‘llvm::raw_ostream::raw_ostream()’</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90000">Bug 90000</a> - [i965 Bisected NIR] Piglit/gglean_fragprog1-z-write_test fail</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90109">Bug 90109</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.shaders.uniform_block.random.basic_arrays.3 fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90114">Bug 90114</a> - [SNB+ Bisected]Ogles3conform ES3-CTS.shaders.struct.uniform.sampler_array_fragment fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90130">Bug 90130</a> - gl_PrimitiveId seems to reset at 340</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90147">Bug 90147</a> - swrast: build error undeclared _SC_PHYS_PAGES on osx</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90149">Bug 90149</a> - [SNB+ Bisected]ES3-CTS.gtf.GL3Tests.uniform_buffer_object.uniform_buffer_object_getactiveuniformsiv_for_nonexistent_uniform_indices fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90153">Bug 90153</a> - [SKL Bisected]ES3-CTS.gtf.GL3Tests.uniform_buffer_object.uniform_buffer_object_all_valid_basic_types fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90167">Bug 90167</a> - [softpipe] piglit depthstencil-default_fb-drawpixels-32f_24_8_rev regression</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90207">Bug 90207</a> - [r600g, bisected] regression: NI/Turks crash on WebGL Water (most WebGL stuff)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90213">Bug 90213</a> - glDrawPixels with GL_COLOR_INDEX never returns.</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90243">Bug 90243</a> - [bisected] regression: spec.!opengl 3_2.get-active-attrib-returns-all-inputs</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90258">Bug 90258</a> - [IVB] spec.glsl-1_10.execution.fs-dfdy-accuracy fails intermittently</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90310">Bug 90310</a> - Fails to build gallium_dri.so at linking stage with clang because of multiple redefinitions</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90350">Bug 90350</a> - [G96] Portal's portal are incorrectly rendered</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90363">Bug 90363</a> - [nv50] HW state is not reset correctly when using a new GL context</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90397">Bug 90397</a> - ARB_program_interface_query: glGetProgramResourceiv() returns wrong value for GL_REFERENCED_BY_*_SHADER prop for GL_UNIFORM for members of an interface block with an instance name</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90466">Bug 90466</a> - arm: linker error ndefined reference to `nir_metadata_preserve'</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90520">Bug 90520</a> - Register spilling clobbers registers used elsewhere in the shader</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90547">Bug 90547</a> - [BDW/BSW/SKL Bisected]Piglit/glean&#64;vertprog1-rsq_test_2_(reciprocal_square_root_of_negative_value) fais</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90580">Bug 90580</a> - [HSW bisected] integer multiplication bug</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90629">Bug 90629</a> - [i965] SIMD16 dual_source_blend assertion `src[i].file != GRF || src[i].width == dst.width' failed</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90749">Bug 90749</a> - [BDW Bisected]dEQP-GLES3.functional.rasterization.fbo.rbo_multisample_max.primitives.lines_wide fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90830">Bug 90830</a> - [bsw bisected regression] GPU hang for spec.arb_gpu_shader5.execution.sampler_array_indexing.vs-nonzero-base</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90839">Bug 90839</a> - [10.5.5/10.6 regression, bisected] PBO glDrawPixels no longer using blit fastpath</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90905">Bug 90905</a> - mesa: Finish subdir-objects transition</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=9951">Bug 9951</a> - GL_LINE_SMOOTH and GL_POLYGON_SMOOTH with i965 driver</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<ul>
-<li>Removed classic Windows software rasterizer.</li>
-<li>Removed egl_gallium EGL driver.</li>
-<li>Removed gbm_gallium GBM driver.</li>
-<li>Removed OpenVG support.</li>
-<li>Removed the galahad gallium driver.</li>
-<li>Removed the identity gallium driver.</li>
-<li>Removed the EGL loader from the Windows SCons build.</li>
-<li>Removed the classic osmesa from the Windows SCons build.</li>
-</ul>
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.1.html

@@ -1,104 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.1 Release Notes / June 29, 2015</h1>
-
-<p>
-Mesa 10.6.1 is a bug fix release which fixes bugs found since the 10.6.0 release.
-</p>
-<p>
-Mesa 10.6.1 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-b4cccd4d0eabcc2bca00c3175d3ad88fdda57ffdb883a7998525b873a21fe607  mesa-10.6.1.tar.gz
-6c80a2b647e57c85dc36e609d9aed17f878f0d8e0cf9ace86d14cf604101e1eb  mesa-10.6.1.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90347">Bug 90347</a> - [NVE0+] Failure to insert texbar under some circumstances (causing bad colors in Terasology)</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Anuj Phogat (4):</p>
-<ul>
-  <li>mesa: Handle integer formats in need_rgb_to_luminance_conversion()</li>
-  <li>mesa: Use helper function need_rgb_to_luminance_conversion()</li>
-  <li>mesa: Turn need_rgb_to_luminance_conversion() in to a global function</li>
-  <li>meta: Abort meta path if ReadPixels need rgb to luminance conversion</li>
-</ul>
-
-<p>Ben Widawsky (1):</p>
-<ul>
-  <li>i965/gen9: Implement Push Constant Buffer workaround</li>
-</ul>
-
-<p>Boyan Ding (2):</p>
-<ul>
-  <li>egl/x11: Set version of swrastLoader to 2</li>
-  <li>egl/x11: Remove duplicate call to dri2_x11_add_configs_for_visuals</li>
-</ul>
-
-<p>Emil Velikov (6):</p>
-<ul>
-  <li>docs: Add sha256sums for the 10.6.0 release</li>
-  <li>configure: warn about shared_glapi &amp; xlib-glx only when both are set</li>
-  <li>configure: error out when building backend-less libEGL</li>
-  <li>configure: error out when building libEGL without shared-glapi</li>
-  <li>gbm: do not (over)link against libglapi.so</li>
-  <li>Update version to 10.6.1</li>
-</ul>
-
-<p>Frank Henigman (1):</p>
-<ul>
-  <li>gbm: dlopen libglapi so gbm_create_device works</li>
-</ul>
-
-<p>Ilia Mirkin (9):</p>
-<ul>
-  <li>nvc0/ir: fix collection of first uses for texture barrier insertion</li>
-  <li>nv50,nvc0: clamp uniform size to 64k</li>
-  <li>nvc0/ir: can't have a join on a load with an indirect source</li>
-  <li>glsl: handle conversions to double when comparing param matches</li>
-  <li>glsl: add version checks to conditionals for builtin variable enablement</li>
-  <li>mesa: add GL_PROGRAM_PIPELINE support in KHR_debug calls</li>
-  <li>glsl: binding point is a texture unit, which is a combined space</li>
-  <li>nvc0: always put all tfb bufs into bufctx</li>
-  <li>nv50,nvc0: make sure to pushbuf_refn before putting bo into pushbuf_data</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.2.html

@@ -1,165 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.2 Release Notes / July 11, 2015</h1>
-
-<p>
-Mesa 10.6.2 is a bug fix release which fixes bugs found since the 10.6.1 release.
-</p>
-<p>
-Mesa 10.6.2 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-9c7ab9300dda6c912faaaff97995ec1820ba21d114d9cf555f145cbad90995f4  mesa-10.6.2.tar.gz
-05753d3db4212900927b9894221a1669a10f56786e86a7e818b6e18a0817dca9  mesa-10.6.2.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=73528">Bug 73528</a> - Deferred lighting in Second Life causes system hiccups and screen flickering</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=80500">Bug 80500</a> - Flickering shadows in unreleased title trace</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=82186">Bug 82186</a> - [r600g] BARTS GPU lockup with minecraft shaders</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84225">Bug 84225</a> - Allow constant-index-expression sampler array indexing with GLSL-ES &lt; 300</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90537">Bug 90537</a> - radeonsi bo/va conflict on RADEON_GEM_VA (rscreen-&gt;ws-&gt;buffer_from_handle returns NULL)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90873">Bug 90873</a> - Kernel hang, TearFree On, Mate desktop environment</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91022">Bug 91022</a> - [g45 g965 bisected] assertions generated from textureGrad cube samplers fix</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91047">Bug 91047</a> - [SNB Bisected] Messed up Fog in Super Smash Bros. Melee in Dolphin</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91056">Bug 91056</a> - The Bard's Tale (2005, native)  has rendering issues</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91117">Bug 91117</a> - Nimbus (running in wine) has rendering issues, objects are semi-transparent</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91124">Bug 91124</a> - Civilization V (in Wine) has rendering issues: text missing, menu bar corrupted</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91173">Bug 91173</a> - Oddworld: Stranger's Wrath HD: disfigured models in wrong colors</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91226">Bug 91226</a> - Crash in glLinkProgram (NEW)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91231">Bug 91231</a> - [NV92] Psychonauts (native) segfaults on start when DRI3 enabled</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Chris Wilson (1):</p>
-<ul>
-  <li>loader: Look for any version of currently linked libudev.so</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: Add sha256 checksums for the 10.6.1 release</li>
-  <li>Update version to 10.6.2</li>
-</ul>
-
-<p>Ilia Mirkin (8):</p>
-<ul>
-  <li>nv50/ir: propagate modifier to right arg when const-folding mad</li>
-  <li>nv50/ir: fix emission of address reg in 3rd source</li>
-  <li>nv50/ir: copy joinAt when splitting both before and after</li>
-  <li>mesa: reset the source packing when creating temp transfer image</li>
-  <li>nv50/ir: don't emit src2 in immediate form</li>
-  <li>mesa/prog: relative offsets into constbufs are not constant</li>
-  <li>nv50/ir: UCMP arguments are float, so make sure modifiers are applied</li>
-  <li>nvc0: turn sample counts off during blit</li>
-</ul>
-
-<p>Kenneth Graunke (5):</p>
-<ul>
-  <li>i965/fs: Fix ir_txs in emit_texture_gen4_simd16().</li>
-  <li>i965: Reserve more batch space to accomodate Gen6 perfmonitors.</li>
-  <li>i965/vs: Fix matNxM vertex attributes where M != 4.</li>
-  <li>Revert "glsl: clone inputs and outputs during linking"</li>
-  <li>Revert "i965: Delete linked GLSL IR when using NIR."</li>
-</ul>
-
-<p>Marek Olšák (3):</p>
-<ul>
-  <li>r600g: disable single-sample fast color clear due to hangs</li>
-  <li>radeonsi: fix a hang with DrawTransformFeedback on 4 SE chips</li>
-  <li>st/dri: don't set PIPE_BIND_SCANOUT for MSAA surfaces</li>
-</ul>
-
-<p>Mario Kleiner (2):</p>
-<ul>
-  <li>nouveau: Use dup fd as key in drm-winsys hash table to fix ZaphodHeads.</li>
-  <li>winsys/radeon: Use dup fd as key in drm-winsys hash table to fix ZaphodHeads.</li>
-</ul>
-
-<p>Matt Turner (2):</p>
-<ul>
-  <li>i965/fs: Don't mess up stride for uniform integer multiplication.</li>
-  <li>Revert SHA1 additions.</li>
-</ul>
-
-<p>Michel Dänzer (1):</p>
-<ul>
-  <li>winsys/radeon: Unmap GPU VM address range when destroying BO</li>
-</ul>
-
-<p>Mike Stroyan (2):</p>
-<ul>
-  <li>meta: Only change and restore viewport 0 in mesa meta mode</li>
-  <li>i965: allocate at least 1 BLEND_STATE element</li>
-</ul>
-
-<p>Neil Roberts (4):</p>
-<ul>
-  <li>i965/skl: Set the pulls bary bit in 3DSTATE_PS_EXTRA</li>
-  <li>glsl: Add missing check for whether an expression is an add operation</li>
-  <li>glsl: Make sure not to dereference NULL</li>
-  <li>i965: Don't try to print the GLSL IR if it has been freed</li>
-</ul>
-
-<p>Tapani Pälli (8):</p>
-<ul>
-  <li>glsl: clone inputs and outputs during linking</li>
-  <li>i965: Delete linked GLSL IR when using NIR.</li>
-  <li>glsl: Allow dynamic sampler array indexing with GLSL ES &lt; 3.00</li>
-  <li>mesa/glsl: new compiler option EmitNoIndirectSampler</li>
-  <li>i965: use EmitNoIndirectSampler for gen &lt; 7</li>
-  <li>i915: use EmitNoIndirectSampler</li>
-  <li>mesa/st: use EmitNoIndirectSampler if !ARB_gpu_shader5</li>
-  <li>glsl: validate sampler array indexing for 'constant-index-expression'</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.3.html

@@ -1,106 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.3 Release Notes / July 26, 2015</h1>
-
-<p>
-Mesa 10.6.3 is a bug fix release which fixes bugs found since the 10.6.2 release.
-</p>
-<p>
-Mesa 10.6.3 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-c27e1e33798e69a6d2d2425aee8ac7b4c0b243066a65dd76cbb182ea31b1c7f2  mesa-10.6.3.tar.gz
-58592e07c350cd2e8969b73fa83048c657a39fe2f13f3b88f5e5818fe2e4676d  mesa-10.6.3.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90728">Bug 90728</a> - dvd playback with vlc and vdpau causes segmentation fault</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91337">Bug 91337</a> - OSMesaGetProcAdress(&quot;OSMesaPixelStore&quot;) returns nil</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Brian Paul (1):</p>
-<ul>
-  <li>osmesa: fix OSMesaPixelsStore typo</li>
-</ul>
-
-<p>Chad Versace (1):</p>
-<ul>
-  <li>mesa: Fix generation of git_sha1.h.tmp for gitlinks</li>
-</ul>
-
-<p>Christian König (2):</p>
-<ul>
-  <li>vl: cleanup video buffer private when the decoder is destroyed</li>
-  <li>st/vdpau: fix mixer size checks</li>
-</ul>
-
-<p>Emil Velikov (3):</p>
-<ul>
-  <li>docs: Add sha256 checksums for the 10.6.2 release</li>
-  <li>auxiliary/vl: use the correct screen index</li>
-  <li>Update version to 10.6.3</li>
-</ul>
-
-<p>Francisco Jerez (1):</p>
-<ul>
-  <li>i965/gen9: Use custom MOCS entries set up by the kernel.</li>
-</ul>
-
-<p>Ilia Mirkin (5):</p>
-<ul>
-  <li>nv50, nvc0: enable at least one color RT if alphatest is enabled</li>
-  <li>nvc0/ir: fix txq on indirect samplers</li>
-  <li>nvc0/ir: don't worry about sampler in txq handling</li>
-  <li>gm107/ir: fix indirect txq emission</li>
-  <li>nv50: fix max level clamping on G80</li>
-</ul>
-
-<p>Kenneth Graunke (1):</p>
-<ul>
-  <li>program: Allow redundant OPTION ARB_fog_* directives.</li>
-</ul>
-
-<p>Rob Clark (1):</p>
-<ul>
-  <li>xa: don't leak fences</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.4.html

@@ -1,137 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.4 Release Notes / August 11, 2015</h1>
-
-<p>
-Mesa 10.6.4 is a bug fix release which fixes bugs found since the 10.6.3 release.
-</p>
-<p>
-Mesa 10.6.4 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-4960bf17d8b5d6a6503c6954ec6cf480b5cd930797bac901c60bea192675f85e  mesa-10.6.4.tar.gz
-8f5ac103f0f503de2f7a985b0df349bd4ecdfe7f51c714be146fa5a9a3c07b77  mesa-10.6.4.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=73512">Bug 73512</a> - [clover] mesa.icd. should contain full path</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91290">Bug 91290</a> - SIGSEGV glcpp/glcpp-parse.y:1077</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Anuj Phogat (6):</p>
-<ul>
-  <li>mesa: Turn get_readpixels_transfer_ops() in to a global function</li>
-  <li>meta: Fix transfer operations check in meta pbo path for readpixels</li>
-  <li>meta: Abort meta pbo path if readpixels need signed-unsigned conversion</li>
-  <li>meta: Don't do fragment color clamping in _mesa_meta_pbo_GetTexSubImage</li>
-  <li>mesa: Add a helper function _mesa_need_luminance_to_rgb_conversion()</li>
-  <li>meta: Fix reading luminance texture as rgba in _mesa_meta_pbo_GetTexSubImage()</li>
-</ul>
-
-<p>Ben Widawsky (1):</p>
-<ul>
-  <li>i965/skl: Add production thread counts and URB size</li>
-</ul>
-
-<p>Eduardo Lima Mitev (3):</p>
-<ul>
-  <li>mesa: Fix errors values returned by glShaderBinary()</li>
-  <li>mesa: Validate target before resolving tex obj in glTex(ture)SubImageXD</li>
-  <li>mesa: Fix error returned by glCopyTexImage2D() upon an invalid internal format</li>
-</ul>
-
-<p>Emil Velikov (6):</p>
-<ul>
-  <li>docs: Add checksums for mesa 10.6.3 tarballs</li>
-  <li>configure.ac: do not set HAVE_DRI(23) when libdrm is missing</li>
-  <li>egl/wayland: libdrm is a hard requirement, treat it as such</li>
-  <li>winsys/radeon: don't leak the fd when it is 0</li>
-  <li>bugzilla_mesa.sh: sort the bugs list by number</li>
-  <li>Update version to 10.6.4</li>
-</ul>
-
-<p>Francisco Jerez (1):</p>
-<ul>
-  <li>i965/fs: Fix fs_inst::regs_read() for sources in the ATTR file.</li>
-</ul>
-
-<p>Frank Binns (2):</p>
-<ul>
-  <li>egl/dri: Add error info needed for EGL_EXT_image_dma_buf_import extension</li>
-  <li>egl: Add eglQuerySurface surface type check for EGL_LARGEST_PBUFFER attrib</li>
-</ul>
-
-<p>Igor Gnatenko (1):</p>
-<ul>
-  <li>opencl: use versioned .so in mesa.icd</li>
-</ul>
-
-<p>Ilia Mirkin (1):</p>
-<ul>
-  <li>nvc0: fix geometry program revalidation of clipping params</li>
-</ul>
-
-<p>Kenneth Graunke (1):</p>
-<ul>
-  <li>glsl: Fix a bug where LHS swizzles of swizzles were too small.</li>
-</ul>
-
-<p>Marek Olšák (6):</p>
-<ul>
-  <li>st/mesa: don't call st_validate_state in BlitFramebuffer</li>
-  <li>radeonsi: upload shader rodata after updating scratch relocations</li>
-  <li>st/mesa: don't ignore texture buffer state changes</li>
-  <li>radeonsi: rework how shader pointers to descriptors are set</li>
-  <li>radeonsi: completely rework updating descriptors without CP DMA</li>
-  <li>r600g: fix the CB_SHADER_MASK setup</li>
-</ul>
-
-<p>Samuel Iglesias Gonsalvez (1):</p>
-<ul>
-  <li>glsl/glcpp: fix SIGSEGV when checking error condition for macro redefinition</li>
-</ul>
-
-<p>Samuel Pitoiset (1):</p>
-<ul>
-  <li>nv50: avoid segfault with enabled but unbound vertex attrib</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.5.html

@@ -1,124 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.5 Release Notes / August 22, 2015</h1>
-
-<p>
-Mesa 10.6.5 is a bug fix release which fixes bugs found since the 10.6.4 release.
-</p>
-<p>
-Mesa 10.6.5 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-afe290fc7af75a25df5ee52396a9f09e5dba85fb3e159304bdda265b8564b0d4  mesa-10.6.5.tar.gz
-fb6fac3c85bcfa9d06b8dd439169f23f0c0924a88e44362e738b99b1feff762f  mesa-10.6.5.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=85252">Bug 85252</a> - Segfault in compiler while processing ternary operator with void arguments</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91570">Bug 91570</a> - Upgrading mesa to 10.6 causes segfault in OpenGL applications with GeForce4 MX 440 / AGP 8X</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91610">Bug 91610</a> - [BSW] GPU hang for spec.shaders.point-vertex-id gl_instanceid divisor</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Adam Jackson (1):</p>
-<ul>
-  <li>glx: Fix __glXWireToEvent for BufferSwapComplete</li>
-</ul>
-
-<p>Alex Deucher (2):</p>
-<ul>
-  <li>radeonsi: add new OLAND pci id</li>
-  <li>radeonsi: properly set the raster_config for KV</li>
-</ul>
-
-<p>Emil Velikov (4):</p>
-<ul>
-  <li>docs: add sha256 checksums for 10.6.4</li>
-  <li>vc4: add missing nir include, to fix the build</li>
-  <li>Revert "radeonsi: properly set the raster_config for KV"</li>
-  <li>Update version to 10.6.5</li>
-</ul>
-
-<p>Frank Binns (1):</p>
-<ul>
-  <li>egl/x11: don't abort when creating a DRI2 drawable fails</li>
-</ul>
-
-<p>Ilia Mirkin (3):</p>
-<ul>
-  <li>nouveau: no need to do tnl wakeup, state updates are always hooked up</li>
-  <li>gm107/ir: indirect handle goes first on maxwell also</li>
-  <li>nv50,nvc0: take level into account when doing eng2d multi-layer blits</li>
-</ul>
-
-<p>Jason Ekstrand (4):</p>
-<ul>
-  <li>meta/copy_image: Stash off the scissor</li>
-  <li>mesa/formats: Only do byteswapping for packed formats</li>
-  <li>mesa/formats: Fix swizzle flipping for big-endian targets</li>
-  <li>mesa/formats: Don't flip channels of null array formats</li>
-</ul>
-
-<p>Marek Olšák (3):</p>
-<ul>
-  <li>radeonsi: fix polygon offset scale</li>
-  <li>r600g: fix polygon offset scale</li>
-  <li>r600g: allow setting geometry shader sampler states</li>
-</ul>
-
-<p>Neil Roberts (1):</p>
-<ul>
-  <li>i965/bdw: Fix setting the instancing state for the SGVS element</li>
-</ul>
-
-<p>Oded Gabbay (2):</p>
-<ul>
-  <li>mesa: clear existing swizzle info before bitwise-OR</li>
-  <li>mesa/formats: don't byteswap when building array formats</li>
-</ul>
-
-<p>Renaud Gaubert (1):</p>
-<ul>
-  <li>glsl: avoid compiler's segfault when processing operators with void arguments</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.6.html

@@ -1,164 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.6 Release Notes / September 04, 2015</h1>
-
-<p>
-Mesa 10.6.6 is a bug fix release which fixes bugs found since the 10.6.5 release.
-</p>
-<p>
-Mesa 10.6.6 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-416517aa9df4791f97d34451a9e4da33c966afcd18c115c5769b92b15b018ef5  mesa-10.6.6.tar.gz
-570f2154b7340ff5db61ff103bc6e85165b8958798b78a50fa2df488e98e5778  mesa-10.6.6.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=84677">Bug 84677</a> - Triangle disappears with glPolygonMode GL_LINE</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90734">Bug 90734</a> - glBufferSubData is corrupting data when buffer is &gt; 32k</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90748">Bug 90748</a> - [BDW Bisected]dEQP-GLES3.functional.fbo.completeness.renderable.texture.depth.rg_half_float_oes fails</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90902">Bug 90902</a> - [bsw][regression] dEQP: &quot;Found invalid pixel values&quot;</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90925">Bug 90925</a> - &quot;high fidelity&quot;: Segfault in _mesa_program_resource_find_name</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91254">Bug 91254</a> - (regresion) video using VA-API on Intel slow and freeze system with mesa 10.6 or 10.6.1</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91292">Bug 91292</a> - [BDW+] glVertexAttribDivisor not working in combination with glPolygonMode</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91673">Bug 91673</a> - Segfault when calling glTexSubImage2D on storage texture to bound FBO</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91726">Bug 91726</a> - R600 asserts in tgsi_cmp/make_src_for_op3</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Chris Wilson (2):</p>
-<ul>
-  <li>i965: Prevent coordinate overflow in intel_emit_linear_blit</li>
-  <li>i965: Always re-emit the pipeline select during invariant state emission</li>
-</ul>
-
-<p>Daniel Scharrer (1):</p>
-<ul>
-  <li>mesa: add missing queries for ARB_direct_state_access</li>
-</ul>
-
-<p>Dave Airlie (8):</p>
-<ul>
-  <li>mesa/arb_gpu_shader_fp64: add support for glGetUniformdv</li>
-  <li>mesa/texgetimage: fix missing stencil check</li>
-  <li>st/readpixels: fix accel path for skipimages.</li>
-  <li>texcompress_s3tc/fxt1: fix stride checks (v1.1)</li>
-  <li>mesa/readpixels: check strides are equal before skipping conversion</li>
-  <li>mesa: enable texture stencil8 for multisample</li>
-  <li>r600/sb: update last_cf for finalize if.</li>
-  <li>r600g: fix calculation for gpr allocation</li>
-</ul>
-
-<p>David Heidelberg (1):</p>
-<ul>
-  <li>st/nine: Require gcc &gt;= 4.6</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: add sha256 checksums for 10.6.5</li>
-  <li>get-pick-list.sh: Require explicit "10.6" for nominating stable patches</li>
-</ul>
-
-<p>Glenn Kennard (4):</p>
-<ul>
-  <li>r600g: Fix assert in tgsi_cmp</li>
-  <li>r600g/sb: Handle undef in read port tracker</li>
-  <li>r600g/sb: Don't read junk after EOP</li>
-  <li>r600g/sb: Don't crash on empty if jump target</li>
-</ul>
-
-<p>Ilia Mirkin (5):</p>
-<ul>
-  <li>st/mesa: fix assignments with 4-operand arguments (i.e. BFI)</li>
-  <li>st/mesa: pass through 4th opcode argument in bitmap/pixel visitors</li>
-  <li>nv50,nvc0: disable depth bounds test on blit</li>
-  <li>nv50: fix 2d engine blits for 64- and 128-bit formats</li>
-  <li>mesa: only copy the requested teximage faces</li>
-</ul>
-
-<p>Jason Ekstrand (1):</p>
-<ul>
-  <li>i965/fs: Split VGRFs after lowering pull constants</li>
-</ul>
-
-<p>Kenneth Graunke (3):</p>
-<ul>
-  <li>i965: Fix copy propagation type changes.</li>
-  <li>Revert "i965: Advertise a line width of 40.0 on Cherryview and Skylake."</li>
-  <li>i965: Momentarily pretend to support ARB_texture_stencil8 for blits.</li>
-</ul>
-
-<p>Marek Olšák (3):</p>
-<ul>
-  <li>gallium/radeon: fix the ADDRESS_HI mask for EVENT_WRITE CIK packets</li>
-  <li>mesa: create multisample fallback textures like normal textures</li>
-  <li>radeonsi: fix a Unigine Heaven hang when drirc is missing</li>
-</ul>
-
-<p>Matt Turner (1):</p>
-<ul>
-  <li>i965/fs: Handle MRF destinations in lower_integer_multiplication().</li>
-</ul>
-
-<p>Neil Roberts (2):</p>
-<ul>
-  <li>i965: Swap the order of the vertex ID and edge flag attributes</li>
-  <li>i965/bdw: Fix 3DSTATE_VF_INSTANCING when the edge flag is used</li>
-</ul>
-
-<p>Tapani Pälli (5):</p>
-<ul>
-  <li>mesa: update fbo state in glTexStorage</li>
-  <li>glsl: build stageref mask using IR, not symbol table</li>
-  <li>glsl: expose build_program_resource_list function</li>
-  <li>glsl: create program resource list after LinkShader</li>
-  <li>mesa: add GL_RED, GL_RG support for floating point textures</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.7.html

@@ -1,75 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.7 Release Notes / September 10, 2015</h1>
-
-<p>
-Mesa 10.6.7 is a bug fix release which fixes bugs found since the 10.6.6 release.
-</p>
-<p>
-Mesa 10.6.7 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-4ba10c59abee30d72476543a57afd2f33803dabf4620dc333b335d47966ff842  mesa-10.6.7.tar.gz
-feb1f640b915dada88a7c793dfaff0ae23580f8903f87a6b76469253de0d28d8  mesa-10.6.7.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90751">Bug 90751</a> - [BDW Bisected]dEQP-GLES3.functional.fbo.completeness.renderable.texture.stencil.stencil_index8 fails</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Dave Airlie (1):</p>
-<ul>
-  <li>mesa/teximage: use correct extension for accept stencil texture.</li>
-</ul>
-
-<p>Emil Velikov (3):</p>
-<ul>
-  <li>docs: add sha256 checksums for 10.6.6</li>
-  <li>Revert "i965: Momentarily pretend to support ARB_texture_stencil8 for blits."</li>
-  <li>Update version to 10.6.7</li>
-</ul>
-
-<p>Kenneth Graunke (1):</p>
-<ul>
-  <li>glsl: Handle attribute aliasing in attribute storage limit check.</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.8.html

@@ -1,136 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.8 Release Notes / September 20, 2015</h1>
-
-<p>
-Mesa 10.6.8 is a bug fix release which fixes bugs found since the 10.6.7 release.
-</p>
-<p>
-Mesa 10.6.8 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-1f34dba2a8059782e3e4e0f18b9628004e253b2c69085f735b846d2e63c9e250  mesa-10.6.8.tar.gz
-e36ee5ceeadb3966fb5ce5b4cf18322dbb76a4f075558ae49c3bba94f57d58fd  mesa-10.6.8.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=90621">Bug 90621</a> - Mesa fail to build from git</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91526">Bug 91526</a> - World of Warcraft (on Wine) has UI corruption with nouveau</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91719">Bug 91719</a> - [SNB,HSW,BYT] dEQP regressions associated with using NIR for vertex shaders</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Alejandro Piñeiro (1):</p>
-<ul>
-  <li>i965/vec4: fill src_reg type using the constructor type parameter</li>
-</ul>
-
-<p>Antia Puentes (1):</p>
-<ul>
-  <li>i965/vec4: Fix saturation errors when coalescing registers</li>
-</ul>
-
-<p>Emil Velikov (2):</p>
-<ul>
-  <li>docs: add sha256 checksums for 10.6.7</li>
-  <li>cherry-ignore: add commit non applicable for 10.6</li>
-</ul>
-
-<p>Hans de Goede (4):</p>
-<ul>
-  <li>nv30: Fix creation of scanout buffers</li>
-  <li>nv30: Implement color resolve for msaa</li>
-  <li>nv30: Fix max width / height checks in nv30 sifm code</li>
-  <li>nv30: Disable msaa unless requested from the env by NV30_MAX_MSAA</li>
-</ul>
-
-<p>Ian Romanick (2):</p>
-<ul>
-  <li>mesa: Pass the type to _mesa_uniform_matrix as a glsl_base_type</li>
-  <li>mesa: Don't allow wrong type setters for matrix uniforms</li>
-</ul>
-
-<p>Ilia Mirkin (5):</p>
-<ul>
-  <li>st/mesa: don't fall back to 16F when 32F is requested</li>
-  <li>nvc0: always emit a full shader colormask</li>
-  <li>nvc0: remove BGRA4 format support</li>
-  <li>st/mesa: avoid integer overflows with buffers &gt;= 512MB</li>
-  <li>nv50, nvc0: fix max texture buffer size to 128M elements</li>
-</ul>
-
-<p>Jason Ekstrand (1):</p>
-<ul>
-  <li>i965/vec4: Don't reswizzle hardware registers</li>
-</ul>
-
-<p>Jose Fonseca (1):</p>
-<ul>
-  <li>gallivm: Workaround LLVM PR23628.</li>
-</ul>
-
-<p>Kenneth Graunke (1):</p>
-<ul>
-  <li>i965: Momentarily pretend to support ARB_texture_stencil8 for blits.</li>
-</ul>
-
-<p>Oded Gabbay (1):</p>
-<ul>
-  <li>llvmpipe: convert double to long long instead of unsigned long long</li>
-</ul>
-
-<p>Ray Strode (1):</p>
-<ul>
-  <li>gbm: convert gbm bo format to fourcc format on dma-buf import</li>
-</ul>
-
-<p>Ulrich Weigand (1):</p>
-<ul>
-  <li>mesa: Fix texture compression on big-endian systems</li>
-</ul>
-
-<p>Vinson Lee (1):</p>
-<ul>
-  <li>gallivm: Do not use NoFramePointerElim with LLVM 3.7.</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/10.6.9.html

@@ -1,130 +0,0 @@
-<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
-<html lang="en">
-<head>
-  <meta http-equiv="content-type" content="text/html; charset=utf-8">
-  <title>Mesa Release Notes</title>
-  <link rel="stylesheet" type="text/css" href="../mesa.css">
-</head>
-<body>
-
-<div class="header">
-  <h1>The Mesa 3D Graphics Library</h1>
-</div>
-
-<iframe src="../contents.html"></iframe>
-<div class="content">
-
-<h1>Mesa 10.6.9 Release Notes / Octover 03, 2015</h1>
-
-<p>
-Mesa 10.6.9 is a bug fix release which fixes bugs found since the 10.6.8 release.
-</p>
-<p>
-Mesa 10.6.9 implements the OpenGL 3.3 API, but the version reported by
-glGetString(GL_VERSION) or glGetIntegerv(GL_MAJOR_VERSION) /
-glGetIntegerv(GL_MINOR_VERSION) depends on the particular driver being used.
-Some drivers don't support all the features required in OpenGL 3.3.  OpenGL
-3.3 is <strong>only</strong> available if requested at context creation
-because compatibility contexts are not supported.
-</p>
-
-
-<h2>SHA256 checksums</h2>
-<pre>
-3406876aac67546d0c3e2cb97da330b62644c313e7992b95618662e13c54296a  mesa-10.6.9.tar.gz
-b04c4de6280b863babc2929573da17218d92e9e4ba6272d548d135415723e8c3  mesa-10.6.9.tar.xz
-</pre>
-
-
-<h2>New features</h2>
-<p>None</p>
-
-<h2>Bug fixes</h2>
-
-<p>This list is likely incomplete.</p>
-
-<ul>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=38109">Bug 38109</a> - i915 driver crashes if too few vertices are submitted (Mesa 7.10.2)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=55552">Bug 55552</a> - Compile errors with --enable-mangling</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=86281">Bug 86281</a> - brw_meta_fast_clear (brw=brw&#64;entry=0x7fffd4097a08, fb=fb&#64;entry=0x7fffd40fa900, buffers=buffers&#64;entry=2, partial_clear=partial_clear&#64;entry=false)</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=91970">Bug 91970</a> - [BSW regression] dEQP-GLES3.functional.shaders.precision.int.highp_mul_vertex</li>
-
-<li><a href="https://bugs.freedesktop.org/show_bug.cgi?id=92072">Bug 92072</a> - Wine breakage since d082c5324 (st/mesa: don't call st_validate_state in BlitFramebuffer)</li>
-
-</ul>
-
-
-<h2>Changes</h2>
-
-<p>Brian Paul (1):</p>
-<ul>
-  <li>st/mesa: try PIPE_BIND_RENDER_TARGET when choosing float texture formats</li>
-</ul>
-
-<p>Chris Wilson (1):</p>
-<ul>
-  <li>i965: Remove early release of DRI2 miptree</li>
-</ul>
-
-<p>Emil Velikov (4):</p>
-<ul>
-  <li>docs: add sha256 checksums for 10.6.8</li>
-  <li>cherry-ignore: add commit non applicable for 10.6</li>
-  <li>cherry-ignore: add commit non applicable for 10.6</li>
-  <li>Update version to 10.6.9</li>
-</ul>
-
-<p>Iago Toral Quiroga (1):</p>
-<ul>
-  <li>mesa: Fix GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE for default framebuffer.</li>
-</ul>
-
-<p>Ian Romanick (5):</p>
-<ul>
-  <li>t_dd_dmatmp: Make "count" actually be the count</li>
-  <li>t_dd_dmatmp: Clean up improper code formatting from previous patch</li>
-  <li>t_dd_dmatmp: Use '&amp; 3' instead of '% 4' everywhere</li>
-  <li>t_dd_dmatmp: Pull out common 'count -= count &amp; 3' code</li>
-  <li>t_dd_dmatmp: Use addition instead of subtraction in loop bounds</li>
-</ul>
-
-<p>Jeremy Huddleston (1):</p>
-<ul>
-  <li>configure.ac: Add support to enable read-only text segment on x86.</li>
-</ul>
-
-<p>Kristian Høgsberg Kristensen (1):</p>
-<ul>
-  <li>i965: Respect stride and subreg_offset for ATTR registers</li>
-</ul>
-
-<p>Kyle Brenneman (3):</p>
-<ul>
-  <li>glx: Fix build errors with --enable-mangling (v2)</li>
-  <li>mapi: Make _glapi_get_stub work with "gl" or "mgl" prefix.</li>
-  <li>glx: Don't hard-code the name "libGL.so.1" in driOpenDriver (v3)</li>
-</ul>
-
-<p>Leo Liu (1):</p>
-<ul>
-  <li>radeon/vce: fix vui time_scale zero error</li>
-</ul>
-
-<p>Marek Olšák (1):</p>
-<ul>
-  <li>st/mesa: fix front buffer regression after dropping st_validate_state in Blit</li>
-</ul>
-
-<p>Roland Scheidegger (1):</p>
-<ul>
-  <li>mesa: fix mipmap generation for immutable, compressed textures</li>
-</ul>
-
-
-</div>
-</body>
-</html>

docs/relnotes/7.10.html

@@ -1693,7 +1693,7 @@ bc644be551ed585fc4f66c16b64a91c9  MesaGLUT-7.10.tar.gz
   <li>llvmpipe: Special case complementary and identify blend factors in SoA.</li>
   <li>llvmpipe: Make rgb/alpha bland func/factors match, when there is no alpha.</li>
   <li>draw: Prevent clipped vertices overflow.</li>
-  <li>draw: Fulfil the new min_lod/max_lod/lod_bias/border_color dynamic state</li>
+  <li>draw: Fullfil the new min_lod/max_lod/lod_bias/border_color dynamic state</li>
   <li>gallivm: Fetch the lod from the dynamic state when min_lod == max_lod.</li>
   <li>gallivm: Remove dead experimental code.</li>
   <li>llvmpipe: Decouple sampler view and sampler state updates.</li>

docs/relnotes/7.6.html

@@ -48,7 +48,7 @@ c49c19c2bbef4f3b7f1389974dff25f4  MesaGLUT-7.6.zip
 
 <h2>New features</h2>
 <ul>
-<li>OpenVG front-end (state tracker for Gallium).
+<li><a href="../openvg.html">OpenVG</a> front-end (state tracker for Gallium).
 This was written by Zack Rusin at Tungsten Graphics.
 <li>GL_ARB_vertex_array_object and GL_APPLE_vertex_array_object extensions
     (supported in Gallium drivers, Intel DRI drivers, and software drivers)</li>

docs/sourcetree.html

@@ -133,8 +133,10 @@ each directory.
        <ul>
        <li><b>clover</b> - OpenCL state tracker
        <li><b>dri</b> - Meta state tracker for DRI drivers
+       <li><b>egl</b> - Meta state tracker for EGL drivers
        <li><b>glx</b> - Meta state tracker for GLX
        <li><b>vdpau</b> - VDPAU state tracker
+       <li><b>vega</b> - OpenVG 1.x state tracker
        <li><b>wgl</b> -
        <li><b>xorg</b> - Meta state tracker for Xorg video drivers
        <li><b>xvmc</b> - XvMC state tracker

docs/specs/MESA_image_dma_buf_export.txt

@@ -1,147 +0,0 @@
-Name
-
-    MESA_image_dma_buf_export
-
-Name Strings
-
-    EGL_MESA_image_dma_buf_export
-
-Contributors
-
-    Dave Airlie
-
-Contact
-
-    Dave Airlie (airlied 'at' redhat 'dot' com)
-
-Status
-
-    Complete, shipping.
-
-Version
-
-    Version 3, May 5, 2015
-
-Number
-
-    EGL Extension #87
-
-Dependencies
-
-    Requires EGL 1.4 or later.  This extension is written against the
-    wording of the EGL 1.4 specification.
-
-    EGL_KHR_base_image is required.
-
-    The EGL implementation must be running on a Linux kernel supporting the
-    dma_buf buffer sharing mechanism.
-
-Overview
-
-    This extension provides entry points for integrating EGLImage with the
-    dma-buf infrastructure.  The extension allows creating a Linux dma_buf
-    file descriptor or multiple file descriptors, in the case of multi-plane
-    YUV image, from an EGLImage.
-
-    It is designed to provide the complementary functionality to
-    EGL_EXT_image_dma_buf_import.
-
-IP Status
-
-    Open-source; freely implementable.
-
-New Types
-
-    This extension uses the 64-bit unsigned integer type EGLuint64KHR
-    first introduced by the EGL_KHR_stream extension, but does not
-    depend on that extension. The typedef may be reproduced separately
-    for this extension, if not already present in eglext.h.
-
-    typedef khronos_uint64_t EGLuint64KHR;
-
-New Procedures and Functions
-
-    EGLBoolean eglExportDMABUFImageQueryMESA(EGLDisplay dpy,
-                                  EGLImageKHR image,
-				  int *fourcc,
-				  int *num_planes,
-				  EGLuint64KHR *modifiers);
-
-    EGLBoolean eglExportDMABUFImageMESA(EGLDisplay dpy,
-                                        EGLImageKHR image,
-                                        int *fds,
-				        EGLint *strides,
-					EGLint *offsets);
-
-New Tokens
-
-    None
-
-
-Additions to the EGL 1.4 Specification:
-
-    To mirror the import extension, this extension attempts to return
-    enough information to enable an exported dma-buf to be imported
-    via eglCreateImageKHR and EGL_LINUX_DMA_BUF_EXT token.
-
-    Retrieving the information is a two step process, so two APIs
-    are required.
-
-    The first entrypoint
-       EGLBoolean eglExportDMABUFImageQueryMESA(EGLDisplay dpy,
-                                  EGLImageKHR image,
-				  int *fourcc,
-				  int *num_planes,
-				  EGLuint64KHR *modifiers);
-
-    is used to retrieve the pixel format of the buffer, as specified by
-    drm_fourcc.h, the number of planes in the image and the Linux
-    drm modifiers. <fourcc>, <num_planes> and <modifiers> may be NULL,
-    in which case no value is retrieved.
-
-    The second entrypoint retrieves the dma_buf file descriptors,
-    strides and offsets for the image. The caller should pass
-    arrays sized according to the num_planes values retrieved previously.
-    Passing arrays of the wrong size will have undefined results.
-    If the number of fds is less than the number of planes, then
-    subsequent fd slots should contain -1.
-
-        EGLBoolean eglExportDMABUFImageMESA(EGLDisplay dpy,
-                                         EGLImageKHR image,
-					 int *fds,
-                                         EGLint *strides,
-                                         EGLint *offsets);
-
-    <fds>, <strides>, <offsets> can be NULL if the infomatation isn't
-    required by the caller.
-
-Issues
-
-1. Should the API look more like an attribute getting API?
-
-ANSWER: No, from a user interface pov, having to iterate across calling
-the API up to 12 times using attribs seems like the wrong solution.
-
-2. Should the API take a plane and just get the fd/stride/offset for that
-   plane?
-
-ANSWER: UNKNOWN,this might be just as valid an API.
-
-3. Does ownership of the file descriptor remain with the app?
-
-ANSWER: Yes, the app is responsible for closing any fds retrieved.
-
-4. If number of planes and number of fds differ what should we do?
-
-ANSWER: Return -1 for the secondary slots, as this avoids having
-to dup the fd extra times to make the interface sane.
-
-Revision History
-
-    Version 3, May, 2015
-        Just use the KHR 64-bit type.
-    Version 2, March, 2015
-        Add a query interface (Dave Airlie)
-    Version 1, June 3, 2014
-        Initial draft (Dave Airlie)
-

docs/versions.html

@@ -150,7 +150,7 @@ New features:
 Changes:
 <ul>
 <li>renamed aux.h as glaux.h (MS-DOS names can't start with aux)
-<li>most filenames are in 8.3 format to accommodate MS-DOS
+<li>most filenames are in 8.3 format to accomodate MS-DOS
 <li>use GLubytes to store arrays of colors instead of GLints
 </ul>
 
@@ -1224,7 +1224,7 @@ Bug fixes:
 </ul>
 Changes:
 <ul>
-<li>max texture units reduced to six to accommodate texture rectangles
+<li>max texture units reduced to six to accomodate texture rectangles
 <li>removed unfinished GL_MESA_sprite_point extension code
 </ul>
 

docs/viewperf.html

@@ -19,7 +19,6 @@
 <p>
 This page lists known issues with
 <a href="http://www.spec.org/gwpg/gpc.static/vp11info.html" target="_main">SPEC Viewperf 11</a>
-and <a href="https://www.spec.org/gwpg/gpc.static/vp12info.html" target="_main">SPEC Viewperf 12</a>
 when running on Mesa-based drivers.
 </p>
 
@@ -41,15 +40,13 @@ These issues have been reported to the SPEC organization in the hope that
 they'll be fixed in the future.
 </p>
 
-<h2><u>Viewperf 11</u></h2>
-
 <p>
-Some of the Viewperf 11 tests use a lot of memory.
+Some of the Viewperf tests use a lot of memory.
 At least 2GB of RAM is recommended.
 </p>
 
 
-<h3>Catia-03 test 2</h3>
+<h2>Catia-03 test 2</h2>
 
 <p>
 This test creates over 38000 vertex buffer objects.  On some systems
@@ -62,7 +59,7 @@ either in Viewperf or the Mesa driver.
 
 
 
-<h3>Catia-03 tests 3, 4, 8</h3>
+<h2>Catia-03 tests 3, 4, 8</h2>
 
 <p>
 These tests use features of the
@@ -82,7 +79,7 @@ Subsequent drawing calls become no-ops and the rendering is incorrect.
 
 
 
-<h3>sw-02 tests 1, 2, 4, 6</h3>
+<h2>sw-02 tests 1, 2, 4, 6</h2>
 
 <p>
 These tests depend on the
@@ -102,7 +99,7 @@ color.  This is probably due to some uninitialized state somewhere.
 
 
 
-<h3>sw-02 test 6</h3>
+<h2>sw-02 test 6</h2>
 
 <p>
 The lines drawn in this test appear in a random color.
@@ -114,7 +111,7 @@ situation, we get a random color.
 
 
 
-<h3>Lightwave-01 test 3</h3>
+<h2>Lightwave-01 test 3</h2>
 
 <p>
 This test uses a number of mipmapped textures, but the textures are
@@ -175,7 +172,7 @@ However, we have no plans to implement this work-around in Mesa.
 </p>
 
 
-<h3>Maya-03 test 2</h3>
+<h2>Maya-03 test 2</h2>
 
 <p>
 This test makes some unusual calls to glRotate.  For example:
@@ -207,7 +204,7 @@ and with a semi-random color (between white and black) since GL_FOG is enabled.
 </p>
 
 
-<h3>Proe-05 test 1</h3>
+<h2>Proe-05 test 1</h2>
 
 <p>
 This uses depth testing but there's two problems:
@@ -235,7 +232,7 @@ glClear is called so clearing the depth buffer would be a no-op anyway.
 </p>
 
 
-<h3>Proe-05 test 6</h3>
+<h2>Proe-05 test 6</h2>
 
 <p>
 This test draws an engine model with a two-pass algorithm.
@@ -264,86 +261,6 @@ blending with appropriate patterns/modes to ensure the same fragments
 are produced in both passes.
 </p>
 
-<h2><u>Viewperf 12</u></h2>
-
-<p>
-Note that Viewperf 12 only runs on 64-bit Windows 7 or later.
-</p>
-
-<h3>catia-04</h3>
-
-<p>
-One of the catia tests calls wglGetProcAddress() to get some
-GL_EXT_direct_state_access functions (such as glBindMultiTextureEXT) and some
-GL_NV_half_float functions (such as glMultiTexCoord3hNV).
-If the extension/function is not supported, wglGetProcAddress() can return NULL.
-Unfortunately, Viewperf doesn't check for null pointers and crashes when it
-later tries to use the pointer.
-</p>
-
-<p>
-Another catia test uses OpenGL 3.1's primitive restart feature.
-But when Viewperf creates an OpenGL context, it doesn't request version 3.1
-If the driver returns version 3.0 or earlier all the calls related to primitive
-restart generate an OpenGL error.
-Some of the rendering is then incorrect.
-</p>
-
-
-<h3>energy-01</h3>
-
-<p>
-This test creates a 3D luminance texture of size 1K x 1K x 1K.
-If the OpenGL driver/device doesn't support a texture of this size
-the glTexImage3D() call will fail with GL_INVALID_VALUE or GL_OUT_OF_MEMORY
-and all that's rendered is plain white polygons.
-Ideally, the test would use a proxy texture to determine the max 3D
-texture size.  But it does not do that.
-</p>
-
-<h3>maya-04</h3>
-
-<p>
-This test generates many GL_INVALID_OPERATION errors in its calls to
-glUniform().
-Causes include:
-<ul>
-<li> Trying to set float uniforms with glUniformi()
-<li> Trying to set float uniforms with glUniform3f()
-<li> Trying to set matrix uniforms with glUniform() instead of glUniformMatrix().
-</ul>
-<p>
-Apparently, the indexes returned by glGetUniformLocation() were hard-coded
-into the application trace when it was created.
-Since different implementations of glGetUniformLocation() may return different
-values for any given uniform name, subsequent calls to glUniform() will be
-invalid since they refer to the wrong uniform variables.
-This causes many OpenGL errors and leads to incorrect rendering.
-</p>
-
-<h3>medical-01</h3>
-
-<p>
-This test uses a single GLSL fragment shader which contains a GLSL 1.20
-array initializer statement, but it neglects to specify
-<code>#version 120</code> at the top of the shader code.
-So, the shader does not compile and all that's rendered is plain white polygons.
-</p>
-<p>
-Also, the test tries to create a very large 3D texture that may exceed
-the device driver's limit.
-When this happens, the glTexImage3D call fails and all that's rendered is
-a white box.
-</p>
-
-
-<h3>showcase-01</h3>
-
-<p>
-This is actually a DX11 test based on Autodesk's Showcase product.
-As such, it won't run with Mesa.
-</p>
-
 
 </div>
 </body>

include/D3D9/d3d9caps.h

@@ -1,387 +0,0 @@
-/*
- * Copyright 2011 Joakim Sindholt <opensource@zhasha.com>
- *
- * Permission is hereby granted, free of charge, to any person obtaining a
- * copy of this software and associated documentation files (the "Software"),
- * to deal in the Software without restriction, including without limitation
- * on the rights to use, copy, modify, merge, publish, distribute, sub
- * license, and/or sell copies of the Software, and to permit persons to whom
- * the Software is furnished to do so, subject to the following conditions:
- *
- * The above copyright notice and this permission notice (including the next
- * paragraph) shall be included in all copies or substantial portions of the
- * Software.
- *
- * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
- * IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
- * FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. IN NO EVENT SHALL
- * THE AUTHOR(S) AND/OR THEIR SUPPLIERS BE LIABLE FOR ANY CLAIM,
- * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
- * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE
- * USE OR OTHER DEALINGS IN THE SOFTWARE. */
-
-#ifndef _D3D9CAPS_H_
-#define _D3D9CAPS_H_
-
-#include "d3d9types.h"
-
-/* Caps flags */
-#define D3DCAPS2_FULLSCREENGAMMA   0x00020000
-#define D3DCAPS2_CANCALIBRATEGAMMA 0x00100000
-#define D3DCAPS2_RESERVED          0x02000000
-#define D3DCAPS2_CANMANAGERESOURCE 0x10000000
-#define D3DCAPS2_DYNAMICTEXTURES   0x20000000
-#define D3DCAPS2_CANAUTOGENMIPMAP  0x40000000
-#define D3DCAPS2_CANSHARERESOURCE  0x80000000
-
-#define D3DCAPS3_ALPHA_FULLSCREEN_FLIP_OR_DISCARD 0x00000020
-#define D3DCAPS3_LINEAR_TO_SRGB_PRESENTATION      0x00000080
-#define D3DCAPS3_COPY_TO_VIDMEM                   0x00000100
-#define D3DCAPS3_COPY_TO_SYSTEMMEM                0x00000200
-#define D3DCAPS3_DXVAHD                           0x00000400
-#define D3DCAPS3_RESERVED                         0x8000001F
-
-#define D3DPRESENT_INTERVAL_DEFAULT   0x00000000
-#define D3DPRESENT_INTERVAL_ONE       0x00000001
-#define D3DPRESENT_INTERVAL_TWO       0x00000002
-#define D3DPRESENT_INTERVAL_THREE     0x00000004
-#define D3DPRESENT_INTERVAL_FOUR      0x00000008
-#define D3DPRESENT_INTERVAL_IMMEDIATE 0x80000000
-
-#define D3DCURSORCAPS_COLOR  0x00000001
-#define D3DCURSORCAPS_LOWRES 0x00000002
-
-#define D3DDEVCAPS_EXECUTESYSTEMMEMORY     0x00000010
-#define D3DDEVCAPS_EXECUTEVIDEOMEMORY      0x00000020
-#define D3DDEVCAPS_TLVERTEXSYSTEMMEMORY    0x00000040
-#define D3DDEVCAPS_TLVERTEXVIDEOMEMORY     0x00000080
-#define D3DDEVCAPS_TEXTURESYSTEMMEMORY     0x00000100
-#define D3DDEVCAPS_TEXTUREVIDEOMEMORY      0x00000200
-#define D3DDEVCAPS_DRAWPRIMTLVERTEX        0x00000400
-#define D3DDEVCAPS_CANRENDERAFTERFLIP      0x00000800
-#define D3DDEVCAPS_TEXTURENONLOCALVIDMEM   0x00001000
-#define D3DDEVCAPS_DRAWPRIMITIVES2         0x00002000
-#define D3DDEVCAPS_SEPARATETEXTUREMEMORIES 0x00004000
-#define D3DDEVCAPS_DRAWPRIMITIVES2EX       0x00008000
-#define D3DDEVCAPS_HWTRANSFORMANDLIGHT     0x00010000
-#define D3DDEVCAPS_CANBLTSYSTONONLOCAL     0x00020000
-#define D3DDEVCAPS_HWRASTERIZATION         0x00080000
-#define D3DDEVCAPS_PUREDEVICE              0x00100000
-#define D3DDEVCAPS_QUINTICRTPATCHES        0x00200000
-#define D3DDEVCAPS_RTPATCHES               0x00400000
-#define D3DDEVCAPS_RTPATCHHANDLEZERO       0x00800000
-#define D3DDEVCAPS_NPATCHES                0x01000000
-
-#define D3DPMISCCAPS_MASKZ                      0x00000002
-#define D3DPMISCCAPS_CULLNONE                   0x00000010
-#define D3DPMISCCAPS_CULLCW                     0x00000020
-#define D3DPMISCCAPS_CULLCCW                    0x00000040
-#define D3DPMISCCAPS_COLORWRITEENABLE           0x00000080
-#define D3DPMISCCAPS_CLIPPLANESCALEDPOINTS      0x00000100
-#define D3DPMISCCAPS_CLIPTLVERTS                0x00000200
-#define D3DPMISCCAPS_TSSARGTEMP                 0x00000400
-#define D3DPMISCCAPS_BLENDOP                    0x00000800
-#define D3DPMISCCAPS_NULLREFERENCE              0x00001000
-#define D3DPMISCCAPS_INDEPENDENTWRITEMASKS      0x00004000
-#define D3DPMISCCAPS_PERSTAGECONSTANT           0x00008000
-#define D3DPMISCCAPS_FOGANDSPECULARALPHA        0x00010000
-#define D3DPMISCCAPS_SEPARATEALPHABLEND         0x00020000
-#define D3DPMISCCAPS_MRTINDEPENDENTBITDEPTHS    0x00040000
-#define D3DPMISCCAPS_MRTPOSTPIXELSHADERBLENDING 0x00080000
-#define D3DPMISCCAPS_FOGVERTEXCLAMPED           0x00100000
-#define D3DPMISCCAPS_POSTBLENDSRGBCONVERT       0x00200000
-
-#define D3DPRASTERCAPS_DITHER              0x00000001
-#define D3DPRASTERCAPS_ZTEST               0x00000010
-#define D3DPRASTERCAPS_FOGVERTEX           0x00000080
-#define D3DPRASTERCAPS_FOGTABLE            0x00000100
-#define D3DPRASTERCAPS_MIPMAPLODBIAS       0x00002000
-#define D3DPRASTERCAPS_ZBUFFERLESSHSR      0x00008000
-#define D3DPRASTERCAPS_FOGRANGE            0x00010000
-#define D3DPRASTERCAPS_ANISOTROPY          0x00020000
-#define D3DPRASTERCAPS_WBUFFER             0x00040000
-#define D3DPRASTERCAPS_WFOG                0x00100000
-#define D3DPRASTERCAPS_ZFOG                0x00200000
-#define D3DPRASTERCAPS_COLORPERSPECTIVE    0x00400000
-#define D3DPRASTERCAPS_SCISSORTEST         0x01000000
-#define D3DPRASTERCAPS_SLOPESCALEDEPTHBIAS 0x02000000
-#define D3DPRASTERCAPS_DEPTHBIAS           0x04000000
-#define D3DPRASTERCAPS_MULTISAMPLE_TOGGLE  0x08000000
-
-#define D3DPCMPCAPS_NEVER        0x00000001
-#define D3DPCMPCAPS_LESS         0x00000002
-#define D3DPCMPCAPS_EQUAL        0x00000004
-#define D3DPCMPCAPS_LESSEQUAL    0x00000008
-#define D3DPCMPCAPS_GREATER      0x00000010
-#define D3DPCMPCAPS_NOTEQUAL     0x00000020
-#define D3DPCMPCAPS_GREATEREQUAL 0x00000040
-#define D3DPCMPCAPS_ALWAYS       0x00000080
-
-#define D3DPBLENDCAPS_ZERO            0x00000001
-#define D3DPBLENDCAPS_ONE             0x00000002
-#define D3DPBLENDCAPS_SRCCOLOR        0x00000004
-#define D3DPBLENDCAPS_INVSRCCOLOR     0x00000008
-#define D3DPBLENDCAPS_SRCALPHA        0x00000010
-#define D3DPBLENDCAPS_INVSRCALPHA     0x00000020
-#define D3DPBLENDCAPS_DESTALPHA       0x00000040
-#define D3DPBLENDCAPS_INVDESTALPHA    0x00000080
-#define D3DPBLENDCAPS_DESTCOLOR       0x00000100
-#define D3DPBLENDCAPS_INVDESTCOLOR    0x00000200
-#define D3DPBLENDCAPS_SRCALPHASAT     0x00000400
-#define D3DPBLENDCAPS_BOTHSRCALPHA    0x00000800
-#define D3DPBLENDCAPS_BOTHINVSRCALPHA 0x00001000
-#define D3DPBLENDCAPS_BLENDFACTOR     0x00002000
-#ifndef D3D_DISABLE_9EX
-# define D3DPBLENDCAPS_SRCCOLOR2      0x00004000
-# define D3DPBLENDCAPS_INVSRCCOLOR2   0x00008000
-#endif
-
-#define D3DPSHADECAPS_COLORGOURAUDRGB    0x00000008
-#define D3DPSHADECAPS_SPECULARGOURAUDRGB 0x00000200
-#define D3DPSHADECAPS_ALPHAGOURAUDBLEND  0x00004000
-#define D3DPSHADECAPS_FOGGOURAUD         0x00080000
-
-#define D3DPTEXTURECAPS_PERSPECTIVE              0x00000001
-#define D3DPTEXTURECAPS_POW2                     0x00000002
-#define D3DPTEXTURECAPS_ALPHA                    0x00000004
-#define D3DPTEXTURECAPS_SQUAREONLY               0x00000020
-#define D3DPTEXTURECAPS_TEXREPEATNOTSCALEDBYSIZE 0x00000040
-#define D3DPTEXTURECAPS_ALPHAPALETTE             0x00000080
-#define D3DPTEXTURECAPS_NONPOW2CONDITIONAL       0x00000100
-#define D3DPTEXTURECAPS_PROJECTED                0x00000400
-#define D3DPTEXTURECAPS_CUBEMAP                  0x00000800
-#define D3DPTEXTURECAPS_VOLUMEMAP                0x00002000
-#define D3DPTEXTURECAPS_MIPMAP                   0x00004000
-#define D3DPTEXTURECAPS_MIPVOLUMEMAP             0x00008000
-#define D3DPTEXTURECAPS_MIPCUBEMAP               0x00010000
-#define D3DPTEXTURECAPS_CUBEMAP_POW2             0x00020000
-#define D3DPTEXTURECAPS_VOLUMEMAP_POW2           0x00040000
-#define D3DPTEXTURECAPS_NOPROJECTEDBUMPENV       0x00200000
-
-#define D3DPTFILTERCAPS_MINFPOINT         0x00000100
-#define D3DPTFILTERCAPS_MINFLINEAR        0x00000200
-#define D3DPTFILTERCAPS_MINFANISOTROPIC   0x00000400
-#define D3DPTFILTERCAPS_MINFPYRAMIDALQUAD 0x00000800
-#define D3DPTFILTERCAPS_MINFGAUSSIANQUAD  0x00001000
-#define D3DPTFILTERCAPS_MIPFPOINT         0x00010000
-#define D3DPTFILTERCAPS_MIPFLINEAR        0x00020000
-#define D3DPTFILTERCAPS_MAGFPOINT         0x01000000
-#define D3DPTFILTERCAPS_MAGFLINEAR        0x02000000
-#define D3DPTFILTERCAPS_MAGFANISOTROPIC   0x04000000
-#define D3DPTFILTERCAPS_MAGFPYRAMIDALQUAD 0x08000000
-#define D3DPTFILTERCAPS_MAGFGAUSSIANQUAD  0x10000000
-
-#define D3DPTADDRESSCAPS_WRAP          0x00000001
-#define D3DPTADDRESSCAPS_MIRROR        0x00000002
-#define D3DPTADDRESSCAPS_CLAMP         0x00000004
-#define D3DPTADDRESSCAPS_BORDER        0x00000008
-#define D3DPTADDRESSCAPS_INDEPENDENTUV 0x00000010
-#define D3DPTADDRESSCAPS_MIRRORONCE    0x00000020
-
-#define D3DLINECAPS_TEXTURE   0x00000001
-#define D3DLINECAPS_ZTEST     0x00000002
-#define D3DLINECAPS_BLEND     0x00000004
-#define D3DLINECAPS_ALPHACMP  0x00000008
-#define D3DLINECAPS_FOG       0x00000010
-#define D3DLINECAPS_ANTIALIAS 0x00000020
-
-#define D3DSTENCILCAPS_KEEP     0x00000001
-#define D3DSTENCILCAPS_ZERO     0x00000002
-#define D3DSTENCILCAPS_REPLACE  0x00000004
-#define D3DSTENCILCAPS_INCRSAT  0x00000008
-#define D3DSTENCILCAPS_DECRSAT  0x00000010
-#define D3DSTENCILCAPS_INVERT   0x00000020
-#define D3DSTENCILCAPS_INCR     0x00000040
-#define D3DSTENCILCAPS_DECR     0x00000080
-#define D3DSTENCILCAPS_TWOSIDED 0x00000100
-
-#define D3DFVFCAPS_TEXCOORDCOUNTMASK  0x0000FFFF
-#define D3DFVFCAPS_DONOTSTRIPELEMENTS 0x00080000
-#define D3DFVFCAPS_PSIZE              0x00100000
-
-#define D3DTEXOPCAPS_DISABLE                   0x00000001
-#define D3DTEXOPCAPS_SELECTARG1                0x00000002
-#define D3DTEXOPCAPS_SELECTARG2                0x00000004
-#define D3DTEXOPCAPS_MODULATE                  0x00000008
-#define D3DTEXOPCAPS_MODULATE2X                0x00000010
-#define D3DTEXOPCAPS_MODULATE4X                0x00000020
-#define D3DTEXOPCAPS_ADD                       0x00000040
-#define D3DTEXOPCAPS_ADDSIGNED                 0x00000080
-#define D3DTEXOPCAPS_ADDSIGNED2X               0x00000100
-#define D3DTEXOPCAPS_SUBTRACT                  0x00000200
-#define D3DTEXOPCAPS_ADDSMOOTH                 0x00000400
-#define D3DTEXOPCAPS_BLENDDIFFUSEALPHA         0x00000800
-#define D3DTEXOPCAPS_BLENDTEXTUREALPHA         0x00001000
-#define D3DTEXOPCAPS_BLENDFACTORALPHA          0x00002000
-#define D3DTEXOPCAPS_BLENDTEXTUREALPHAPM       0x00004000
-#define D3DTEXOPCAPS_BLENDCURRENTALPHA         0x00008000
-#define D3DTEXOPCAPS_PREMODULATE               0x00010000
-#define D3DTEXOPCAPS_MODULATEALPHA_ADDCOLOR    0x00020000
-#define D3DTEXOPCAPS_MODULATECOLOR_ADDALPHA    0x00040000
-#define D3DTEXOPCAPS_MODULATEINVALPHA_ADDCOLOR 0x00080000
-#define D3DTEXOPCAPS_MODULATEINVCOLOR_ADDALPHA 0x00100000
-#define D3DTEXOPCAPS_BUMPENVMAP                0x00200000
-#define D3DTEXOPCAPS_BUMPENVMAPLUMINANCE       0x00400000
-#define D3DTEXOPCAPS_DOTPRODUCT3               0x00800000
-#define D3DTEXOPCAPS_MULTIPLYADD               0x01000000
-#define D3DTEXOPCAPS_LERP                      0x02000000
-
-#define D3DVTXPCAPS_TEXGEN                   0x00000001
-#define D3DVTXPCAPS_MATERIALSOURCE7          0x00000002
-#define D3DVTXPCAPS_DIRECTIONALLIGHTS        0x00000008
-#define D3DVTXPCAPS_POSITIONALLIGHTS         0x00000010
-#define D3DVTXPCAPS_LOCALVIEWER              0x00000020
-#define D3DVTXPCAPS_TWEENING                 0x00000040
-#define D3DVTXPCAPS_TEXGEN_SPHEREMAP         0x00000100
-#define D3DVTXPCAPS_NO_TEXGEN_NONLOCALVIEWER 0x00000200
-
-#define D3DDEVCAPS2_STREAMOFFSET                       0x00000001
-#define D3DDEVCAPS2_DMAPNPATCH                         0x00000002
-#define D3DDEVCAPS2_ADAPTIVETESSRTPATCH                0x00000004
-#define D3DDEVCAPS2_ADAPTIVETESSNPATCH                 0x00000008
-#define D3DDEVCAPS2_CAN_STRETCHRECT_FROM_TEXTURES      0x00000010
-#define D3DDEVCAPS2_PRESAMPLEDDMAPNPATCH               0x00000020
-#define D3DDEVCAPS2_VERTEXELEMENTSCANSHARESTREAMOFFSET 0x00000040
-
-#define D3DDTCAPS_UBYTE4    0x00000001
-#define D3DDTCAPS_UBYTE4N   0x00000002
-#define D3DDTCAPS_SHORT2N   0x00000004
-#define D3DDTCAPS_SHORT4N   0x00000008
-#define D3DDTCAPS_USHORT2N  0x00000010
-#define D3DDTCAPS_USHORT4N  0x00000020
-#define D3DDTCAPS_UDEC3     0x00000040
-#define D3DDTCAPS_DEC3N     0x00000080
-#define D3DDTCAPS_FLOAT16_2 0x00000100
-#define D3DDTCAPS_FLOAT16_4 0x00000200
-
-
-#define D3DVS20_MAX_DYNAMICFLOWCONTROLDEPTH  24
-#define D3DVS20_MIN_DYNAMICFLOWCONTROLDEPTH  0
-#define D3DVS20_MAX_NUMTEMPS                 32
-#define D3DVS20_MIN_NUMTEMPS                 12
-#define D3DVS20_MAX_STATICFLOWCONTROLDEPTH   4
-#define D3DVS20_MIN_STATICFLOWCONTROLDEPTH   1
-
-#define D3DVS20CAPS_PREDICATION              (1 << 0)
-
-#define D3DPS20CAPS_ARBITRARYSWIZZLE         (1 << 0)
-#define D3DPS20CAPS_GRADIENTINSTRUCTIONS     (1 << 1)
-#define D3DPS20CAPS_PREDICATION              (1 << 2)
-#define D3DPS20CAPS_NODEPENDENTREADLIMIT     (1 << 3)
-#define D3DPS20CAPS_NOTEXINSTRUCTIONLIMIT    (1 << 4)
-
-#define D3DPS20_MAX_DYNAMICFLOWCONTROLDEPTH  24
-#define D3DPS20_MIN_DYNAMICFLOWCONTROLDEPTH  0
-#define D3DPS20_MAX_NUMTEMPS                 32
-#define D3DPS20_MIN_NUMTEMPS                 12
-#define D3DPS20_MAX_STATICFLOWCONTROLDEPTH   4
-#define D3DPS20_MIN_STATICFLOWCONTROLDEPTH   0
-#define D3DPS20_MAX_NUMINSTRUCTIONSLOTS      512
-#define D3DPS20_MIN_NUMINSTRUCTIONSLOTS      96
-
-#define D3DMIN30SHADERINSTRUCTIONS          512
-#define D3DMAX30SHADERINSTRUCTIONS          32768
-
-/* Structs */
-typedef struct _D3DVSHADERCAPS2_0 {
-	DWORD Caps;
-	INT DynamicFlowControlDepth;
-	INT NumTemps;
-	INT StaticFlowControlDepth;
-} D3DVSHADERCAPS2_0, *PD3DVSHADERCAPS2_0, *LPD3DVSHADERCAPS2_0;
-
-typedef struct _D3DPSHADERCAPS2_0 {
-	DWORD Caps;
-	INT DynamicFlowControlDepth;
-	INT NumTemps;
-	INT StaticFlowControlDepth;
-	INT NumInstructionSlots;
-} D3DPSHADERCAPS2_0, *PD3DPSHADERCAPS2_0, *LPD3DPSHADERCAPS2_0;
-
-typedef struct _D3DCAPS9 {
-	D3DDEVTYPE DeviceType;
-	UINT AdapterOrdinal;
-	DWORD Caps;
-	DWORD Caps2;
-	DWORD Caps3;
-	DWORD PresentationIntervals;
-	DWORD CursorCaps;
-	DWORD DevCaps;
-	DWORD PrimitiveMiscCaps;
-	DWORD RasterCaps;
-	DWORD ZCmpCaps;
-	DWORD SrcBlendCaps;
-	DWORD DestBlendCaps;
-	DWORD AlphaCmpCaps;
-	DWORD ShadeCaps;
-	DWORD TextureCaps;
-	DWORD TextureFilterCaps;
-	DWORD CubeTextureFilterCaps;
-	DWORD VolumeTextureFilterCaps;
-	DWORD TextureAddressCaps;
-	DWORD VolumeTextureAddressCaps;
-	DWORD LineCaps;
-	DWORD MaxTextureWidth;
-	DWORD MaxTextureHeight;
-	DWORD MaxVolumeExtent;
-	DWORD MaxTextureRepeat;
-	DWORD MaxTextureAspectRatio;
-	DWORD MaxAnisotropy;
-	float MaxVertexW;
-	float GuardBandLeft;
-	float GuardBandTop;
-	float GuardBandRight;
-	float GuardBandBottom;
-	float ExtentsAdjust;
-	DWORD StencilCaps;
-	DWORD FVFCaps;
-	DWORD TextureOpCaps;
-	DWORD MaxTextureBlendStages;
-	DWORD MaxSimultaneousTextures;
-	DWORD VertexProcessingCaps;
-	DWORD MaxActiveLights;
-	DWORD MaxUserClipPlanes;
-	DWORD MaxVertexBlendMatrices;
-	DWORD MaxVertexBlendMatrixIndex;
-	float MaxPointSize;
-	DWORD MaxPrimitiveCount;
-	DWORD MaxVertexIndex;
-	DWORD MaxStreams;
-	DWORD MaxStreamStride;
-	DWORD VertexShaderVersion;
-	DWORD MaxVertexShaderConst;
-	DWORD PixelShaderVersion;
-	float PixelShader1xMaxValue;
-	DWORD DevCaps2;
-	float MaxNpatchTessellationLevel;
-	DWORD Reserved5;
-	UINT MasterAdapterOrdinal;
-	UINT AdapterOrdinalInGroup;
-	UINT NumberOfAdaptersInGroup;
-	DWORD DeclTypes;
-	DWORD NumSimultaneousRTs;
-	DWORD StretchRectFilterCaps;
-	D3DVSHADERCAPS2_0 VS20Caps;
-	D3DPSHADERCAPS2_0 PS20Caps;
-	DWORD VertexTextureFilterCaps;
-	DWORD MaxVShaderInstructionsExecuted;
-	DWORD MaxPShaderInstructionsExecuted;
-	DWORD MaxVertexShader30InstructionSlots;
-	DWORD MaxPixelShader30InstructionSlots;
-} D3DCAPS9, *PD3DCAPS9, *LPD3DCAPS9;
-
-typedef struct _D3DCONTENTPROTECTIONCAPS {
-    DWORD Caps;
-    GUID KeyExchangeType;
-    UINT BufferAlignmentStart;
-    UINT BlockAlignmentSize;
-    ULONGLONG ProtectedMemorySize;
-} D3DCONTENTPROTECTIONCAPS, *PD3DCONTENTPROTECTIONCAPS, *LPD3DCONTENTPROTECTIONCAPS;
-
-typedef struct _D3DOVERLAYCAPS {
-    UINT Caps;
-    UINT MaxOverlayDisplayWidth;
-    UINT MaxOverlayDisplayHeight;
-} D3DOVERLAYCAPS, *PD3DOVERLAYCAPS, *LPD3DOVERLAYCAPS;
-
-#endif /* _D3D9CAPS_H_ */

include/EGL/eglext.h

@@ -646,7 +646,6 @@ EGLAPI EGLuint64NV EGLAPIENTRY eglGetSystemTimeNV (void);
 #endif /* EGL_NV_system_time */
 
 #include <EGL/eglmesaext.h>
-#include <EGL/eglextchromium.h>
 
 #ifdef __cplusplus
 }

include/EGL/eglextchromium.h

@@ -1,60 +0,0 @@
-// Copyright (c) 2013 The Chromium Authors. All rights reserved.
-//
-// Redistribution and use in source and binary forms, with or without
-// modification, are permitted provided that the following conditions are
-// met:
-//
-//    * Redistributions of source code must retain the above copyright
-// notice, this list of conditions and the following disclaimer.
-//    * Redistributions in binary form must reproduce the above
-// copyright notice, this list of conditions and the following disclaimer
-// in the documentation and/or other materials provided with the
-// distribution.
-//    * Neither the name of Google Inc. nor the names of its
-// contributors may be used to endorse or promote products derived from
-// this software without specific prior written permission.
-//
-// THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS
-// "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT
-// LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR
-// A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT
-// OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
-// SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT
-// LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
-// DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY
-// THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
-// (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE
-// OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
-
-// This file contains Chromium-specific EGL extensions declarations.
-
-#ifndef GPU_EGL_EGLEXTCHROMIUM_H_
-#define GPU_EGL_EGLEXTCHROMIUM_H_
-
-#ifdef __cplusplus
-extern "C" {
-#endif
-
-#include <EGL/eglplatform.h>
-
-/* EGLSyncControlCHROMIUM requires 64-bit uint support */
-#if KHRONOS_SUPPORT_INT64
-#ifndef EGL_CHROMIUM_sync_control
-#define EGL_CHROMIUM_sync_control 1
-typedef khronos_uint64_t EGLuint64CHROMIUM;
-#ifdef EGL_EGLEXT_PROTOTYPES
-EGLAPI EGLBoolean EGLAPIENTRY eglGetSyncValuesCHROMIUM(
-    EGLDisplay dpy, EGLSurface surface, EGLuint64CHROMIUM *ust,
-    EGLuint64CHROMIUM *msc, EGLuint64CHROMIUM *sbc);
-#endif /* EGL_EGLEXT_PROTOTYPES */
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETSYNCVALUESCHROMIUMPROC)
-    (EGLDisplay dpy, EGLSurface surface, EGLuint64CHROMIUM *ust,
-     EGLuint64CHROMIUM *msc, EGLuint64CHROMIUM *sbc);
-#endif
-#endif
-
-#ifdef __cplusplus
-}
-#endif
-
-#endif // GPU_EGL_EGLEXTCHROMIUM_H_

include/EGL/eglmesaext.h

@@ -34,6 +34,63 @@ extern "C" {
 
 #include <EGL/eglplatform.h>
 
+/* EGL_MESA_screen extension  >>> PRELIMINARY <<< */
+#ifndef EGL_MESA_screen_surface
+#define EGL_MESA_screen_surface 1
+
+#define EGL_BAD_SCREEN_MESA                    0x4000
+#define EGL_BAD_MODE_MESA                      0x4001
+#define EGL_SCREEN_COUNT_MESA                  0x4002
+#define EGL_SCREEN_POSITION_MESA               0x4003
+#define EGL_SCREEN_POSITION_GRANULARITY_MESA   0x4004
+#define EGL_MODE_ID_MESA                       0x4005
+#define EGL_REFRESH_RATE_MESA                  0x4006
+#define EGL_OPTIMAL_MESA                       0x4007
+#define EGL_INTERLACED_MESA                    0x4008
+#define EGL_SCREEN_BIT_MESA                    0x08
+
+typedef khronos_uint32_t EGLScreenMESA;
+typedef khronos_uint32_t EGLModeMESA;
+
+#ifdef EGL_EGLEXT_PROTOTYPES
+EGLAPI EGLBoolean EGLAPIENTRY eglChooseModeMESA(EGLDisplay dpy, EGLScreenMESA screen, const EGLint *attrib_list, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
+EGLAPI EGLBoolean EGLAPIENTRY eglGetModesMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
+EGLAPI EGLBoolean EGLAPIENTRY eglGetModeAttribMESA(EGLDisplay dpy, EGLModeMESA mode, EGLint attribute, EGLint *value);
+EGLAPI EGLBoolean EGLAPIENTRY eglGetScreensMESA(EGLDisplay dpy, EGLScreenMESA *screens, EGLint max_screens, EGLint *num_screens);
+EGLAPI EGLSurface EGLAPIENTRY eglCreateScreenSurfaceMESA(EGLDisplay dpy, EGLConfig config, const EGLint *attrib_list);
+EGLAPI EGLBoolean EGLAPIENTRY eglShowScreenSurfaceMESA(EGLDisplay dpy, EGLint screen, EGLSurface surface, EGLModeMESA mode);
+EGLAPI EGLBoolean EGLAPIENTRY eglScreenPositionMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLint x, EGLint y);
+EGLAPI EGLBoolean EGLAPIENTRY eglQueryScreenMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLint attribute, EGLint *value);
+EGLAPI EGLBoolean EGLAPIENTRY eglQueryScreenSurfaceMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLSurface *surface);
+EGLAPI EGLBoolean EGLAPIENTRY eglQueryScreenModeMESA(EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *mode);
+EGLAPI const char * EGLAPIENTRY eglQueryModeStringMESA(EGLDisplay dpy, EGLModeMESA mode);
+#endif /* EGL_EGLEXT_PROTOTYPES */
+
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLCHOOSEMODEMESA) (EGLDisplay dpy, EGLScreenMESA screen, const EGLint *attrib_list, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETMODESMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *modes, EGLint modes_size, EGLint *num_modes);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLGetModeATTRIBMESA) (EGLDisplay dpy, EGLModeMESA mode, EGLint attribute, EGLint *value);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLGETSCRREENSMESA) (EGLDisplay dpy, EGLScreenMESA *screens, EGLint max_screens, EGLint *num_screens);
+typedef EGLSurface (EGLAPIENTRYP PFNEGLCREATESCREENSURFACEMESA) (EGLDisplay dpy, EGLConfig config, const EGLint *attrib_list);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLSHOWSCREENSURFACEMESA) (EGLDisplay dpy, EGLint screen, EGLSurface surface, EGLModeMESA mode);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLSCREENPOSIITONMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLint x, EGLint y);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYSCREENMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLint attribute, EGLint *value);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYSCREENSURFACEMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLSurface *surface);
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYSCREENMODEMESA) (EGLDisplay dpy, EGLScreenMESA screen, EGLModeMESA *mode);
+typedef const char * (EGLAPIENTRYP PFNEGLQUERYMODESTRINGMESA) (EGLDisplay dpy, EGLModeMESA mode);
+
+#endif /* EGL_MESA_screen_surface */
+
+#ifndef EGL_MESA_copy_context
+#define EGL_MESA_copy_context 1
+
+#ifdef EGL_EGLEXT_PROTOTYPES
+EGLAPI EGLBoolean EGLAPIENTRY eglCopyContextMESA(EGLDisplay dpy, EGLContext source, EGLContext dest, EGLint mask);
+#endif /* EGL_EGLEXT_PROTOTYPES */
+
+typedef EGLBoolean (EGLAPIENTRYP PFNEGLCOPYCONTEXTMESA) (EGLDisplay dpy, EGLContext source, EGLContext dest, EGLint mask);
+
+#endif /* EGL_MESA_copy_context */
+
 #ifndef EGL_MESA_drm_display
 #define EGL_MESA_drm_display 1
 
@@ -113,19 +170,6 @@ typedef EGLBoolean (EGLAPIENTRYP PFNEGLSWAPBUFFERSREGIONNOK) (EGLDisplay dpy, EG
 #define EGL_NO_CONFIG_MESA			((EGLConfig)0)
 #endif
 
-#if KHRONOS_SUPPORT_INT64
-#ifndef EGL_MESA_image_dma_buf_export
-#define EGL_MESA_image_dma_buf_export 1
-#ifdef EGL_EGLEXT_PROTOTYPES
-EGLAPI EGLBoolean EGLAPIENTRY eglExportDMABUFImageQueryMESA (EGLDisplay dpy, EGLImageKHR image, EGLint *fourcc, EGLint *nplanes, EGLuint64KHR *modifiers);
-EGLAPI EGLBoolean EGLAPIENTRY eglExportDMABUFImageMESA (EGLDisplay dpy, EGLImageKHR image, int *fds, EGLint *strides, EGLint *offsets);
-#endif
-#endif
-
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLEXPORTDMABUFIMAGEQUERYMESA) (EGLDisplay dpy, EGLImageKHR image, EGLint *fourcc, EGLint *nplanes, EGLuint64KHR *modifiers);
-typedef EGLBoolean (EGLAPIENTRYP PFNEGLEXPORTDMABUFIMAGEMESA) (EGLDisplay dpy, EGLImageKHR image, int *fds, EGLint *strides, EGLint *offsets);
-
-#endif
 #ifdef __cplusplus
 }
 #endif

include/EGL/eglplatform.h

@@ -106,7 +106,7 @@ typedef void                        *EGLNativeDisplayType;
 
 #elif defined(__unix__)
 
-#if defined(MESA_EGL_NO_X11_HEADERS)
+#ifdef MESA_EGL_NO_X11_HEADERS
 
 typedef void            *EGLNativeDisplayType;
 typedef khronos_uintptr_t EGLNativePixmapType;
@@ -124,16 +124,8 @@ typedef Window   EGLNativeWindowType;
 
 #endif /* MESA_EGL_NO_X11_HEADERS */
 
-#elif __HAIKU__
-#include <kernel/image.h>
-typedef void				*EGLNativeDisplayType;
-typedef khronos_uintptr_t	 EGLNativePixmapType;
-typedef khronos_uintptr_t	 EGLNativeWindowType;
-
 #else
-
 #error "Platform not recognized"
-
 #endif
 
 /* EGL 1.2 types, renamed for consistency in EGL 1.3 */

include/GL/gl_mangle.h

@@ -106,7 +106,6 @@
 #define glBindTextureEXT		MANGLE(BindTextureEXT)
 #define glBindTexture		MANGLE(BindTexture)
 #define glBindTextures		MANGLE(BindTextures)
-#define glBindTextureUnit		MANGLE(BindTextureUnit)
 #define glBindTextureUnitParameterEXT		MANGLE(BindTextureUnitParameterEXT)
 #define glBindTransformFeedback		MANGLE(BindTransformFeedback)
 #define glBindTransformFeedbackNV		MANGLE(BindTransformFeedbackNV)
@@ -130,7 +129,6 @@
 #define glBinormalPointerEXT		MANGLE(BinormalPointerEXT)
 #define glBitmap		MANGLE(Bitmap)
 #define glBitmapxOES		MANGLE(BitmapxOES)
-#define glBlendBarrierKHR		MANGLE(BlendBarrierKHR)
 #define glBlendBarrierNV		MANGLE(BlendBarrierNV)
 #define glBlendColorEXT		MANGLE(BlendColorEXT)
 #define glBlendColor		MANGLE(BlendColor)
@@ -159,11 +157,9 @@
 #define glBlendParameteriNV		MANGLE(BlendParameteriNV)
 #define glBlitFramebufferEXT		MANGLE(BlitFramebufferEXT)
 #define glBlitFramebuffer		MANGLE(BlitFramebuffer)
-#define glBlitNamedFramebuffer		MANGLE(BlitNamedFramebuffer)
 #define glBufferAddressRangeNV		MANGLE(BufferAddressRangeNV)
 #define glBufferDataARB		MANGLE(BufferDataARB)
 #define glBufferData		MANGLE(BufferData)
-#define glBufferPageCommitmentARB		MANGLE(BufferPageCommitmentARB)
 #define glBufferParameteriAPPLE		MANGLE(BufferParameteriAPPLE)
 #define glBufferStorage		MANGLE(BufferStorage)
 #define glBufferSubDataARB		MANGLE(BufferSubDataARB)
@@ -173,7 +169,6 @@
 #define glCheckFramebufferStatusEXT		MANGLE(CheckFramebufferStatusEXT)
 #define glCheckFramebufferStatus		MANGLE(CheckFramebufferStatus)
 #define glCheckNamedFramebufferStatusEXT		MANGLE(CheckNamedFramebufferStatusEXT)
-#define glCheckNamedFramebufferStatus		MANGLE(CheckNamedFramebufferStatus)
 #define glClampColorARB		MANGLE(ClampColorARB)
 #define glClampColor		MANGLE(ClampColor)
 #define glClearAccum		MANGLE(ClearAccum)
@@ -196,13 +191,7 @@
 #define glClearIndex		MANGLE(ClearIndex)
 #define glClear		MANGLE(Clear)
 #define glClearNamedBufferDataEXT		MANGLE(ClearNamedBufferDataEXT)
-#define glClearNamedBufferData		MANGLE(ClearNamedBufferData)
 #define glClearNamedBufferSubDataEXT		MANGLE(ClearNamedBufferSubDataEXT)
-#define glClearNamedBufferSubData		MANGLE(ClearNamedBufferSubData)
-#define glClearNamedFramebufferfi		MANGLE(ClearNamedFramebufferfi)
-#define glClearNamedFramebufferfv		MANGLE(ClearNamedFramebufferfv)
-#define glClearNamedFramebufferiv		MANGLE(ClearNamedFramebufferiv)
-#define glClearNamedFramebufferuiv		MANGLE(ClearNamedFramebufferuiv)
 #define glClearStencil		MANGLE(ClearStencil)
 #define glClearTexImage		MANGLE(ClearTexImage)
 #define glClearTexSubImage		MANGLE(ClearTexSubImage)
@@ -211,7 +200,6 @@
 #define glClientActiveVertexStreamATI		MANGLE(ClientActiveVertexStreamATI)
 #define glClientAttribDefaultEXT		MANGLE(ClientAttribDefaultEXT)
 #define glClientWaitSync		MANGLE(ClientWaitSync)
-#define glClipControl		MANGLE(ClipControl)
 #define glClipPlanefOES		MANGLE(ClipPlanefOES)
 #define glClipPlane		MANGLE(ClipPlane)
 #define glClipPlanexOES		MANGLE(ClipPlanexOES)
@@ -320,11 +308,8 @@
 #define glCompressedTextureImage2DEXT		MANGLE(CompressedTextureImage2DEXT)
 #define glCompressedTextureImage3DEXT		MANGLE(CompressedTextureImage3DEXT)
 #define glCompressedTextureSubImage1DEXT		MANGLE(CompressedTextureSubImage1DEXT)
-#define glCompressedTextureSubImage1D		MANGLE(CompressedTextureSubImage1D)
 #define glCompressedTextureSubImage2DEXT		MANGLE(CompressedTextureSubImage2DEXT)
-#define glCompressedTextureSubImage2D		MANGLE(CompressedTextureSubImage2D)
 #define glCompressedTextureSubImage3DEXT		MANGLE(CompressedTextureSubImage3DEXT)
-#define glCompressedTextureSubImage3D		MANGLE(CompressedTextureSubImage3D)
 #define glConvolutionFilter1DEXT		MANGLE(ConvolutionFilter1DEXT)
 #define glConvolutionFilter1D		MANGLE(ConvolutionFilter1D)
 #define glConvolutionFilter2DEXT		MANGLE(ConvolutionFilter2DEXT)
@@ -355,7 +340,6 @@
 #define glCopyMultiTexSubImage1DEXT		MANGLE(CopyMultiTexSubImage1DEXT)
 #define glCopyMultiTexSubImage2DEXT		MANGLE(CopyMultiTexSubImage2DEXT)
 #define glCopyMultiTexSubImage3DEXT		MANGLE(CopyMultiTexSubImage3DEXT)
-#define glCopyNamedBufferSubData		MANGLE(CopyNamedBufferSubData)
 #define glCopyPathNV		MANGLE(CopyPathNV)
 #define glCopyPixels		MANGLE(CopyPixels)
 #define glCopyTexImage1DEXT		MANGLE(CopyTexImage1DEXT)
@@ -371,32 +355,20 @@
 #define glCopyTextureImage1DEXT		MANGLE(CopyTextureImage1DEXT)
 #define glCopyTextureImage2DEXT		MANGLE(CopyTextureImage2DEXT)
 #define glCopyTextureSubImage1DEXT		MANGLE(CopyTextureSubImage1DEXT)
-#define glCopyTextureSubImage1D		MANGLE(CopyTextureSubImage1D)
 #define glCopyTextureSubImage2DEXT		MANGLE(CopyTextureSubImage2DEXT)
-#define glCopyTextureSubImage2D		MANGLE(CopyTextureSubImage2D)
 #define glCopyTextureSubImage3DEXT		MANGLE(CopyTextureSubImage3DEXT)
-#define glCopyTextureSubImage3D		MANGLE(CopyTextureSubImage3D)
 #define glCoverFillPathInstancedNV		MANGLE(CoverFillPathInstancedNV)
 #define glCoverFillPathNV		MANGLE(CoverFillPathNV)
 #define glCoverStrokePathInstancedNV		MANGLE(CoverStrokePathInstancedNV)
 #define glCoverStrokePathNV		MANGLE(CoverStrokePathNV)
-#define glCreateBuffers		MANGLE(CreateBuffers)
-#define glCreateFramebuffers		MANGLE(CreateFramebuffers)
 #define glCreatePerfQueryINTEL		MANGLE(CreatePerfQueryINTEL)
 #define glCreateProgram		MANGLE(CreateProgram)
 #define glCreateProgramObjectARB		MANGLE(CreateProgramObjectARB)
-#define glCreateProgramPipelines		MANGLE(CreateProgramPipelines)
-#define glCreateQueries		MANGLE(CreateQueries)
-#define glCreateRenderbuffers		MANGLE(CreateRenderbuffers)
-#define glCreateSamplers		MANGLE(CreateSamplers)
 #define glCreateShader		MANGLE(CreateShader)
 #define glCreateShaderObjectARB		MANGLE(CreateShaderObjectARB)
 #define glCreateShaderProgramEXT		MANGLE(CreateShaderProgramEXT)
 #define glCreateShaderProgramv		MANGLE(CreateShaderProgramv)
 #define glCreateSyncFromCLeventARB		MANGLE(CreateSyncFromCLeventARB)
-#define glCreateTextures		MANGLE(CreateTextures)
-#define glCreateTransformFeedbacks		MANGLE(CreateTransformFeedbacks)
-#define glCreateVertexArrays		MANGLE(CreateVertexArrays)
 #define glCullFace		MANGLE(CullFace)
 #define glCullParameterdvEXT		MANGLE(CullParameterdvEXT)
 #define glCullParameterfvEXT		MANGLE(CullParameterfvEXT)
@@ -469,7 +441,6 @@
 #define glDisable		MANGLE(Disable)
 #define glDisableVariantClientStateEXT		MANGLE(DisableVariantClientStateEXT)
 #define glDisableVertexArrayAttribEXT		MANGLE(DisableVertexArrayAttribEXT)
-#define glDisableVertexArrayAttrib		MANGLE(DisableVertexArrayAttrib)
 #define glDisableVertexArrayEXT		MANGLE(DisableVertexArrayEXT)
 #define glDisableVertexAttribAPPLE		MANGLE(DisableVertexAttribAPPLE)
 #define glDisableVertexAttribArrayARB		MANGLE(DisableVertexAttribArrayARB)
@@ -530,7 +501,6 @@
 #define glEnable		MANGLE(Enable)
 #define glEnableVariantClientStateEXT		MANGLE(EnableVariantClientStateEXT)
 #define glEnableVertexArrayAttribEXT		MANGLE(EnableVertexArrayAttribEXT)
-#define glEnableVertexArrayAttrib		MANGLE(EnableVertexArrayAttrib)
 #define glEnableVertexArrayEXT		MANGLE(EnableVertexArrayEXT)
 #define glEnableVertexAttribAPPLE		MANGLE(EnableVertexAttribAPPLE)
 #define glEnableVertexAttribArrayARB		MANGLE(EnableVertexAttribArrayARB)
@@ -585,7 +555,6 @@
 #define glFlushMappedBufferRangeAPPLE		MANGLE(FlushMappedBufferRangeAPPLE)
 #define glFlushMappedBufferRange		MANGLE(FlushMappedBufferRange)
 #define glFlushMappedNamedBufferRangeEXT		MANGLE(FlushMappedNamedBufferRangeEXT)
-#define glFlushMappedNamedBufferRange		MANGLE(FlushMappedNamedBufferRange)
 #define glFlushPixelDataRangeNV		MANGLE(FlushPixelDataRangeNV)
 #define glFlushRasterSGIX		MANGLE(FlushRasterSGIX)
 #define glFlushStaticDataIBM		MANGLE(FlushStaticDataIBM)
@@ -659,7 +628,6 @@
 #define glGenerateMipmap		MANGLE(GenerateMipmap)
 #define glGenerateMultiTexMipmapEXT		MANGLE(GenerateMultiTexMipmapEXT)
 #define glGenerateTextureMipmapEXT		MANGLE(GenerateTextureMipmapEXT)
-#define glGenerateTextureMipmap		MANGLE(GenerateTextureMipmap)
 #define glGenFencesAPPLE		MANGLE(GenFencesAPPLE)
 #define glGenFencesNV		MANGLE(GenFencesNV)
 #define glGenFragmentShadersATI		MANGLE(GenFragmentShadersATI)
@@ -737,8 +705,6 @@
 #define glGetCompressedTexImageARB		MANGLE(GetCompressedTexImageARB)
 #define glGetCompressedTexImage		MANGLE(GetCompressedTexImage)
 #define glGetCompressedTextureImageEXT		MANGLE(GetCompressedTextureImageEXT)
-#define glGetCompressedTextureImage		MANGLE(GetCompressedTextureImage)
-#define glGetCompressedTextureSubImage		MANGLE(GetCompressedTextureSubImage)
 #define glGetConvolutionFilterEXT		MANGLE(GetConvolutionFilterEXT)
 #define glGetConvolutionFilter		MANGLE(GetConvolutionFilter)
 #define glGetConvolutionParameterfvEXT		MANGLE(GetConvolutionParameterfvEXT)
@@ -777,7 +743,6 @@
 #define glGetFramebufferParameterivEXT		MANGLE(GetFramebufferParameterivEXT)
 #define glGetFramebufferParameteriv		MANGLE(GetFramebufferParameteriv)
 #define glGetGraphicsResetStatusARB		MANGLE(GetGraphicsResetStatusARB)
-#define glGetGraphicsResetStatus		MANGLE(GetGraphicsResetStatus)
 #define glGetHandleARB		MANGLE(GetHandleARB)
 #define glGetHistogramEXT		MANGLE(GetHistogramEXT)
 #define glGetHistogram		MANGLE(GetHistogram)
@@ -844,18 +809,12 @@
 #define glGetMultiTexParameterIivEXT		MANGLE(GetMultiTexParameterIivEXT)
 #define glGetMultiTexParameterIuivEXT		MANGLE(GetMultiTexParameterIuivEXT)
 #define glGetMultiTexParameterivEXT		MANGLE(GetMultiTexParameterivEXT)
-#define glGetNamedBufferParameteri64v		MANGLE(GetNamedBufferParameteri64v)
 #define glGetNamedBufferParameterivEXT		MANGLE(GetNamedBufferParameterivEXT)
-#define glGetNamedBufferParameteriv		MANGLE(GetNamedBufferParameteriv)
 #define glGetNamedBufferParameterui64vNV		MANGLE(GetNamedBufferParameterui64vNV)
 #define glGetNamedBufferPointervEXT		MANGLE(GetNamedBufferPointervEXT)
-#define glGetNamedBufferPointerv		MANGLE(GetNamedBufferPointerv)
 #define glGetNamedBufferSubDataEXT		MANGLE(GetNamedBufferSubDataEXT)
-#define glGetNamedBufferSubData		MANGLE(GetNamedBufferSubData)
 #define glGetNamedFramebufferAttachmentParameterivEXT		MANGLE(GetNamedFramebufferAttachmentParameterivEXT)
-#define glGetNamedFramebufferAttachmentParameteriv		MANGLE(GetNamedFramebufferAttachmentParameteriv)
 #define glGetNamedFramebufferParameterivEXT		MANGLE(GetNamedFramebufferParameterivEXT)
-#define glGetNamedFramebufferParameteriv		MANGLE(GetNamedFramebufferParameteriv)
 #define glGetNamedProgramivEXT		MANGLE(GetNamedProgramivEXT)
 #define glGetNamedProgramLocalParameterdvEXT		MANGLE(GetNamedProgramLocalParameterdvEXT)
 #define glGetNamedProgramLocalParameterfvEXT		MANGLE(GetNamedProgramLocalParameterfvEXT)
@@ -863,46 +822,27 @@
 #define glGetNamedProgramLocalParameterIuivEXT		MANGLE(GetNamedProgramLocalParameterIuivEXT)
 #define glGetNamedProgramStringEXT		MANGLE(GetNamedProgramStringEXT)
 #define glGetNamedRenderbufferParameterivEXT		MANGLE(GetNamedRenderbufferParameterivEXT)
-#define glGetNamedRenderbufferParameteriv		MANGLE(GetNamedRenderbufferParameteriv)
 #define glGetNamedStringARB		MANGLE(GetNamedStringARB)
 #define glGetNamedStringivARB		MANGLE(GetNamedStringivARB)
 #define glGetnColorTableARB		MANGLE(GetnColorTableARB)
-#define glGetnColorTable		MANGLE(GetnColorTable)
 #define glGetnCompressedTexImageARB		MANGLE(GetnCompressedTexImageARB)
-#define glGetnCompressedTexImage		MANGLE(GetnCompressedTexImage)
 #define glGetnConvolutionFilterARB		MANGLE(GetnConvolutionFilterARB)
-#define glGetnConvolutionFilter		MANGLE(GetnConvolutionFilter)
 #define glGetNextPerfQueryIdINTEL		MANGLE(GetNextPerfQueryIdINTEL)
 #define glGetnHistogramARB		MANGLE(GetnHistogramARB)
-#define glGetnHistogram		MANGLE(GetnHistogram)
 #define glGetnMapdvARB		MANGLE(GetnMapdvARB)
-#define glGetnMapdv		MANGLE(GetnMapdv)
 #define glGetnMapfvARB		MANGLE(GetnMapfvARB)
-#define glGetnMapfv		MANGLE(GetnMapfv)
 #define glGetnMapivARB		MANGLE(GetnMapivARB)
-#define glGetnMapiv		MANGLE(GetnMapiv)
 #define glGetnMinmaxARB		MANGLE(GetnMinmaxARB)
-#define glGetnMinmax		MANGLE(GetnMinmax)
 #define glGetnPixelMapfvARB		MANGLE(GetnPixelMapfvARB)
-#define glGetnPixelMapfv		MANGLE(GetnPixelMapfv)
 #define glGetnPixelMapuivARB		MANGLE(GetnPixelMapuivARB)
-#define glGetnPixelMapuiv		MANGLE(GetnPixelMapuiv)
 #define glGetnPixelMapusvARB		MANGLE(GetnPixelMapusvARB)
-#define glGetnPixelMapusv		MANGLE(GetnPixelMapusv)
 #define glGetnPolygonStippleARB		MANGLE(GetnPolygonStippleARB)
-#define glGetnPolygonStipple		MANGLE(GetnPolygonStipple)
 #define glGetnSeparableFilterARB		MANGLE(GetnSeparableFilterARB)
-#define glGetnSeparableFilter		MANGLE(GetnSeparableFilter)
 #define glGetnTexImageARB		MANGLE(GetnTexImageARB)
-#define glGetnTexImage		MANGLE(GetnTexImage)
 #define glGetnUniformdvARB		MANGLE(GetnUniformdvARB)
-#define glGetnUniformdv		MANGLE(GetnUniformdv)
 #define glGetnUniformfvARB		MANGLE(GetnUniformfvARB)
-#define glGetnUniformfv		MANGLE(GetnUniformfv)
 #define glGetnUniformivARB		MANGLE(GetnUniformivARB)
-#define glGetnUniformiv		MANGLE(GetnUniformiv)
 #define glGetnUniformuivARB		MANGLE(GetnUniformuivARB)
-#define glGetnUniformuiv		MANGLE(GetnUniformuiv)
 #define glGetObjectBufferfvATI		MANGLE(GetObjectBufferfvATI)
 #define glGetObjectBufferivATI		MANGLE(GetObjectBufferivATI)
 #define glGetObjectLabelEXT		MANGLE(GetObjectLabelEXT)
@@ -969,7 +909,6 @@
 #define glGetProgramParameterfvNV		MANGLE(GetProgramParameterfvNV)
 #define glGetProgramPipelineInfoLog		MANGLE(GetProgramPipelineInfoLog)
 #define glGetProgramPipelineiv		MANGLE(GetProgramPipelineiv)
-#define glGetProgramResourcefvNV		MANGLE(GetProgramResourcefvNV)
 #define glGetProgramResourceIndex		MANGLE(GetProgramResourceIndex)
 #define glGetProgramResourceiv		MANGLE(GetProgramResourceiv)
 #define glGetProgramResourceLocationIndex		MANGLE(GetProgramResourceLocationIndex)
@@ -1034,26 +973,15 @@
 #define glGetTextureHandleARB		MANGLE(GetTextureHandleARB)
 #define glGetTextureHandleNV		MANGLE(GetTextureHandleNV)
 #define glGetTextureImageEXT		MANGLE(GetTextureImageEXT)
-#define glGetTextureImage		MANGLE(GetTextureImage)
 #define glGetTextureLevelParameterfvEXT		MANGLE(GetTextureLevelParameterfvEXT)
-#define glGetTextureLevelParameterfv		MANGLE(GetTextureLevelParameterfv)
 #define glGetTextureLevelParameterivEXT		MANGLE(GetTextureLevelParameterivEXT)
-#define glGetTextureLevelParameteriv		MANGLE(GetTextureLevelParameteriv)
 #define glGetTextureParameterfvEXT		MANGLE(GetTextureParameterfvEXT)
-#define glGetTextureParameterfv		MANGLE(GetTextureParameterfv)
 #define glGetTextureParameterIivEXT		MANGLE(GetTextureParameterIivEXT)
-#define glGetTextureParameterIiv		MANGLE(GetTextureParameterIiv)
 #define glGetTextureParameterIuivEXT		MANGLE(GetTextureParameterIuivEXT)
-#define glGetTextureParameterIuiv		MANGLE(GetTextureParameterIuiv)
 #define glGetTextureParameterivEXT		MANGLE(GetTextureParameterivEXT)
-#define glGetTextureParameteriv		MANGLE(GetTextureParameteriv)
 #define glGetTextureSamplerHandleARB		MANGLE(GetTextureSamplerHandleARB)
 #define glGetTextureSamplerHandleNV		MANGLE(GetTextureSamplerHandleNV)
-#define glGetTextureSubImage		MANGLE(GetTextureSubImage)
 #define glGetTrackMatrixivNV		MANGLE(GetTrackMatrixivNV)
-#define glGetTransformFeedbacki64_v		MANGLE(GetTransformFeedbacki64_v)
-#define glGetTransformFeedbacki_v		MANGLE(GetTransformFeedbacki_v)
-#define glGetTransformFeedbackiv		MANGLE(GetTransformFeedbackiv)
 #define glGetTransformFeedbackVaryingEXT		MANGLE(GetTransformFeedbackVaryingEXT)
 #define glGetTransformFeedbackVarying		MANGLE(GetTransformFeedbackVarying)
 #define glGetTransformFeedbackVaryingNV		MANGLE(GetTransformFeedbackVaryingNV)
@@ -1080,11 +1008,8 @@
 #define glGetVariantIntegervEXT		MANGLE(GetVariantIntegervEXT)
 #define glGetVariantPointervEXT		MANGLE(GetVariantPointervEXT)
 #define glGetVaryingLocationNV		MANGLE(GetVaryingLocationNV)
-#define glGetVertexArrayIndexed64iv		MANGLE(GetVertexArrayIndexed64iv)
-#define glGetVertexArrayIndexediv		MANGLE(GetVertexArrayIndexediv)
 #define glGetVertexArrayIntegeri_vEXT		MANGLE(GetVertexArrayIntegeri_vEXT)
 #define glGetVertexArrayIntegervEXT		MANGLE(GetVertexArrayIntegervEXT)
-#define glGetVertexArrayiv		MANGLE(GetVertexArrayiv)
 #define glGetVertexArrayPointeri_vEXT		MANGLE(GetVertexArrayPointeri_vEXT)
 #define glGetVertexArrayPointervEXT		MANGLE(GetVertexArrayPointervEXT)
 #define glGetVertexAttribArrayObjectfvATI		MANGLE(GetVertexAttribArrayObjectfvATI)
@@ -1164,8 +1089,6 @@
 #define glInvalidateBufferData		MANGLE(InvalidateBufferData)
 #define glInvalidateBufferSubData		MANGLE(InvalidateBufferSubData)
 #define glInvalidateFramebuffer		MANGLE(InvalidateFramebuffer)
-#define glInvalidateNamedFramebufferData		MANGLE(InvalidateNamedFramebufferData)
-#define glInvalidateNamedFramebufferSubData		MANGLE(InvalidateNamedFramebufferSubData)
 #define glInvalidateSubFramebuffer		MANGLE(InvalidateSubFramebuffer)
 #define glInvalidateTexImage		MANGLE(InvalidateTexImage)
 #define glInvalidateTexSubImage		MANGLE(InvalidateTexSubImage)
@@ -1279,9 +1202,7 @@
 #define glMapGrid2f		MANGLE(MapGrid2f)
 #define glMapGrid2xOES		MANGLE(MapGrid2xOES)
 #define glMapNamedBufferEXT		MANGLE(MapNamedBufferEXT)
-#define glMapNamedBuffer		MANGLE(MapNamedBuffer)
 #define glMapNamedBufferRangeEXT		MANGLE(MapNamedBufferRangeEXT)
-#define glMapNamedBufferRange		MANGLE(MapNamedBufferRange)
 #define glMapObjectBufferATI		MANGLE(MapObjectBufferATI)
 #define glMapParameterfvNV		MANGLE(MapParameterfvNV)
 #define glMapParameterivNV		MANGLE(MapParameterivNV)
@@ -1301,20 +1222,14 @@
 #define glMatrixIndexubvARB		MANGLE(MatrixIndexubvARB)
 #define glMatrixIndexuivARB		MANGLE(MatrixIndexuivARB)
 #define glMatrixIndexusvARB		MANGLE(MatrixIndexusvARB)
-#define glMatrixLoad3x2fNV		MANGLE(MatrixLoad3x2fNV)
-#define glMatrixLoad3x3fNV		MANGLE(MatrixLoad3x3fNV)
 #define glMatrixLoaddEXT		MANGLE(MatrixLoaddEXT)
 #define glMatrixLoadfEXT		MANGLE(MatrixLoadfEXT)
 #define glMatrixLoadIdentityEXT		MANGLE(MatrixLoadIdentityEXT)
-#define glMatrixLoadTranspose3x3fNV		MANGLE(MatrixLoadTranspose3x3fNV)
 #define glMatrixLoadTransposedEXT		MANGLE(MatrixLoadTransposedEXT)
 #define glMatrixLoadTransposefEXT		MANGLE(MatrixLoadTransposefEXT)
 #define glMatrixMode		MANGLE(MatrixMode)
-#define glMatrixMult3x2fNV		MANGLE(MatrixMult3x2fNV)
-#define glMatrixMult3x3fNV		MANGLE(MatrixMult3x3fNV)
 #define glMatrixMultdEXT		MANGLE(MatrixMultdEXT)
 #define glMatrixMultfEXT		MANGLE(MatrixMultfEXT)
-#define glMatrixMultTranspose3x3fNV		MANGLE(MatrixMultTranspose3x3fNV)
 #define glMatrixMultTransposedEXT		MANGLE(MatrixMultTransposedEXT)
 #define glMatrixMultTransposefEXT		MANGLE(MatrixMultTransposefEXT)
 #define glMatrixOrthoEXT		MANGLE(MatrixOrthoEXT)
@@ -1326,7 +1241,6 @@
 #define glMatrixScalefEXT		MANGLE(MatrixScalefEXT)
 #define glMatrixTranslatedEXT		MANGLE(MatrixTranslatedEXT)
 #define glMatrixTranslatefEXT		MANGLE(MatrixTranslatefEXT)
-#define glMemoryBarrierByRegion		MANGLE(MemoryBarrierByRegion)
 #define glMemoryBarrierEXT		MANGLE(MemoryBarrierEXT)
 #define glMemoryBarrier		MANGLE(MemoryBarrier)
 #define glMinmaxEXT		MANGLE(MinmaxEXT)
@@ -1335,7 +1249,6 @@
 #define glMinSampleShading		MANGLE(MinSampleShading)
 #define glMultiDrawArraysEXT		MANGLE(MultiDrawArraysEXT)
 #define glMultiDrawArraysIndirectAMD		MANGLE(MultiDrawArraysIndirectAMD)
-#define glMultiDrawArraysIndirectBindlessCountNV		MANGLE(MultiDrawArraysIndirectBindlessCountNV)
 #define glMultiDrawArraysIndirectBindlessNV		MANGLE(MultiDrawArraysIndirectBindlessNV)
 #define glMultiDrawArraysIndirectCountARB		MANGLE(MultiDrawArraysIndirectCountARB)
 #define glMultiDrawArraysIndirect		MANGLE(MultiDrawArraysIndirect)
@@ -1344,7 +1257,6 @@
 #define glMultiDrawElementsBaseVertex		MANGLE(MultiDrawElementsBaseVertex)
 #define glMultiDrawElementsEXT		MANGLE(MultiDrawElementsEXT)
 #define glMultiDrawElementsIndirectAMD		MANGLE(MultiDrawElementsIndirectAMD)
-#define glMultiDrawElementsIndirectBindlessCountNV		MANGLE(MultiDrawElementsIndirectBindlessCountNV)
 #define glMultiDrawElementsIndirectBindlessNV		MANGLE(MultiDrawElementsIndirectBindlessNV)
 #define glMultiDrawElementsIndirectCountARB		MANGLE(MultiDrawElementsIndirectCountARB)
 #define glMultiDrawElementsIndirect		MANGLE(MultiDrawElementsIndirect)
@@ -1482,29 +1394,17 @@
 #define glMultTransposeMatrixf		MANGLE(MultTransposeMatrixf)
 #define glMultTransposeMatrixxOES		MANGLE(MultTransposeMatrixxOES)
 #define glNamedBufferDataEXT		MANGLE(NamedBufferDataEXT)
-#define glNamedBufferData		MANGLE(NamedBufferData)
-#define glNamedBufferPageCommitmentARB		MANGLE(NamedBufferPageCommitmentARB)
-#define glNamedBufferPageCommitmentEXT		MANGLE(NamedBufferPageCommitmentEXT)
 #define glNamedBufferStorageEXT		MANGLE(NamedBufferStorageEXT)
-#define glNamedBufferStorage		MANGLE(NamedBufferStorage)
 #define glNamedBufferSubDataEXT		MANGLE(NamedBufferSubDataEXT)
-#define glNamedBufferSubData		MANGLE(NamedBufferSubData)
 #define glNamedCopyBufferSubDataEXT		MANGLE(NamedCopyBufferSubDataEXT)
-#define glNamedFramebufferDrawBuffer		MANGLE(NamedFramebufferDrawBuffer)
-#define glNamedFramebufferDrawBuffers		MANGLE(NamedFramebufferDrawBuffers)
 #define glNamedFramebufferParameteriEXT		MANGLE(NamedFramebufferParameteriEXT)
-#define glNamedFramebufferParameteri		MANGLE(NamedFramebufferParameteri)
-#define glNamedFramebufferReadBuffer		MANGLE(NamedFramebufferReadBuffer)
 #define glNamedFramebufferRenderbufferEXT		MANGLE(NamedFramebufferRenderbufferEXT)
-#define glNamedFramebufferRenderbuffer		MANGLE(NamedFramebufferRenderbuffer)
 #define glNamedFramebufferTexture1DEXT		MANGLE(NamedFramebufferTexture1DEXT)
 #define glNamedFramebufferTexture2DEXT		MANGLE(NamedFramebufferTexture2DEXT)
 #define glNamedFramebufferTexture3DEXT		MANGLE(NamedFramebufferTexture3DEXT)
 #define glNamedFramebufferTextureEXT		MANGLE(NamedFramebufferTextureEXT)
 #define glNamedFramebufferTextureFaceEXT		MANGLE(NamedFramebufferTextureFaceEXT)
 #define glNamedFramebufferTextureLayerEXT		MANGLE(NamedFramebufferTextureLayerEXT)
-#define glNamedFramebufferTextureLayer		MANGLE(NamedFramebufferTextureLayer)
-#define glNamedFramebufferTexture		MANGLE(NamedFramebufferTexture)
 #define glNamedProgramLocalParameter4dEXT		MANGLE(NamedProgramLocalParameter4dEXT)
 #define glNamedProgramLocalParameter4dvEXT		MANGLE(NamedProgramLocalParameter4dvEXT)
 #define glNamedProgramLocalParameter4fEXT		MANGLE(NamedProgramLocalParameter4fEXT)
@@ -1518,10 +1418,8 @@
 #define glNamedProgramLocalParametersI4uivEXT		MANGLE(NamedProgramLocalParametersI4uivEXT)
 #define glNamedProgramStringEXT		MANGLE(NamedProgramStringEXT)
 #define glNamedRenderbufferStorageEXT		MANGLE(NamedRenderbufferStorageEXT)
-#define glNamedRenderbufferStorage		MANGLE(NamedRenderbufferStorage)
 #define glNamedRenderbufferStorageMultisampleCoverageEXT		MANGLE(NamedRenderbufferStorageMultisampleCoverageEXT)
 #define glNamedRenderbufferStorageMultisampleEXT		MANGLE(NamedRenderbufferStorageMultisampleEXT)
-#define glNamedRenderbufferStorageMultisample		MANGLE(NamedRenderbufferStorageMultisample)
 #define glNamedStringARB		MANGLE(NamedStringARB)
 #define glNewList		MANGLE(NewList)
 #define glNewObjectBufferATI		MANGLE(NewObjectBufferATI)
@@ -1576,11 +1474,8 @@
 #define glPathCoverDepthFuncNV		MANGLE(PathCoverDepthFuncNV)
 #define glPathDashArrayNV		MANGLE(PathDashArrayNV)
 #define glPathFogGenNV		MANGLE(PathFogGenNV)
-#define glPathGlyphIndexArrayNV		MANGLE(PathGlyphIndexArrayNV)
-#define glPathGlyphIndexRangeNV		MANGLE(PathGlyphIndexRangeNV)
 #define glPathGlyphRangeNV		MANGLE(PathGlyphRangeNV)
 #define glPathGlyphsNV		MANGLE(PathGlyphsNV)
-#define glPathMemoryGlyphIndexArrayNV		MANGLE(PathMemoryGlyphIndexArrayNV)
 #define glPathParameterfNV		MANGLE(PathParameterfNV)
 #define glPathParameterfvNV		MANGLE(PathParameterfvNV)
 #define glPathParameteriNV		MANGLE(PathParameteriNV)
@@ -1693,7 +1588,6 @@
 #define glProgramParameteri		MANGLE(ProgramParameteri)
 #define glProgramParameters4dvNV		MANGLE(ProgramParameters4dvNV)
 #define glProgramParameters4fvNV		MANGLE(ProgramParameters4fvNV)
-#define glProgramPathFragmentInputGenNV		MANGLE(ProgramPathFragmentInputGenNV)
 #define glProgramStringARB		MANGLE(ProgramStringARB)
 #define glProgramSubroutineParametersuivNV		MANGLE(ProgramSubroutineParametersuivNV)
 #define glProgramUniform1dEXT		MANGLE(ProgramUniform1dEXT)
@@ -1864,7 +1758,6 @@
 #define glReadBuffer		MANGLE(ReadBuffer)
 #define glReadInstrumentsSGIX		MANGLE(ReadInstrumentsSGIX)
 #define glReadnPixelsARB		MANGLE(ReadnPixelsARB)
-#define glReadnPixels		MANGLE(ReadnPixels)
 #define glReadPixels		MANGLE(ReadPixels)
 #define glRectd		MANGLE(Rectd)
 #define glRectdv		MANGLE(Rectdv)
@@ -2019,10 +1912,6 @@
 #define glStencilOpValueAMD		MANGLE(StencilOpValueAMD)
 #define glStencilStrokePathInstancedNV		MANGLE(StencilStrokePathInstancedNV)
 #define glStencilStrokePathNV		MANGLE(StencilStrokePathNV)
-#define glStencilThenCoverFillPathInstancedNV		MANGLE(StencilThenCoverFillPathInstancedNV)
-#define glStencilThenCoverFillPathNV		MANGLE(StencilThenCoverFillPathNV)
-#define glStencilThenCoverStrokePathInstancedNV		MANGLE(StencilThenCoverStrokePathInstancedNV)
-#define glStencilThenCoverStrokePathNV		MANGLE(StencilThenCoverStrokePathNV)
 #define glStopInstrumentsSGIX		MANGLE(StopInstrumentsSGIX)
 #define glStringMarkerGREMEDY		MANGLE(StringMarkerGREMEDY)
 #define glSwizzleEXT		MANGLE(SwizzleEXT)
@@ -2183,12 +2072,9 @@
 #define glTexSubImage3DEXT		MANGLE(TexSubImage3DEXT)
 #define glTexSubImage3D		MANGLE(TexSubImage3D)
 #define glTexSubImage4DSGIS		MANGLE(TexSubImage4DSGIS)
-#define glTextureBarrier		MANGLE(TextureBarrier)
 #define glTextureBarrierNV		MANGLE(TextureBarrierNV)
 #define glTextureBufferEXT		MANGLE(TextureBufferEXT)
-#define glTextureBuffer		MANGLE(TextureBuffer)
 #define glTextureBufferRangeEXT		MANGLE(TextureBufferRangeEXT)
-#define glTextureBufferRange		MANGLE(TextureBufferRange)
 #define glTextureColorMaskSGIS		MANGLE(TextureColorMaskSGIS)
 #define glTextureImage1DEXT		MANGLE(TextureImage1DEXT)
 #define glTextureImage2DEXT		MANGLE(TextureImage2DEXT)
@@ -2202,41 +2088,25 @@
 #define glTextureNormalEXT		MANGLE(TextureNormalEXT)
 #define glTexturePageCommitmentEXT		MANGLE(TexturePageCommitmentEXT)
 #define glTextureParameterfEXT		MANGLE(TextureParameterfEXT)
-#define glTextureParameterf		MANGLE(TextureParameterf)
 #define glTextureParameterfvEXT		MANGLE(TextureParameterfvEXT)
-#define glTextureParameterfv		MANGLE(TextureParameterfv)
 #define glTextureParameteriEXT		MANGLE(TextureParameteriEXT)
 #define glTextureParameterIivEXT		MANGLE(TextureParameterIivEXT)
-#define glTextureParameterIiv		MANGLE(TextureParameterIiv)
-#define glTextureParameteri		MANGLE(TextureParameteri)
 #define glTextureParameterIuivEXT		MANGLE(TextureParameterIuivEXT)
-#define glTextureParameterIuiv		MANGLE(TextureParameterIuiv)
 #define glTextureParameterivEXT		MANGLE(TextureParameterivEXT)
-#define glTextureParameteriv		MANGLE(TextureParameteriv)
 #define glTextureRangeAPPLE		MANGLE(TextureRangeAPPLE)
 #define glTextureRenderbufferEXT		MANGLE(TextureRenderbufferEXT)
 #define glTextureStorage1DEXT		MANGLE(TextureStorage1DEXT)
-#define glTextureStorage1D		MANGLE(TextureStorage1D)
 #define glTextureStorage2DEXT		MANGLE(TextureStorage2DEXT)
-#define glTextureStorage2D		MANGLE(TextureStorage2D)
 #define glTextureStorage2DMultisampleEXT		MANGLE(TextureStorage2DMultisampleEXT)
-#define glTextureStorage2DMultisample		MANGLE(TextureStorage2DMultisample)
 #define glTextureStorage3DEXT		MANGLE(TextureStorage3DEXT)
-#define glTextureStorage3D		MANGLE(TextureStorage3D)
 #define glTextureStorage3DMultisampleEXT		MANGLE(TextureStorage3DMultisampleEXT)
-#define glTextureStorage3DMultisample		MANGLE(TextureStorage3DMultisample)
 #define glTextureStorageSparseAMD		MANGLE(TextureStorageSparseAMD)
 #define glTextureSubImage1DEXT		MANGLE(TextureSubImage1DEXT)
-#define glTextureSubImage1D		MANGLE(TextureSubImage1D)
 #define glTextureSubImage2DEXT		MANGLE(TextureSubImage2DEXT)
-#define glTextureSubImage2D		MANGLE(TextureSubImage2D)
 #define glTextureSubImage3DEXT		MANGLE(TextureSubImage3DEXT)
-#define glTextureSubImage3D		MANGLE(TextureSubImage3D)
 #define glTextureView		MANGLE(TextureView)
 #define glTrackMatrixNV		MANGLE(TrackMatrixNV)
 #define glTransformFeedbackAttribsNV		MANGLE(TransformFeedbackAttribsNV)
-#define glTransformFeedbackBufferBase		MANGLE(TransformFeedbackBufferBase)
-#define glTransformFeedbackBufferRange		MANGLE(TransformFeedbackBufferRange)
 #define glTransformFeedbackStreamAttribsNV		MANGLE(TransformFeedbackStreamAttribsNV)
 #define glTransformFeedbackVaryingsEXT		MANGLE(TransformFeedbackVaryingsEXT)
 #define glTransformFeedbackVaryings		MANGLE(TransformFeedbackVaryings)
@@ -2351,7 +2221,6 @@
 #define glUnmapBufferARB		MANGLE(UnmapBufferARB)
 #define glUnmapBuffer		MANGLE(UnmapBuffer)
 #define glUnmapNamedBufferEXT		MANGLE(UnmapNamedBufferEXT)
-#define glUnmapNamedBuffer		MANGLE(UnmapNamedBuffer)
 #define glUnmapObjectBufferATI		MANGLE(UnmapObjectBufferATI)
 #define glUnmapTexture2DINTEL		MANGLE(UnmapTexture2DINTEL)
 #define glUpdateObjectBufferATI		MANGLE(UpdateObjectBufferATI)
@@ -2424,15 +2293,9 @@
 #define glVertex4sv		MANGLE(Vertex4sv)
 #define glVertex4xOES		MANGLE(Vertex4xOES)
 #define glVertex4xvOES		MANGLE(Vertex4xvOES)
-#define glVertexArrayAttribBinding		MANGLE(VertexArrayAttribBinding)
-#define glVertexArrayAttribFormat		MANGLE(VertexArrayAttribFormat)
-#define glVertexArrayAttribIFormat		MANGLE(VertexArrayAttribIFormat)
-#define glVertexArrayAttribLFormat		MANGLE(VertexArrayAttribLFormat)
-#define glVertexArrayBindingDivisor		MANGLE(VertexArrayBindingDivisor)
 #define glVertexArrayBindVertexBufferEXT		MANGLE(VertexArrayBindVertexBufferEXT)
 #define glVertexArrayColorOffsetEXT		MANGLE(VertexArrayColorOffsetEXT)
 #define glVertexArrayEdgeFlagOffsetEXT		MANGLE(VertexArrayEdgeFlagOffsetEXT)
-#define glVertexArrayElementBuffer		MANGLE(VertexArrayElementBuffer)
 #define glVertexArrayFogCoordOffsetEXT		MANGLE(VertexArrayFogCoordOffsetEXT)
 #define glVertexArrayIndexOffsetEXT		MANGLE(VertexArrayIndexOffsetEXT)
 #define glVertexArrayMultiTexCoordOffsetEXT		MANGLE(VertexArrayMultiTexCoordOffsetEXT)
@@ -2451,8 +2314,6 @@
 #define glVertexArrayVertexAttribLOffsetEXT		MANGLE(VertexArrayVertexAttribLOffsetEXT)
 #define glVertexArrayVertexAttribOffsetEXT		MANGLE(VertexArrayVertexAttribOffsetEXT)
 #define glVertexArrayVertexBindingDivisorEXT		MANGLE(VertexArrayVertexBindingDivisorEXT)
-#define glVertexArrayVertexBuffer		MANGLE(VertexArrayVertexBuffer)
-#define glVertexArrayVertexBuffers		MANGLE(VertexArrayVertexBuffers)
 #define glVertexArrayVertexOffsetEXT		MANGLE(VertexArrayVertexOffsetEXT)
 #define glVertexAttrib1dARB		MANGLE(VertexAttrib1dARB)
 #define glVertexAttrib1d		MANGLE(VertexAttrib1d)

include/GL/glxext.h

@@ -33,10 +33,10 @@ extern "C" {
 ** used to make the header, and the header can be found at
 **   http://www.opengl.org/registry/
 **
-** Khronos $Revision: 27684 $ on $Date: 2014-08-11 01:21:35 -0700 (Mon, 11 Aug 2014) $
+** Khronos $Revision: 25407 $ on $Date: 2014-02-18 16:51:56 -0800 (Tue, 18 Feb 2014) $
 */
 
-#define GLX_GLXEXT_VERSION 20140810
+#define GLX_GLXEXT_VERSION 20140218
 
 /* Generated C header for:
  * API: glx
@@ -158,13 +158,6 @@ __GLXextFuncPtr glXGetProcAddress (const GLubyte *procName);
 #endif
 #endif /* GLX_VERSION_1_4 */
 
-#ifndef GLX_ARB_context_flush_control
-#define GLX_ARB_context_flush_control 1
-#define GLX_CONTEXT_RELEASE_BEHAVIOR_ARB  0x2097
-#define GLX_CONTEXT_RELEASE_BEHAVIOR_NONE_ARB 0
-#define GLX_CONTEXT_RELEASE_BEHAVIOR_FLUSH_ARB 0x2098
-#endif /* GLX_ARB_context_flush_control */
-
 #ifndef GLX_ARB_create_context
 #define GLX_ARB_create_context 1
 #define GLX_CONTEXT_DEBUG_BIT_ARB         0x00000001
@@ -297,23 +290,6 @@ void glXFreeContextEXT (Display *dpy, GLXContext context);
 #endif
 #endif /* GLX_EXT_import_context */
 
-#ifndef GLX_EXT_stereo_tree
-#define GLX_EXT_stereo_tree 1
-typedef struct {
-    int type;
-    unsigned long serial;
-    Bool send_event;
-    Display *display;
-    int extension;
-    int evtype;
-    GLXDrawable window;
-    Bool stereo_tree;
-} GLXStereoNotifyEventEXT;
-#define GLX_STEREO_TREE_EXT               0x20F5
-#define GLX_STEREO_NOTIFY_MASK_EXT        0x00000001
-#define GLX_STEREO_NOTIFY_EXT             0x00000000
-#endif /* GLX_EXT_stereo_tree */
-
 #ifndef GLX_EXT_swap_control
 #define GLX_EXT_swap_control 1
 #define GLX_SWAP_INTERVAL_EXT             0x20F1
@@ -475,16 +451,6 @@ Bool glXSet3DfxModeMESA (int mode);
 #endif
 #endif /* GLX_MESA_set_3dfx_mode */
 
-#ifndef GLX_NV_copy_buffer
-#define GLX_NV_copy_buffer 1
-typedef void ( *PFNGLXCOPYBUFFERSUBDATANVPROC) (Display *dpy, GLXContext readCtx, GLXContext writeCtx, GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size);
-typedef void ( *PFNGLXNAMEDCOPYBUFFERSUBDATANVPROC) (Display *dpy, GLXContext readCtx, GLXContext writeCtx, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size);
-#ifdef GLX_GLXEXT_PROTOTYPES
-void glXCopyBufferSubDataNV (Display *dpy, GLXContext readCtx, GLXContext writeCtx, GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size);
-void glXNamedCopyBufferSubDataNV (Display *dpy, GLXContext readCtx, GLXContext writeCtx, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size);
-#endif
-#endif /* GLX_NV_copy_buffer */
-
 #ifndef GLX_NV_copy_image
 #define GLX_NV_copy_image 1
 typedef void ( *PFNGLXCOPYIMAGESUBDATANVPROC) (Display *dpy, GLXContext srcCtx, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLXContext dstCtx, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth);
@@ -561,8 +527,8 @@ void glXReleaseVideoCaptureDeviceNV (Display *dpy, GLXVideoCaptureDeviceNV devic
 #endif
 #endif /* GLX_NV_video_capture */
 
-#ifndef GLX_NV_video_out
-#define GLX_NV_video_out 1
+#ifndef GLX_NV_video_output
+#define GLX_NV_video_output 1
 typedef unsigned int GLXVideoDeviceNV;
 #define GLX_VIDEO_OUT_COLOR_NV            0x20C3
 #define GLX_VIDEO_OUT_ALPHA_NV            0x20C4
@@ -588,7 +554,7 @@ int glXReleaseVideoImageNV (Display *dpy, GLXPbuffer pbuf);
 int glXSendPbufferToVideoNV (Display *dpy, GLXPbuffer pbuf, int iBufferType, unsigned long *pulCounterPbuffer, GLboolean bBlock);
 int glXGetVideoInfoNV (Display *dpy, int screen, GLXVideoDeviceNV VideoDevice, unsigned long *pulCounterOutputPbuffer, unsigned long *pulCounterOutputVideo);
 #endif
-#endif /* GLX_NV_video_out */
+#endif /* GLX_NV_video_output */
 
 #ifndef GLX_OML_swap_method
 #define GLX_OML_swap_method 1

include/GL/internal/dri_interface.h

@@ -85,7 +85,6 @@ typedef struct __DRIdri2ExtensionRec		__DRIdri2Extension;
 typedef struct __DRIdri2LoaderExtensionRec	__DRIdri2LoaderExtension;
 typedef struct __DRI2flushExtensionRec	__DRI2flushExtension;
 typedef struct __DRI2throttleExtensionRec	__DRI2throttleExtension;
-typedef struct __DRI2fenceExtensionRec          __DRI2fenceExtension;
 
 
 typedef struct __DRIimageLoaderExtensionRec     __DRIimageLoaderExtension;
@@ -280,7 +279,6 @@ struct __DRItexBufferExtensionRec {
 
 #define __DRI2_FLUSH_DRAWABLE (1 << 0) /* the drawable should be flushed. */
 #define __DRI2_FLUSH_CONTEXT  (1 << 1) /* glFlush should be called */
-#define __DRI2_FLUSH_INVALIDATE_ANCILLARY (1 << 2)
 
 enum __DRI2throttleReason {
    __DRI2_THROTTLE_SWAPBUFFER,
@@ -340,65 +338,6 @@ struct __DRI2throttleExtensionRec {
 		    enum __DRI2throttleReason reason);
 };
 
-
-/**
- * Extension for fences / synchronization objects.
- */
-
-#define __DRI2_FENCE "DRI2_Fence"
-#define __DRI2_FENCE_VERSION 1
-
-#define __DRI2_FENCE_TIMEOUT_INFINITE     0xffffffffffffffffllu
-
-#define __DRI2_FENCE_FLAG_FLUSH_COMMANDS  (1 << 0)
-
-struct __DRI2fenceExtensionRec {
-   __DRIextension base;
-
-   /**
-    * Create and insert a fence into the command stream of the context.
-    */
-   void *(*create_fence)(__DRIcontext *ctx);
-
-   /**
-    * Get a fence associated with the OpenCL event object.
-    * This can be NULL, meaning that OpenCL interoperability is not supported.
-    */
-   void *(*get_fence_from_cl_event)(__DRIscreen *screen, intptr_t cl_event);
-
-   /**
-    * Destroy a fence.
-    */
-   void (*destroy_fence)(__DRIscreen *screen, void *fence);
-
-   /**
-    * This function waits and doesn't return until the fence is signalled
-    * or the timeout expires. It returns true if the fence has been signaled.
-    *
-    * \param ctx     the context where commands are flushed
-    * \param fence   the fence
-    * \param flags   a combination of __DRI2_FENCE_FLAG_xxx flags
-    * \param timeout the timeout in ns or __DRI2_FENCE_TIMEOUT_INFINITE
-    */
-   GLboolean (*client_wait_sync)(__DRIcontext *ctx, void *fence,
-                                 unsigned flags, uint64_t timeout);
-
-   /**
-    * This function enqueues a wait command into the command stream of
-    * the context and then returns. When the execution reaches the wait
-    * command, no further execution will be done in the context until
-    * the fence is signaled. This is a no-op if the device doesn't support
-    * parallel execution of contexts.
-    *
-    * \param ctx     the context where the waiting is done
-    * \param fence   the fence
-    * \param flags   a combination of __DRI2_FENCE_FLAG_xxx flags that make
-    *                sense with this function (right now there are none)
-    */
-   void (*server_wait_sync)(__DRIcontext *ctx, void *fence, unsigned flags);
-};
-
-
 /*@}*/
 
 /**
@@ -1066,7 +1005,7 @@ struct __DRIdri2ExtensionRec {
  * extensions.
  */
 #define __DRI_IMAGE "DRI_IMAGE"
-#define __DRI_IMAGE_VERSION 11
+#define __DRI_IMAGE_VERSION 8
 
 /**
  * These formats correspond to the similarly named MESA_FORMAT_*
@@ -1157,8 +1096,6 @@ struct __DRIdri2ExtensionRec {
 #define __DRI_IMAGE_ATTRIB_FD           0x2007 /* available in versions
                                                 * 7+. Each query will return a
                                                 * new fd. */
-#define __DRI_IMAGE_ATTRIB_FOURCC       0x2008 /* available in versions 11 */
-#define __DRI_IMAGE_ATTRIB_NUM_PLANES   0x2009 /* available in versions 11 */
 
 enum __DRIYUVColorSpace {
    __DRI_YUV_COLOR_SPACE_UNDEFINED = 0,
@@ -1180,8 +1117,7 @@ enum __DRIChromaSiting {
 };
 
 /**
- * \name Reasons that __DRIimageExtensionRec::createImageFromTexture or
- * __DRIimageExtensionRec::createImageFromDmaBufs might fail
+ * \name Reasons that __DRIimageExtensionRec::createImageFromTexture might fail
  */
 /*@{*/
 /** Success! */
@@ -1190,30 +1126,13 @@ enum __DRIChromaSiting {
 /** Memory allocation failure */
 #define __DRI_IMAGE_ERROR_BAD_ALLOC     1
 
-/** Client requested an invalid attribute */
+/** Client requested an invalid attribute for a texture object  */
 #define __DRI_IMAGE_ERROR_BAD_MATCH     2
 
 /** Client requested an invalid texture object */
 #define __DRI_IMAGE_ERROR_BAD_PARAMETER 3
-
-/** Client requested an invalid pitch and/or offset */
-#define __DRI_IMAGE_ERROR_BAD_ACCESS    4
 /*@}*/
 
-/**
- * \name Capabilities that might be returned by __DRIimageExtensionRec::getCapabilities
- */
-/*@{*/
-#define __DRI_IMAGE_CAP_GLOBAL_NAMES 1
-/*@}*/
-
-/**
- * blitImage flags
- */
-
-#define __BLIT_FLAG_FLUSH		0x0001
-#define __BLIT_FLAG_FINISH		0x0002
-
 typedef struct __DRIimageRec          __DRIimage;
 typedef struct __DRIimageExtensionRec __DRIimageExtension;
 struct __DRIimageExtensionRec {
@@ -1320,29 +1239,6 @@ struct __DRIimageExtensionRec {
                                          enum __DRIChromaSiting vert_siting,
                                          unsigned *error,
                                          void *loaderPrivate);
-
-   /**
-    * Blit a part of a __DRIimage to another and flushes
-    *
-    * flush_flag:
-    *    0:                  no flush
-    *    __BLIT_FLAG_FLUSH:  flush after the blit operation
-    *    __BLIT_FLAG_FINISH: flush and wait the blit finished
-    *
-    * \since 9
-    */
-   void (*blitImage)(__DRIcontext *context, __DRIimage *dst, __DRIimage *src,
-                     int dstx0, int dsty0, int dstwidth, int dstheight,
-                     int srcx0, int srcy0, int srcwidth, int srcheight,
-                     int flush_flag);
-
-   /**
-    * Query for general capabilities of the driver that concern
-    * buffer sharing and image importing.
-    *
-    * \since 10
-    */
-   int (*getCapabilities)(__DRIscreen *screen);
 };
 
 
@@ -1376,9 +1272,9 @@ typedef struct __DRI2configQueryExtensionRec __DRI2configQueryExtension;
 struct __DRI2configQueryExtensionRec {
    __DRIextension base;
 
-   int (*configQueryb)(__DRIscreen *screen, const char *var, unsigned char *val);
-   int (*configQueryi)(__DRIscreen *screen, const char *var, int *val);
-   int (*configQueryf)(__DRIscreen *screen, const char *var, float *val);
+   int (*configQueryb)(__DRIscreen *screen, const char *var, GLboolean *val);
+   int (*configQueryi)(__DRIscreen *screen, const char *var, GLint *val);
+   int (*configQueryf)(__DRIscreen *screen, const char *var, GLfloat *val);
 };
 
 /**

include/GL/internal/sarea.h

@@ -1,5 +1,5 @@
 /**
- * \file dri_sarea.h
+ * \file sarea.h 
  * SAREA definitions.
  * 
  * \author Kevin E. Martin <kevin@precisioninsight.com>

include/GL/osmesa.h

@@ -41,8 +41,10 @@
  *   OSMesaGetIntegerv - return OSMesa state parameters
  *
  *
- * The limits on the width and height of an image buffer can be retrieved
- * via OSMesaGetIntegerv(OSMESA_MAX_WIDTH/OSMESA_MAX_HEIGHT).
+ * The limits on the width and height of an image buffer are MAX_WIDTH and
+ * MAX_HEIGHT as defined in Mesa/src/config.h.  Defaults are 1280 and 1024.
+ * You can increase them as needed but beware that many temporary arrays in
+ * Mesa are dimensioned by MAX_WIDTH or MAX_HEIGHT.
  */
 
 

include/GL/wmesa.h

@@ -0,0 +1,140 @@
+/*
+ * Mesa 3-D graphics library
+ * Copyright (C) 1995-1998  Brian Paul
+ *
+ * This library is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2 of the License, or (at your option) any later version.
+ *
+ * This library is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
+ * Library General Public License for more details.
+ *
+ * You should have received a copy of the GNU Library General Public
+ * License along with this library; if not, write to the Free
+ * Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
+ *
+ */
+
+
+/*
+ * Windows driver by: Mark E. Peterson (markp@ic.mankato.mn.us)
+ * Updated by Li Wei (liwei@aiar.xjtu.edu.cn)
+ *
+ *
+ ***************************************************************
+ *                     WMesa                                   *
+ *                     version 2.3                             *	
+ *                                                             *
+ *                        By                                   *
+ *                      Li Wei                                 *
+ *       Institute of Artificial Intelligence & Robotics       *
+ *       Xi'an Jiaotong University                             *
+ *       Email: liwei@aiar.xjtu.edu.cn                         * 
+ *       Web page: http://sun.aiar.xjtu.edu.cn                 *
+ *                                                             *
+ *	       July 7th, 1997				       *
+ ***************************************************************
+ */
+
+
+#ifndef WMESA_H
+#define WMESA_H
+
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+
+#include "GL/gl.h"
+
+#if defined(_MSV_VER) && !defined(__GNUC__)
+#  pragma warning (disable:4273)
+#  pragma warning( disable : 4244 ) /* '=' : conversion from 'const double ' to 'float ', possible loss of data */
+#  pragma warning( disable : 4018 ) /* '<' : signed/unsigned mismatch */
+#  pragma warning( disable : 4305 ) /* '=' : truncation from 'const double ' to 'float ' */
+#  pragma warning( disable : 4013 ) /* 'function' undefined; assuming extern returning int */
+#  pragma warning( disable : 4761 ) /* integral size mismatch in argument; conversion supplied */
+#  pragma warning( disable : 4273 ) /* 'identifier' : inconsistent DLL linkage. dllexport assumed */
+#  if (MESA_WARNQUIET>1)
+#    pragma warning( disable : 4146 ) /* unary minus operator applied to unsigned type, result still unsigned */
+#  endif
+#endif
+
+/*
+ * This is the WMesa context 'handle':
+ */
+typedef struct wmesa_context *WMesaContext;
+
+
+
+/*
+ * Create a new WMesaContext for rendering into a window.  You must
+ * have already created the window of correct visual type and with an
+ * appropriate colormap.
+ *
+ * Input:
+ *         hDC - Windows device or memory context
+ *         Pal  - Palette to use
+ *         rgb_flag - GL_TRUE = RGB mode,
+ *                    GL_FALSE = color index mode
+ *         db_flag - GL_TRUE = double-buffered,
+ *                   GL_FALSE = single buffered
+ *         alpha_flag - GL_TRUE = create software alpha buffer,
+ *                      GL_FALSE = no software alpha buffer
+ *
+ * Note: Indexed mode requires double buffering under Windows.
+ *
+ * Return:  a WMesa_context or NULL if error.
+ */
+extern WMesaContext WMesaCreateContext(HDC hDC,HPALETTE* pPal,
+                                       GLboolean rgb_flag,
+                                       GLboolean db_flag,
+                                       GLboolean alpha_flag);
+
+
+/*
+ * Destroy a rendering context as returned by WMesaCreateContext()
+ */
+extern void WMesaDestroyContext( WMesaContext ctx );
+
+
+
+/*
+ * Make the specified context the current one.
+ */
+extern void WMesaMakeCurrent( WMesaContext ctx, HDC hdc );
+
+
+/*
+ * Return a handle to the current context.
+ */
+extern WMesaContext WMesaGetCurrentContext( void );
+
+
+/*
+ * Swap the front and back buffers for the current context.  No action
+ * taken if the context is not double buffered.
+ */
+extern void WMesaSwapBuffers(HDC hdc);
+
+
+/*
+ * In indexed color mode we need to know when the palette changes.
+ */
+extern void WMesaPaletteChange(HPALETTE Pal);
+
+extern void WMesaMove(void);
+
+void WMesaShareLists(WMesaContext ctx_to_share, WMesaContext ctx);
+
+#ifdef __cplusplus
+}
+#endif
+
+
+#endif
+

include/GLES2/gl2ext.h

@@ -33,14 +33,14 @@ extern "C" {
 ** used to make the header, and the header can be found at
 **   http://www.opengl.org/registry/
 **
-** Khronos $Revision: 28335 $ on $Date: 2014-09-26 18:55:45 -0700 (Fri, 26 Sep 2014) $
+** Khronos $Revision: 25922 $ on $Date: 2014-03-17 03:54:32 -0700 (Mon, 17 Mar 2014) $
 */
 
 #ifndef GL_APIENTRYP
 #define GL_APIENTRYP GL_APIENTRY*
 #endif
 
-/* Generated on date 20140926 */
+/* Generated on date 20140317 */
 
 /* Generated C header for:
  * API: gles2
@@ -54,6 +54,7 @@ extern "C" {
 
 #ifndef GL_KHR_blend_equation_advanced
 #define GL_KHR_blend_equation_advanced 1
+#define GL_BLEND_ADVANCED_COHERENT_KHR    0x9285
 #define GL_MULTIPLY_KHR                   0x9294
 #define GL_SCREEN_KHR                     0x9295
 #define GL_OVERLAY_KHR                    0x9296
@@ -75,17 +76,6 @@ GL_APICALL void GL_APIENTRY glBlendBarrierKHR (void);
 #endif
 #endif /* GL_KHR_blend_equation_advanced */
 
-#ifndef GL_KHR_blend_equation_advanced_coherent
-#define GL_KHR_blend_equation_advanced_coherent 1
-#define GL_BLEND_ADVANCED_COHERENT_KHR    0x9285
-#endif /* GL_KHR_blend_equation_advanced_coherent */
-
-#ifndef GL_KHR_context_flush_control
-#define GL_KHR_context_flush_control 1
-#define GL_CONTEXT_RELEASE_BEHAVIOR_KHR   0x82FB
-#define GL_CONTEXT_RELEASE_BEHAVIOR_FLUSH_KHR 0x82FC
-#endif /* GL_KHR_context_flush_control */
-
 #ifndef GL_KHR_debug
 #define GL_KHR_debug 1
 typedef void (GL_APIENTRY  *GLDEBUGPROCKHR)(GLenum source,GLenum type,GLuint id,GLenum severity,GLsizei length,const GLchar *message,const void *userParam);
@@ -155,34 +145,6 @@ GL_APICALL void GL_APIENTRY glGetPointervKHR (GLenum pname, void **params);
 #endif
 #endif /* GL_KHR_debug */
 
-#ifndef GL_KHR_robust_buffer_access_behavior
-#define GL_KHR_robust_buffer_access_behavior 1
-#endif /* GL_KHR_robust_buffer_access_behavior */
-
-#ifndef GL_KHR_robustness
-#define GL_KHR_robustness 1
-#define GL_CONTEXT_ROBUST_ACCESS_KHR      0x90F3
-#define GL_LOSE_CONTEXT_ON_RESET_KHR      0x8252
-#define GL_GUILTY_CONTEXT_RESET_KHR       0x8253
-#define GL_INNOCENT_CONTEXT_RESET_KHR     0x8254
-#define GL_UNKNOWN_CONTEXT_RESET_KHR      0x8255
-#define GL_RESET_NOTIFICATION_STRATEGY_KHR 0x8256
-#define GL_NO_RESET_NOTIFICATION_KHR      0x8261
-#define GL_CONTEXT_LOST_KHR               0x0507
-typedef GLenum (GL_APIENTRYP PFNGLGETGRAPHICSRESETSTATUSKHRPROC) (void);
-typedef void (GL_APIENTRYP PFNGLREADNPIXELSKHRPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data);
-typedef void (GL_APIENTRYP PFNGLGETNUNIFORMFVKHRPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat *params);
-typedef void (GL_APIENTRYP PFNGLGETNUNIFORMIVKHRPROC) (GLuint program, GLint location, GLsizei bufSize, GLint *params);
-typedef void (GL_APIENTRYP PFNGLGETNUNIFORMUIVKHRPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint *params);
-#ifdef GL_GLEXT_PROTOTYPES
-GL_APICALL GLenum GL_APIENTRY glGetGraphicsResetStatusKHR (void);
-GL_APICALL void GL_APIENTRY glReadnPixelsKHR (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data);
-GL_APICALL void GL_APIENTRY glGetnUniformfvKHR (GLuint program, GLint location, GLsizei bufSize, GLfloat *params);
-GL_APICALL void GL_APIENTRY glGetnUniformivKHR (GLuint program, GLint location, GLsizei bufSize, GLint *params);
-GL_APICALL void GL_APIENTRY glGetnUniformuivKHR (GLuint program, GLint location, GLsizei bufSize, GLuint *params);
-#endif
-#endif /* GL_KHR_robustness */
-
 #ifndef GL_KHR_texture_compression_astc_hdr
 #define GL_KHR_texture_compression_astc_hdr 1
 #define GL_COMPRESSED_RGBA_ASTC_4x4_KHR   0x93B0
@@ -238,10 +200,6 @@ GL_APICALL void GL_APIENTRY glEGLImageTargetRenderbufferStorageOES (GLenum targe
 #define GL_SAMPLER_EXTERNAL_OES           0x8D66
 #endif /* GL_OES_EGL_image_external */
 
-#ifndef GL_OES_compressed_ETC1_RGB8_sub_texture
-#define GL_OES_compressed_ETC1_RGB8_sub_texture 1
-#endif /* GL_OES_compressed_ETC1_RGB8_sub_texture */
-
 #ifndef GL_OES_compressed_ETC1_RGB8_texture
 #define GL_OES_compressed_ETC1_RGB8_texture 1
 #define GL_ETC1_RGB8_OES                  0x8D64
@@ -554,10 +512,6 @@ GL_APICALL void GL_APIENTRY glGetPerfMonitorCounterDataAMD (GLuint monitor, GLen
 #define GL_Z400_BINARY_AMD                0x8740
 #endif /* GL_AMD_program_binary_Z400 */
 
-#ifndef GL_ANDROID_extension_pack_es31a
-#define GL_ANDROID_extension_pack_es31a 1
-#endif /* GL_ANDROID_extension_pack_es31a */
-
 #ifndef GL_ANGLE_depth_texture
 #define GL_ANGLE_depth_texture 1
 #endif /* GL_ANGLE_depth_texture */
@@ -633,23 +587,6 @@ GL_APICALL void GL_APIENTRY glGetTranslatedShaderSourceANGLE (GLuint shader, GLs
 #endif
 #endif /* GL_ANGLE_translated_shader_source */
 
-#ifndef GL_APPLE_clip_distance
-#define GL_APPLE_clip_distance 1
-#define GL_MAX_CLIP_DISTANCES_APPLE       0x0D32
-#define GL_CLIP_DISTANCE0_APPLE           0x3000
-#define GL_CLIP_DISTANCE1_APPLE           0x3001
-#define GL_CLIP_DISTANCE2_APPLE           0x3002
-#define GL_CLIP_DISTANCE3_APPLE           0x3003
-#define GL_CLIP_DISTANCE4_APPLE           0x3004
-#define GL_CLIP_DISTANCE5_APPLE           0x3005
-#define GL_CLIP_DISTANCE6_APPLE           0x3006
-#define GL_CLIP_DISTANCE7_APPLE           0x3007
-#endif /* GL_APPLE_clip_distance */
-
-#ifndef GL_APPLE_color_buffer_packed_float
-#define GL_APPLE_color_buffer_packed_float 1
-#endif /* GL_APPLE_color_buffer_packed_float */
-
 #ifndef GL_APPLE_copy_texture_levels
 #define GL_APPLE_copy_texture_levels 1
 typedef void (GL_APIENTRYP PFNGLCOPYTEXTURELEVELSAPPLEPROC) (GLuint destinationTexture, GLuint sourceTexture, GLint sourceBaseLevel, GLsizei sourceLevelCount);
@@ -730,14 +667,6 @@ GL_APICALL void GL_APIENTRY glGetSyncivAPPLE (GLsync sync, GLenum pname, GLsizei
 #define GL_TEXTURE_MAX_LEVEL_APPLE        0x813D
 #endif /* GL_APPLE_texture_max_level */
 
-#ifndef GL_APPLE_texture_packed_float
-#define GL_APPLE_texture_packed_float 1
-#define GL_UNSIGNED_INT_10F_11F_11F_REV_APPLE 0x8C3B
-#define GL_UNSIGNED_INT_5_9_9_9_REV_APPLE 0x8C3E
-#define GL_R11F_G11F_B10F_APPLE           0x8C3A
-#define GL_RGB9_E5_APPLE                  0x8C3D
-#endif /* GL_APPLE_texture_packed_float */
-
 #ifndef GL_ARM_mali_program_binary
 #define GL_ARM_mali_program_binary 1
 #define GL_MALI_PROGRAM_BINARY_ARM        0x8F61
@@ -762,13 +691,6 @@ GL_APICALL void GL_APIENTRY glGetSyncivAPPLE (GLsync sync, GLenum pname, GLsizei
 #define GL_ARM_shader_framebuffer_fetch_depth_stencil 1
 #endif /* GL_ARM_shader_framebuffer_fetch_depth_stencil */
 
-#ifndef GL_DMP_program_binary
-#define GL_DMP_program_binary 1
-#define GL_SMAPHS30_PROGRAM_BINARY_DMP    0x9251
-#define GL_SMAPHS_PROGRAM_BINARY_DMP      0x9252
-#define GL_DMP_PROGRAM_BINARY_DMP         0x9253
-#endif /* GL_DMP_program_binary */
-
 #ifndef GL_DMP_shader_binary
 #define GL_DMP_shader_binary 1
 #define GL_SHADER_BINARY_DMP              0x9250
@@ -790,14 +712,6 @@ GL_APICALL void GL_APIENTRY glGetSyncivAPPLE (GLsync sync, GLenum pname, GLsizei
 #define GL_UNSIGNED_NORMALIZED_EXT        0x8C17
 #endif /* GL_EXT_color_buffer_half_float */
 
-#ifndef GL_EXT_copy_image
-#define GL_EXT_copy_image 1
-typedef void (GL_APIENTRYP PFNGLCOPYIMAGESUBDATAEXTPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth);
-#ifdef GL_GLEXT_PROTOTYPES
-GL_APICALL void GL_APIENTRY glCopyImageSubDataEXT (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth);
-#endif
-#endif /* GL_EXT_copy_image */
-
 #ifndef GL_EXT_debug_label
 #define GL_EXT_debug_label 1
 #define GL_PROGRAM_PIPELINE_OBJECT_EXT    0x8A4F
@@ -915,30 +829,6 @@ GL_APICALL void GL_APIENTRY glDrawBuffersEXT (GLsizei n, const GLenum *bufs);
 #endif
 #endif /* GL_EXT_draw_buffers */
 
-#ifndef GL_EXT_draw_buffers_indexed
-#define GL_EXT_draw_buffers_indexed 1
-#define GL_MIN                            0x8007
-#define GL_MAX                            0x8008
-typedef void (GL_APIENTRYP PFNGLENABLEIEXTPROC) (GLenum target, GLuint index);
-typedef void (GL_APIENTRYP PFNGLDISABLEIEXTPROC) (GLenum target, GLuint index);
-typedef void (GL_APIENTRYP PFNGLBLENDEQUATIONIEXTPROC) (GLuint buf, GLenum mode);
-typedef void (GL_APIENTRYP PFNGLBLENDEQUATIONSEPARATEIEXTPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha);
-typedef void (GL_APIENTRYP PFNGLBLENDFUNCIEXTPROC) (GLuint buf, GLenum src, GLenum dst);
-typedef void (GL_APIENTRYP PFNGLBLENDFUNCSEPARATEIEXTPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha);
-typedef void (GL_APIENTRYP PFNGLCOLORMASKIEXTPROC) (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a);
-typedef GLboolean (GL_APIENTRYP PFNGLISENABLEDIEXTPROC) (GLenum target, GLuint index);
-#ifdef GL_GLEXT_PROTOTYPES
-GL_APICALL void GL_APIENTRY glEnableiEXT (GLenum target, GLuint index);
-GL_APICALL void GL_APIENTRY glDisableiEXT (GLenum target, GLuint index);
-GL_APICALL void GL_APIENTRY glBlendEquationiEXT (GLuint buf, GLenum mode);
-GL_APICALL void GL_APIENTRY glBlendEquationSeparateiEXT (GLuint buf, GLenum modeRGB, GLenum modeAlpha);
-GL_APICALL void GL_APIENTRY glBlendFunciEXT (GLuint buf, GLenum src, GLenum dst);
-GL_APICALL void GL_APIENTRY glBlendFuncSeparateiEXT (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha);
-GL_APICALL void GL_APIENTRY glColorMaskiEXT (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a);
-GL_APICALL GLboolean GL_APIENTRY glIsEnablediEXT (GLenum target, GLuint index);
-#endif
-#endif /* GL_EXT_draw_buffers_indexed */
-
 #ifndef GL_EXT_draw_instanced
 #define GL_EXT_draw_instanced 1
 typedef void (GL_APIENTRYP PFNGLDRAWARRAYSINSTANCEDEXTPROC) (GLenum mode, GLint start, GLsizei count, GLsizei primcount);
@@ -949,55 +839,6 @@ GL_APICALL void GL_APIENTRY glDrawElementsInstancedEXT (GLenum mode, GLsizei cou
 #endif
 #endif /* GL_EXT_draw_instanced */
 
-#ifndef GL_EXT_geometry_point_size
-#define GL_EXT_geometry_point_size 1
-#endif /* GL_EXT_geometry_point_size */
-
-#ifndef GL_EXT_geometry_shader
-#define GL_EXT_geometry_shader 1
-#define GL_GEOMETRY_SHADER_EXT            0x8DD9
-#define GL_GEOMETRY_SHADER_BIT_EXT        0x00000004
-#define GL_GEOMETRY_LINKED_VERTICES_OUT_EXT 0x8916
-#define GL_GEOMETRY_LINKED_INPUT_TYPE_EXT 0x8917
-#define GL_GEOMETRY_LINKED_OUTPUT_TYPE_EXT 0x8918
-#define GL_GEOMETRY_SHADER_INVOCATIONS_EXT 0x887F
-#define GL_LAYER_PROVOKING_VERTEX_EXT     0x825E
-#define GL_LINES_ADJACENCY_EXT            0x000A
-#define GL_LINE_STRIP_ADJACENCY_EXT       0x000B
-#define GL_TRIANGLES_ADJACENCY_EXT        0x000C
-#define GL_TRIANGLE_STRIP_ADJACENCY_EXT   0x000D
-#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS_EXT 0x8DDF
-#define GL_MAX_GEOMETRY_UNIFORM_BLOCKS_EXT 0x8A2C
-#define GL_MAX_COMBINED_GEOMETRY_UNIFORM_COMPONENTS_EXT 0x8A32
-#define GL_MAX_GEOMETRY_INPUT_COMPONENTS_EXT 0x9123
-#define GL_MAX_GEOMETRY_OUTPUT_COMPONENTS_EXT 0x9124
-#define GL_MAX_GEOMETRY_OUTPUT_VERTICES_EXT 0x8DE0
-#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS_EXT 0x8DE1
-#define GL_MAX_GEOMETRY_SHADER_INVOCATIONS_EXT 0x8E5A
-#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_EXT 0x8C29
-#define GL_MAX_GEOMETRY_ATOMIC_COUNTER_BUFFERS_EXT 0x92CF
-#define GL_MAX_GEOMETRY_ATOMIC_COUNTERS_EXT 0x92D5
-#define GL_MAX_GEOMETRY_IMAGE_UNIFORMS_EXT 0x90CD
-#define GL_MAX_GEOMETRY_SHADER_STORAGE_BLOCKS_EXT 0x90D7
-#define GL_FIRST_VERTEX_CONVENTION_EXT    0x8E4D
-#define GL_LAST_VERTEX_CONVENTION_EXT     0x8E4E
-#define GL_UNDEFINED_VERTEX_EXT           0x8260
-#define GL_PRIMITIVES_GENERATED_EXT       0x8C87
-#define GL_FRAMEBUFFER_DEFAULT_LAYERS_EXT 0x9312
-#define GL_MAX_FRAMEBUFFER_LAYERS_EXT     0x9317
-#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_EXT 0x8DA8
-#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED_EXT 0x8DA7
-#define GL_REFERENCED_BY_GEOMETRY_SHADER_EXT 0x9309
-typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERTEXTUREEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level);
-#ifdef GL_GLEXT_PROTOTYPES
-GL_APICALL void GL_APIENTRY glFramebufferTextureEXT (GLenum target, GLenum attachment, GLuint texture, GLint level);
-#endif
-#endif /* GL_EXT_geometry_shader */
-
-#ifndef GL_EXT_gpu_shader5
-#define GL_EXT_gpu_shader5 1
-#endif /* GL_EXT_gpu_shader5 */
-
 #ifndef GL_EXT_instanced_arrays
 #define GL_EXT_instanced_arrays 1
 #define GL_VERTEX_ATTRIB_ARRAY_DIVISOR_EXT 0x88FE
@@ -1070,23 +911,12 @@ GL_APICALL void GL_APIENTRY glGetIntegeri_vEXT (GLenum target, GLuint index, GLi
 #define GL_ANY_SAMPLES_PASSED_CONSERVATIVE_EXT 0x8D6A
 #endif /* GL_EXT_occlusion_query_boolean */
 
-#ifndef GL_EXT_primitive_bounding_box
-#define GL_EXT_primitive_bounding_box 1
-#define GL_PRIMITIVE_BOUNDING_BOX_EXT     0x92BE
-typedef void (GL_APIENTRYP PFNGLPRIMITIVEBOUNDINGBOXEXTPROC) (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW);
-#ifdef GL_GLEXT_PROTOTYPES
-GL_APICALL void GL_APIENTRY glPrimitiveBoundingBoxEXT (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW);
-#endif
-#endif /* GL_EXT_primitive_bounding_box */
-
 #ifndef GL_EXT_pvrtc_sRGB
 #define GL_EXT_pvrtc_sRGB 1
 #define GL_COMPRESSED_SRGB_PVRTC_2BPPV1_EXT 0x8A54
 #define GL_COMPRESSED_SRGB_PVRTC_4BPPV1_EXT 0x8A55
 #define GL_COMPRESSED_SRGB_ALPHA_PVRTC_2BPPV1_EXT 0x8A56
 #define GL_COMPRESSED_SRGB_ALPHA_PVRTC_4BPPV1_EXT 0x8A57
-#define GL_COMPRESSED_SRGB_ALPHA_PVRTC_2BPPV2_IMG 0x93F0
-#define GL_COMPRESSED_SRGB_ALPHA_PVRTC_4BPPV2_IMG 0x93F1
 #endif /* GL_EXT_pvrtc_sRGB */
 
 #ifndef GL_EXT_read_format_bgra
@@ -1234,18 +1064,10 @@ GL_APICALL void GL_APIENTRY glProgramUniformMatrix4x3fvEXT (GLuint program, GLin
 #define GL_FRAGMENT_SHADER_DISCARDS_SAMPLES_EXT 0x8A52
 #endif /* GL_EXT_shader_framebuffer_fetch */
 
-#ifndef GL_EXT_shader_implicit_conversions
-#define GL_EXT_shader_implicit_conversions 1
-#endif /* GL_EXT_shader_implicit_conversions */
-
 #ifndef GL_EXT_shader_integer_mix
 #define GL_EXT_shader_integer_mix 1
 #endif /* GL_EXT_shader_integer_mix */
 
-#ifndef GL_EXT_shader_io_blocks
-#define GL_EXT_shader_io_blocks 1
-#endif /* GL_EXT_shader_io_blocks */
-
 #ifndef GL_EXT_shader_pixel_local_storage
 #define GL_EXT_shader_pixel_local_storage 1
 #define GL_MAX_SHADER_PIXEL_LOCAL_STORAGE_FAST_SIZE_EXT 0x8F63
@@ -1265,109 +1087,6 @@ GL_APICALL void GL_APIENTRY glProgramUniformMatrix4x3fvEXT (GLuint program, GLin
 #define GL_SAMPLER_2D_SHADOW_EXT          0x8B62
 #endif /* GL_EXT_shadow_samplers */
 
-#ifndef GL_EXT_tessellation_point_size
-#define GL_EXT_tessellation_point_size 1
-#endif /* GL_EXT_tessellation_point_size */
-
-#ifndef GL_EXT_tessellation_shader
-#define GL_EXT_tessellation_shader 1
-#define GL_PATCHES_EXT                    0x000E
-#define GL_PATCH_VERTICES_EXT             0x8E72
-#define GL_TESS_CONTROL_OUTPUT_VERTICES_EXT 0x8E75
-#define GL_TESS_GEN_MODE_EXT              0x8E76
-#define GL_TESS_GEN_SPACING_EXT           0x8E77
-#define GL_TESS_GEN_VERTEX_ORDER_EXT      0x8E78
-#define GL_TESS_GEN_POINT_MODE_EXT        0x8E79
-#define GL_ISOLINES_EXT                   0x8E7A
-#define GL_QUADS_EXT                      0x0007
-#define GL_FRACTIONAL_ODD_EXT             0x8E7B
-#define GL_FRACTIONAL_EVEN_EXT            0x8E7C
-#define GL_MAX_PATCH_VERTICES_EXT         0x8E7D
-#define GL_MAX_TESS_GEN_LEVEL_EXT         0x8E7E
-#define GL_MAX_TESS_CONTROL_UNIFORM_COMPONENTS_EXT 0x8E7F
-#define GL_MAX_TESS_EVALUATION_UNIFORM_COMPONENTS_EXT 0x8E80
-#define GL_MAX_TESS_CONTROL_TEXTURE_IMAGE_UNITS_EXT 0x8E81
-#define GL_MAX_TESS_EVALUATION_TEXTURE_IMAGE_UNITS_EXT 0x8E82
-#define GL_MAX_TESS_CONTROL_OUTPUT_COMPONENTS_EXT 0x8E83
-#define GL_MAX_TESS_PATCH_COMPONENTS_EXT  0x8E84
-#define GL_MAX_TESS_CONTROL_TOTAL_OUTPUT_COMPONENTS_EXT 0x8E85
-#define GL_MAX_TESS_EVALUATION_OUTPUT_COMPONENTS_EXT 0x8E86
-#define GL_MAX_TESS_CONTROL_UNIFORM_BLOCKS_EXT 0x8E89
-#define GL_MAX_TESS_EVALUATION_UNIFORM_BLOCKS_EXT 0x8E8A
-#define GL_MAX_TESS_CONTROL_INPUT_COMPONENTS_EXT 0x886C
-#define GL_MAX_TESS_EVALUATION_INPUT_COMPONENTS_EXT 0x886D
-#define GL_MAX_COMBINED_TESS_CONTROL_UNIFORM_COMPONENTS_EXT 0x8E1E
-#define GL_MAX_COMBINED_TESS_EVALUATION_UNIFORM_COMPONENTS_EXT 0x8E1F
-#define GL_MAX_TESS_CONTROL_ATOMIC_COUNTER_BUFFERS_EXT 0x92CD
-#define GL_MAX_TESS_EVALUATION_ATOMIC_COUNTER_BUFFERS_EXT 0x92CE
-#define GL_MAX_TESS_CONTROL_ATOMIC_COUNTERS_EXT 0x92D3
-#define GL_MAX_TESS_EVALUATION_ATOMIC_COUNTERS_EXT 0x92D4
-#define GL_MAX_TESS_CONTROL_IMAGE_UNIFORMS_EXT 0x90CB
-#define GL_MAX_TESS_EVALUATION_IMAGE_UNIFORMS_EXT 0x90CC
-#define GL_MAX_TESS_CONTROL_SHADER_STORAGE_BLOCKS_EXT 0x90D8
-#define GL_MAX_TESS_EVALUATION_SHADER_STORAGE_BLOCKS_EXT 0x90D9
-#define GL_PRIMITIVE_RESTART_FOR_PATCHES_SUPPORTED 0x8221
-#define GL_IS_PER_PATCH_EXT               0x92E7
-#define GL_REFERENCED_BY_TESS_CONTROL_SHADER_EXT 0x9307
-#define GL_REFERENCED_BY_TESS_EVALUATION_SHADER_EXT 0x9308
-#define GL_TESS_CONTROL_SHADER_EXT        0x8E88
-#define GL_TESS_EVALUATION_SHADER_EXT     0x8E87
-#define GL_TESS_CONTROL_SHADER_BIT_EXT    0x00000008
-#define GL_TESS_EVALUATION_SHADER_BIT_EXT 0x00000010
-typedef void (GL_APIENTRYP PFNGLPATCHPARAMETERIEXTPROC) (GLenum pname, GLint value);
-#ifdef GL_GLEXT_PROTOTYPES
-GL_APICALL void GL_APIENTRY glPatchParameteriEXT (GLenum pname, GLint value);
-#endif
-#endif /* GL_EXT_tessellation_shader */
-
-#ifndef GL_EXT_texture_border_clamp
-#define GL_EXT_texture_border_clamp 1
-#define GL_TEXTURE_BORDER_COLOR_EXT       0x1004
-#define GL_CLAMP_TO_BORDER_EXT            0x812D
-typedef void (GL_APIENTRYP PFNGLTEXPARAMETERIIVEXTPROC) (GLenum target, GLenum pname, const GLint *params);
-typedef void (GL_APIENTRYP PFNGLTEXPARAMETERIUIVEXTPROC) (GLenum target, GLenum pname, const GLuint *params);
-typedef void (GL_APIENTRYP PFNGLGETTEXPARAMETERIIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
-typedef void (GL_APIENTRYP PFNGLGETTEXPARAMETERIUIVEXTPROC) (GLenum target, GLenum pname, GLuint *params);
-typedef void (GL_APIENTRYP PFNGLSAMPLERPARAMETERIIVEXTPROC) (GLuint sampler, GLenum pname, const GLint *param);
-typedef void (GL_APIENTRYP PFNGLSAMPLERPARAMETERIUIVEXTPROC) (GLuint sampler, GLenum pname, const GLuint *param);
-typedef void (GL_APIENTRYP PFNGLGETSAMPLERPARAMETERIIVEXTPROC) (GLuint sampler, GLenum pname, GLint *params);
-typedef void (GL_APIENTRYP PFNGLGETSAMPLERPARAMETERIUIVEXTPROC) (GLuint sampler, GLenum pname, GLuint *params);
-#ifdef GL_GLEXT_PROTOTYPES
-GL_APICALL void GL_APIENTRY glTexParameterIivEXT (GLenum target, GLenum pname, const GLint *params);
-GL_APICALL void GL_APIENTRY glTexParameterIuivEXT (GLenum target, GLenum pname, const GLuint *params);
-GL_APICALL void GL_APIENTRY glGetTexParameterIivEXT (GLenum target, GLenum pname, GLint *params);
-GL_APICALL void GL_APIENTRY glGetTexParameterIuivEXT (GLenum target, GLenum pname, GLuint *params);
-GL_APICALL void GL_APIENTRY glSamplerParameterIivEXT (GLuint sampler, GLenum pname, const GLint *param);
-GL_APICALL void GL_APIENTRY glSamplerParameterIuivEXT (GLuint sampler, GLenum pname, const GLuint *param);
-GL_APICALL void GL_APIENTRY glGetSamplerParameterIivEXT (GLuint sampler, GLenum pname, GLint *params);
-GL_APICALL void GL_APIENTRY glGetSamplerParameterIuivEXT (GLuint sampler, GLenum pname, GLuint *params);
-#endif
-#endif /* GL_EXT_texture_border_clamp */
-
-#ifndef GL_EXT_texture_buffer
-#define GL_EXT_texture_buffer 1
-#define GL_TEXTURE_BUFFER_EXT             0x8C2A
-#define GL_TEXTURE_BUFFER_BINDING_EXT     0x8C2A
-#define GL_MAX_TEXTURE_BUFFER_SIZE_EXT    0x8C2B
-#define GL_TEXTURE_BINDING_BUFFER_EXT     0x8C2C
-#define GL_TEXTURE_BUFFER_DATA_STORE_BINDING_EXT 0x8C2D
-#define GL_TEXTURE_BUFFER_OFFSET_ALIGNMENT_EXT 0x919F
-#define GL_SAMPLER_BUFFER_EXT             0x8DC2
-#define GL_INT_SAMPLER_BUFFER_EXT         0x8DD0
-#define GL_UNSIGNED_INT_SAMPLER_BUFFER_EXT 0x8DD8
-#define GL_IMAGE_BUFFER_EXT               0x9051
-#define GL_INT_IMAGE_BUFFER_EXT           0x905C
-#define GL_UNSIGNED_INT_IMAGE_BUFFER_EXT  0x9067
-#define GL_TEXTURE_BUFFER_OFFSET_EXT      0x919D
-#define GL_TEXTURE_BUFFER_SIZE_EXT        0x919E
-typedef void (GL_APIENTRYP PFNGLTEXBUFFEREXTPROC) (GLenum target, GLenum internalformat, GLuint buffer);
-typedef void (GL_APIENTRYP PFNGLTEXBUFFERRANGEEXTPROC) (GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size);
-#ifdef GL_GLEXT_PROTOTYPES
-GL_APICALL void GL_APIENTRY glTexBufferEXT (GLenum target, GLenum internalformat, GLuint buffer);
-GL_APICALL void GL_APIENTRY glTexBufferRangeEXT (GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size);
-#endif
-#endif /* GL_EXT_texture_buffer */
-
 #ifndef GL_EXT_texture_compression_dxt1
 #define GL_EXT_texture_compression_dxt1 1
 #define GL_COMPRESSED_RGB_S3TC_DXT1_EXT   0x83F0
@@ -1380,19 +1099,6 @@ GL_APICALL void GL_APIENTRY glTexBufferRangeEXT (GLenum target, GLenum internalf
 #define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT  0x83F3
 #endif /* GL_EXT_texture_compression_s3tc */
 
-#ifndef GL_EXT_texture_cube_map_array
-#define GL_EXT_texture_cube_map_array 1
-#define GL_TEXTURE_CUBE_MAP_ARRAY_EXT     0x9009
-#define GL_TEXTURE_BINDING_CUBE_MAP_ARRAY_EXT 0x900A
-#define GL_SAMPLER_CUBE_MAP_ARRAY_EXT     0x900C
-#define GL_SAMPLER_CUBE_MAP_ARRAY_SHADOW_EXT 0x900D
-#define GL_INT_SAMPLER_CUBE_MAP_ARRAY_EXT 0x900E
-#define GL_UNSIGNED_INT_SAMPLER_CUBE_MAP_ARRAY_EXT 0x900F
-#define GL_IMAGE_CUBE_MAP_ARRAY_EXT       0x9054
-#define GL_INT_IMAGE_CUBE_MAP_ARRAY_EXT   0x905F
-#define GL_UNSIGNED_INT_IMAGE_CUBE_MAP_ARRAY_EXT 0x906A
-#endif /* GL_EXT_texture_cube_map_array */
-
 #ifndef GL_EXT_texture_filter_anisotropic
 #define GL_EXT_texture_filter_anisotropic 1
 #define GL_TEXTURE_MAX_ANISOTROPY_EXT     0x84FE
@@ -1455,19 +1161,6 @@ GL_APICALL void GL_APIENTRY glTextureStorage3DEXT (GLuint texture, GLenum target
 #define GL_UNSIGNED_INT_2_10_10_10_REV_EXT 0x8368
 #endif /* GL_EXT_texture_type_2_10_10_10_REV */
 
-#ifndef GL_EXT_texture_view
-#define GL_EXT_texture_view 1
-#define GL_TEXTURE_VIEW_MIN_LEVEL_EXT     0x82DB
-#define GL_TEXTURE_VIEW_NUM_LEVELS_EXT    0x82DC
-#define GL_TEXTURE_VIEW_MIN_LAYER_EXT     0x82DD
-#define GL_TEXTURE_VIEW_NUM_LAYERS_EXT    0x82DE
-#define GL_TEXTURE_IMMUTABLE_LEVELS       0x82DF
-typedef void (GL_APIENTRYP PFNGLTEXTUREVIEWEXTPROC) (GLuint texture, GLenum target, GLuint origtexture, GLenum internalformat, GLuint minlevel, GLuint numlevels, GLuint minlayer, GLuint numlayers);
-#ifdef GL_GLEXT_PROTOTYPES
-GL_APICALL void GL_APIENTRY glTextureViewEXT (GLuint texture, GLenum target, GLuint origtexture, GLenum internalformat, GLuint minlevel, GLuint numlevels, GLuint minlayer, GLuint numlayers);
-#endif
-#endif /* GL_EXT_texture_view */
-
 #ifndef GL_EXT_unpack_subimage
 #define GL_EXT_unpack_subimage 1
 #define GL_UNPACK_ROW_LENGTH_EXT          0x0CF2

include/HaikuGL/OpenGLKit.h

@@ -7,4 +7,4 @@
 
 // Projects needing GL/glu.h and GL/glut.h should now
 // include these headers independently as glu and glut
-// are no longer core parts of mesa
+// are no longe core parts of mesa

include/VG/openvg.h

@@ -0,0 +1,746 @@
+/* $Revision: 9203 $ on $Date:: 2009-10-07 02:21:52 -0700 #$ */
+
+/*------------------------------------------------------------------------
+ *
+ * OpenVG 1.1 Reference Implementation
+ * -------------------------------------
+ *
+ * Copyright (c) 2008 The Khronos Group Inc.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and /or associated documentation files
+ * (the "Materials "), to deal in the Materials without restriction,
+ * including without limitation the rights to use, copy, modify, merge,
+ * publish, distribute, sublicense, and/or sell copies of the Materials,
+ * and to permit persons to whom the Materials are furnished to do so,
+ * subject to the following conditions: 
+ *
+ * The above copyright notice and this permission notice shall be included 
+ * in all copies or substantial portions of the Materials. 
+ *
+ * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+ * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+ * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
+ * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
+ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
+ * THE USE OR OTHER DEALINGS IN THE MATERIALS.
+ *
+ *//**
+ * \file
+ * \brief	OpenVG 1.1 API.
+ *//*-------------------------------------------------------------------*/
+
+#ifndef _OPENVG_H
+#define _OPENVG_H
+
+#include <VG/vgplatform.h>
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+#define OPENVG_VERSION_1_0		1
+#define OPENVG_VERSION_1_0_1	1
+#define OPENVG_VERSION_1_1		2
+
+#ifndef VG_MAXSHORT
+#define VG_MAXSHORT 0x7FFF
+#endif
+
+#ifndef VG_MAXINT
+#define VG_MAXINT 0x7FFFFFFF
+#endif
+
+#ifndef VG_MAX_ENUM
+#define VG_MAX_ENUM 0x7FFFFFFF
+#endif
+
+typedef VGuint VGHandle;
+
+typedef VGHandle VGPath;
+typedef VGHandle VGImage;
+typedef VGHandle VGMaskLayer;
+typedef VGHandle VGFont;
+typedef VGHandle VGPaint;
+
+#define VG_INVALID_HANDLE ((VGHandle)0)
+
+typedef enum {
+  VG_FALSE               = 0,
+  VG_TRUE                = 1,
+
+  VG_BOOLEAN_FORCE_SIZE  = VG_MAX_ENUM
+} VGboolean;
+
+typedef enum {
+  VG_NO_ERROR                                 = 0,
+  VG_BAD_HANDLE_ERROR                         = 0x1000,
+  VG_ILLEGAL_ARGUMENT_ERROR                   = 0x1001,
+  VG_OUT_OF_MEMORY_ERROR                      = 0x1002,
+  VG_PATH_CAPABILITY_ERROR                    = 0x1003,
+  VG_UNSUPPORTED_IMAGE_FORMAT_ERROR           = 0x1004,
+  VG_UNSUPPORTED_PATH_FORMAT_ERROR            = 0x1005,
+  VG_IMAGE_IN_USE_ERROR                       = 0x1006,
+  VG_NO_CONTEXT_ERROR                         = 0x1007,
+
+  VG_ERROR_CODE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGErrorCode;
+
+typedef enum {
+  /* Mode settings */
+  VG_MATRIX_MODE                              = 0x1100,
+  VG_FILL_RULE                                = 0x1101,
+  VG_IMAGE_QUALITY                            = 0x1102,
+  VG_RENDERING_QUALITY                        = 0x1103,
+  VG_BLEND_MODE                               = 0x1104,
+  VG_IMAGE_MODE                               = 0x1105,
+
+  /* Scissoring rectangles */
+  VG_SCISSOR_RECTS                            = 0x1106,
+
+  /* Color Transformation */
+  VG_COLOR_TRANSFORM                          = 0x1170,
+  VG_COLOR_TRANSFORM_VALUES                   = 0x1171,
+
+  /* Stroke parameters */
+  VG_STROKE_LINE_WIDTH                        = 0x1110,
+  VG_STROKE_CAP_STYLE                         = 0x1111,
+  VG_STROKE_JOIN_STYLE                        = 0x1112,
+  VG_STROKE_MITER_LIMIT                       = 0x1113,
+  VG_STROKE_DASH_PATTERN                      = 0x1114,
+  VG_STROKE_DASH_PHASE                        = 0x1115,
+  VG_STROKE_DASH_PHASE_RESET                  = 0x1116,
+
+  /* Edge fill color for VG_TILE_FILL tiling mode */
+  VG_TILE_FILL_COLOR                          = 0x1120,
+
+  /* Color for vgClear */
+  VG_CLEAR_COLOR                              = 0x1121,
+
+  /* Glyph origin */
+  VG_GLYPH_ORIGIN                             = 0x1122,
+
+  /* Enable/disable alpha masking and scissoring */
+  VG_MASKING                                  = 0x1130,
+  VG_SCISSORING                               = 0x1131,
+
+  /* Pixel layout information */
+  VG_PIXEL_LAYOUT                             = 0x1140,
+  VG_SCREEN_LAYOUT                            = 0x1141,
+
+  /* Source format selection for image filters */
+  VG_FILTER_FORMAT_LINEAR                     = 0x1150,
+  VG_FILTER_FORMAT_PREMULTIPLIED              = 0x1151,
+
+  /* Destination write enable mask for image filters */
+  VG_FILTER_CHANNEL_MASK                      = 0x1152,
+
+  /* Implementation limits (read-only) */
+  VG_MAX_SCISSOR_RECTS                        = 0x1160,
+  VG_MAX_DASH_COUNT                           = 0x1161,
+  VG_MAX_KERNEL_SIZE                          = 0x1162,
+  VG_MAX_SEPARABLE_KERNEL_SIZE                = 0x1163,
+  VG_MAX_COLOR_RAMP_STOPS                     = 0x1164,
+  VG_MAX_IMAGE_WIDTH                          = 0x1165,
+  VG_MAX_IMAGE_HEIGHT                         = 0x1166,
+  VG_MAX_IMAGE_PIXELS                         = 0x1167,
+  VG_MAX_IMAGE_BYTES                          = 0x1168,
+  VG_MAX_FLOAT                                = 0x1169,
+  VG_MAX_GAUSSIAN_STD_DEVIATION               = 0x116A,
+
+  VG_PARAM_TYPE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGParamType;
+
+typedef enum {
+  VG_RENDERING_QUALITY_NONANTIALIASED         = 0x1200,
+  VG_RENDERING_QUALITY_FASTER                 = 0x1201,
+  VG_RENDERING_QUALITY_BETTER                 = 0x1202, /* Default */
+
+  VG_RENDERING_QUALITY_FORCE_SIZE             = VG_MAX_ENUM
+} VGRenderingQuality;
+
+typedef enum {
+  VG_PIXEL_LAYOUT_UNKNOWN                     = 0x1300,
+  VG_PIXEL_LAYOUT_RGB_VERTICAL                = 0x1301,
+  VG_PIXEL_LAYOUT_BGR_VERTICAL                = 0x1302,
+  VG_PIXEL_LAYOUT_RGB_HORIZONTAL              = 0x1303,
+  VG_PIXEL_LAYOUT_BGR_HORIZONTAL              = 0x1304,
+
+  VG_PIXEL_LAYOUT_FORCE_SIZE                  = VG_MAX_ENUM
+} VGPixelLayout;
+
+typedef enum {
+  VG_MATRIX_PATH_USER_TO_SURFACE              = 0x1400,
+  VG_MATRIX_IMAGE_USER_TO_SURFACE             = 0x1401,
+  VG_MATRIX_FILL_PAINT_TO_USER                = 0x1402,
+  VG_MATRIX_STROKE_PAINT_TO_USER              = 0x1403,
+  VG_MATRIX_GLYPH_USER_TO_SURFACE             = 0x1404,
+
+  VG_MATRIX_MODE_FORCE_SIZE                   = VG_MAX_ENUM
+} VGMatrixMode;
+
+typedef enum {
+  VG_CLEAR_MASK                               = 0x1500,
+  VG_FILL_MASK                                = 0x1501,
+  VG_SET_MASK                                 = 0x1502,
+  VG_UNION_MASK                               = 0x1503,
+  VG_INTERSECT_MASK                           = 0x1504,
+  VG_SUBTRACT_MASK                            = 0x1505,
+
+  VG_MASK_OPERATION_FORCE_SIZE                = VG_MAX_ENUM
+} VGMaskOperation;
+
+#define VG_PATH_FORMAT_STANDARD 0
+
+typedef enum {
+  VG_PATH_DATATYPE_S_8                        =  0,
+  VG_PATH_DATATYPE_S_16                       =  1,
+  VG_PATH_DATATYPE_S_32                       =  2,
+  VG_PATH_DATATYPE_F                          =  3,
+
+  VG_PATH_DATATYPE_FORCE_SIZE                 = VG_MAX_ENUM
+} VGPathDatatype;
+
+typedef enum {
+  VG_ABSOLUTE                                 = 0,
+  VG_RELATIVE                                 = 1,
+
+  VG_PATH_ABS_REL_FORCE_SIZE                  = VG_MAX_ENUM
+} VGPathAbsRel;
+
+typedef enum {
+  VG_CLOSE_PATH                               = ( 0 << 1),
+  VG_MOVE_TO                                  = ( 1 << 1),
+  VG_LINE_TO                                  = ( 2 << 1),
+  VG_HLINE_TO                                 = ( 3 << 1),
+  VG_VLINE_TO                                 = ( 4 << 1),
+  VG_QUAD_TO                                  = ( 5 << 1),
+  VG_CUBIC_TO                                 = ( 6 << 1),
+  VG_SQUAD_TO                                 = ( 7 << 1),
+  VG_SCUBIC_TO                                = ( 8 << 1),
+  VG_SCCWARC_TO                               = ( 9 << 1),
+  VG_SCWARC_TO                                = (10 << 1),
+  VG_LCCWARC_TO                               = (11 << 1),
+  VG_LCWARC_TO                                = (12 << 1),
+
+  VG_PATH_SEGMENT_FORCE_SIZE                  = VG_MAX_ENUM
+} VGPathSegment;
+
+typedef enum {
+  VG_MOVE_TO_ABS                              = VG_MOVE_TO    | VG_ABSOLUTE,
+  VG_MOVE_TO_REL                              = VG_MOVE_TO    | VG_RELATIVE,
+  VG_LINE_TO_ABS                              = VG_LINE_TO    | VG_ABSOLUTE,
+  VG_LINE_TO_REL                              = VG_LINE_TO    | VG_RELATIVE,
+  VG_HLINE_TO_ABS                             = VG_HLINE_TO   | VG_ABSOLUTE,
+  VG_HLINE_TO_REL                             = VG_HLINE_TO   | VG_RELATIVE,
+  VG_VLINE_TO_ABS                             = VG_VLINE_TO   | VG_ABSOLUTE,
+  VG_VLINE_TO_REL                             = VG_VLINE_TO   | VG_RELATIVE,
+  VG_QUAD_TO_ABS                              = VG_QUAD_TO    | VG_ABSOLUTE,
+  VG_QUAD_TO_REL                              = VG_QUAD_TO    | VG_RELATIVE,
+  VG_CUBIC_TO_ABS                             = VG_CUBIC_TO   | VG_ABSOLUTE,
+  VG_CUBIC_TO_REL                             = VG_CUBIC_TO   | VG_RELATIVE,
+  VG_SQUAD_TO_ABS                             = VG_SQUAD_TO   | VG_ABSOLUTE,
+  VG_SQUAD_TO_REL                             = VG_SQUAD_TO   | VG_RELATIVE,
+  VG_SCUBIC_TO_ABS                            = VG_SCUBIC_TO  | VG_ABSOLUTE,
+  VG_SCUBIC_TO_REL                            = VG_SCUBIC_TO  | VG_RELATIVE,
+  VG_SCCWARC_TO_ABS                           = VG_SCCWARC_TO | VG_ABSOLUTE,
+  VG_SCCWARC_TO_REL                           = VG_SCCWARC_TO | VG_RELATIVE,
+  VG_SCWARC_TO_ABS                            = VG_SCWARC_TO  | VG_ABSOLUTE,
+  VG_SCWARC_TO_REL                            = VG_SCWARC_TO  | VG_RELATIVE,
+  VG_LCCWARC_TO_ABS                           = VG_LCCWARC_TO | VG_ABSOLUTE,
+  VG_LCCWARC_TO_REL                           = VG_LCCWARC_TO | VG_RELATIVE,
+  VG_LCWARC_TO_ABS                            = VG_LCWARC_TO  | VG_ABSOLUTE,
+  VG_LCWARC_TO_REL                            = VG_LCWARC_TO  | VG_RELATIVE,
+
+  VG_PATH_COMMAND_FORCE_SIZE                  = VG_MAX_ENUM
+} VGPathCommand;
+
+typedef enum {
+  VG_PATH_CAPABILITY_APPEND_FROM              = (1 <<  0),
+  VG_PATH_CAPABILITY_APPEND_TO                = (1 <<  1),
+  VG_PATH_CAPABILITY_MODIFY                   = (1 <<  2),
+  VG_PATH_CAPABILITY_TRANSFORM_FROM           = (1 <<  3),
+  VG_PATH_CAPABILITY_TRANSFORM_TO             = (1 <<  4),
+  VG_PATH_CAPABILITY_INTERPOLATE_FROM         = (1 <<  5),
+  VG_PATH_CAPABILITY_INTERPOLATE_TO           = (1 <<  6),
+  VG_PATH_CAPABILITY_PATH_LENGTH              = (1 <<  7),
+  VG_PATH_CAPABILITY_POINT_ALONG_PATH         = (1 <<  8),
+  VG_PATH_CAPABILITY_TANGENT_ALONG_PATH       = (1 <<  9),
+  VG_PATH_CAPABILITY_PATH_BOUNDS              = (1 << 10),
+  VG_PATH_CAPABILITY_PATH_TRANSFORMED_BOUNDS  = (1 << 11),
+  VG_PATH_CAPABILITY_ALL                      = (1 << 12) - 1,
+
+  VG_PATH_CAPABILITIES_FORCE_SIZE             = VG_MAX_ENUM
+} VGPathCapabilities;
+
+typedef enum {
+  VG_PATH_FORMAT                              = 0x1600,
+  VG_PATH_DATATYPE                            = 0x1601,
+  VG_PATH_SCALE                               = 0x1602,
+  VG_PATH_BIAS                                = 0x1603,
+  VG_PATH_NUM_SEGMENTS                        = 0x1604,
+  VG_PATH_NUM_COORDS                          = 0x1605,
+
+  VG_PATH_PARAM_TYPE_FORCE_SIZE               = VG_MAX_ENUM
+} VGPathParamType;
+
+typedef enum {
+  VG_CAP_BUTT                                 = 0x1700,
+  VG_CAP_ROUND                                = 0x1701,
+  VG_CAP_SQUARE                               = 0x1702,
+
+  VG_CAP_STYLE_FORCE_SIZE                     = VG_MAX_ENUM
+} VGCapStyle;
+
+typedef enum {
+  VG_JOIN_MITER                               = 0x1800,
+  VG_JOIN_ROUND                               = 0x1801,
+  VG_JOIN_BEVEL                               = 0x1802,
+
+  VG_JOIN_STYLE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGJoinStyle;
+
+typedef enum {
+  VG_EVEN_ODD                                 = 0x1900,
+  VG_NON_ZERO                                 = 0x1901,
+
+  VG_FILL_RULE_FORCE_SIZE                     = VG_MAX_ENUM
+} VGFillRule;
+
+typedef enum {
+  VG_STROKE_PATH                              = (1 << 0),
+  VG_FILL_PATH                                = (1 << 1),
+
+  VG_PAINT_MODE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGPaintMode;
+
+typedef enum {
+  /* Color paint parameters */
+  VG_PAINT_TYPE                               = 0x1A00,
+  VG_PAINT_COLOR                              = 0x1A01,
+  VG_PAINT_COLOR_RAMP_SPREAD_MODE             = 0x1A02,
+  VG_PAINT_COLOR_RAMP_PREMULTIPLIED           = 0x1A07,
+  VG_PAINT_COLOR_RAMP_STOPS                   = 0x1A03,
+
+  /* Linear gradient paint parameters */
+  VG_PAINT_LINEAR_GRADIENT                    = 0x1A04,
+
+  /* Radial gradient paint parameters */
+  VG_PAINT_RADIAL_GRADIENT                    = 0x1A05,
+
+  /* Pattern paint parameters */
+  VG_PAINT_PATTERN_TILING_MODE                = 0x1A06,
+
+  VG_PAINT_PARAM_TYPE_FORCE_SIZE              = VG_MAX_ENUM
+} VGPaintParamType;
+
+typedef enum {
+  VG_PAINT_TYPE_COLOR                         = 0x1B00,
+  VG_PAINT_TYPE_LINEAR_GRADIENT               = 0x1B01,
+  VG_PAINT_TYPE_RADIAL_GRADIENT               = 0x1B02,
+  VG_PAINT_TYPE_PATTERN                       = 0x1B03,
+
+  VG_PAINT_TYPE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGPaintType;
+
+typedef enum {
+  VG_COLOR_RAMP_SPREAD_PAD                    = 0x1C00,
+  VG_COLOR_RAMP_SPREAD_REPEAT                 = 0x1C01,
+  VG_COLOR_RAMP_SPREAD_REFLECT                = 0x1C02,
+
+  VG_COLOR_RAMP_SPREAD_MODE_FORCE_SIZE        = VG_MAX_ENUM
+} VGColorRampSpreadMode;
+
+typedef enum {
+  VG_TILE_FILL                                = 0x1D00,
+  VG_TILE_PAD                                 = 0x1D01,
+  VG_TILE_REPEAT                              = 0x1D02,
+  VG_TILE_REFLECT                             = 0x1D03,
+
+  VG_TILING_MODE_FORCE_SIZE                   = VG_MAX_ENUM
+} VGTilingMode;
+
+typedef enum {
+  /* RGB{A,X} channel ordering */
+  VG_sRGBX_8888                               =  0,
+  VG_sRGBA_8888                               =  1,
+  VG_sRGBA_8888_PRE                           =  2,
+  VG_sRGB_565                                 =  3,
+  VG_sRGBA_5551                               =  4,
+  VG_sRGBA_4444                               =  5,
+  VG_sL_8                                     =  6,
+  VG_lRGBX_8888                               =  7,
+  VG_lRGBA_8888                               =  8,
+  VG_lRGBA_8888_PRE                           =  9,
+  VG_lL_8                                     = 10,
+  VG_A_8                                      = 11,
+  VG_BW_1                                     = 12,
+  VG_A_1                                      = 13,
+  VG_A_4                                      = 14,
+
+  /* {A,X}RGB channel ordering */
+  VG_sXRGB_8888                               =  0 | (1 << 6),
+  VG_sARGB_8888                               =  1 | (1 << 6),
+  VG_sARGB_8888_PRE                           =  2 | (1 << 6),
+  VG_sARGB_1555                               =  4 | (1 << 6),
+  VG_sARGB_4444                               =  5 | (1 << 6),
+  VG_lXRGB_8888                               =  7 | (1 << 6),
+  VG_lARGB_8888                               =  8 | (1 << 6),
+  VG_lARGB_8888_PRE                           =  9 | (1 << 6),
+
+  /* BGR{A,X} channel ordering */
+  VG_sBGRX_8888                               =  0 | (1 << 7),
+  VG_sBGRA_8888                               =  1 | (1 << 7),
+  VG_sBGRA_8888_PRE                           =  2 | (1 << 7),
+  VG_sBGR_565                                 =  3 | (1 << 7),
+  VG_sBGRA_5551                               =  4 | (1 << 7),
+  VG_sBGRA_4444                               =  5 | (1 << 7),
+  VG_lBGRX_8888                               =  7 | (1 << 7),
+  VG_lBGRA_8888                               =  8 | (1 << 7),
+  VG_lBGRA_8888_PRE                           =  9 | (1 << 7),
+
+  /* {A,X}BGR channel ordering */
+  VG_sXBGR_8888                               =  0 | (1 << 6) | (1 << 7),
+  VG_sABGR_8888                               =  1 | (1 << 6) | (1 << 7),
+  VG_sABGR_8888_PRE                           =  2 | (1 << 6) | (1 << 7),
+  VG_sABGR_1555                               =  4 | (1 << 6) | (1 << 7),
+  VG_sABGR_4444                               =  5 | (1 << 6) | (1 << 7),
+  VG_lXBGR_8888                               =  7 | (1 << 6) | (1 << 7),
+  VG_lABGR_8888                               =  8 | (1 << 6) | (1 << 7),
+  VG_lABGR_8888_PRE                           =  9 | (1 << 6) | (1 << 7),
+
+  VG_IMAGE_FORMAT_FORCE_SIZE                  = VG_MAX_ENUM
+} VGImageFormat;
+
+typedef enum {
+  VG_IMAGE_QUALITY_NONANTIALIASED             = (1 << 0),
+  VG_IMAGE_QUALITY_FASTER                     = (1 << 1),
+  VG_IMAGE_QUALITY_BETTER                     = (1 << 2),
+
+  VG_IMAGE_QUALITY_FORCE_SIZE                 = VG_MAX_ENUM
+} VGImageQuality;
+
+typedef enum {
+  VG_IMAGE_FORMAT                             = 0x1E00,
+  VG_IMAGE_WIDTH                              = 0x1E01,
+  VG_IMAGE_HEIGHT                             = 0x1E02,
+
+  VG_IMAGE_PARAM_TYPE_FORCE_SIZE              = VG_MAX_ENUM
+} VGImageParamType;
+
+typedef enum {
+  VG_DRAW_IMAGE_NORMAL                        = 0x1F00,
+  VG_DRAW_IMAGE_MULTIPLY                      = 0x1F01,
+  VG_DRAW_IMAGE_STENCIL                       = 0x1F02,
+
+  VG_IMAGE_MODE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGImageMode;
+
+typedef enum {
+  VG_RED                                      = (1 << 3),
+  VG_GREEN                                    = (1 << 2),
+  VG_BLUE                                     = (1 << 1),
+  VG_ALPHA                                    = (1 << 0),
+
+  VG_IMAGE_CHANNEL_FORCE_SIZE                 = VG_MAX_ENUM
+} VGImageChannel;
+
+typedef enum {
+  VG_BLEND_SRC                                = 0x2000,
+  VG_BLEND_SRC_OVER                           = 0x2001,
+  VG_BLEND_DST_OVER                           = 0x2002,
+  VG_BLEND_SRC_IN                             = 0x2003,
+  VG_BLEND_DST_IN                             = 0x2004,
+  VG_BLEND_MULTIPLY                           = 0x2005,
+  VG_BLEND_SCREEN                             = 0x2006,
+  VG_BLEND_DARKEN                             = 0x2007,
+  VG_BLEND_LIGHTEN                            = 0x2008,
+  VG_BLEND_ADDITIVE                           = 0x2009,
+
+  VG_BLEND_MODE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGBlendMode;
+
+typedef enum {
+  VG_FONT_NUM_GLYPHS                          = 0x2F00,
+
+  VG_FONT_PARAM_TYPE_FORCE_SIZE               = VG_MAX_ENUM
+} VGFontParamType;
+
+typedef enum {
+  VG_IMAGE_FORMAT_QUERY                       = 0x2100,
+  VG_PATH_DATATYPE_QUERY                      = 0x2101,
+
+  VG_HARDWARE_QUERY_TYPE_FORCE_SIZE           = VG_MAX_ENUM
+} VGHardwareQueryType;
+
+typedef enum {
+  VG_HARDWARE_ACCELERATED                     = 0x2200,
+  VG_HARDWARE_UNACCELERATED                   = 0x2201,
+
+  VG_HARDWARE_QUERY_RESULT_FORCE_SIZE         = VG_MAX_ENUM
+} VGHardwareQueryResult;
+
+typedef enum {
+  VG_VENDOR                                   = 0x2300,
+  VG_RENDERER                                 = 0x2301,
+  VG_VERSION                                  = 0x2302,
+  VG_EXTENSIONS                               = 0x2303,
+
+  VG_STRING_ID_FORCE_SIZE                     = VG_MAX_ENUM
+} VGStringID;
+
+/* Function Prototypes */
+
+#ifndef VG_API_CALL
+#	error VG_API_CALL must be defined
+#endif
+
+#ifndef VG_API_ENTRY
+#   error VG_API_ENTRY must be defined 
+#endif
+
+#ifndef VG_API_EXIT
+#   error VG_API_EXIT must be defined 
+#endif
+
+VG_API_CALL VGErrorCode VG_API_ENTRY vgGetError(void) VG_API_EXIT;
+
+VG_API_CALL void VG_API_ENTRY vgFlush(void) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgFinish(void) VG_API_EXIT;
+
+/* Getters and Setters */
+VG_API_CALL void VG_API_ENTRY vgSetf (VGParamType type, VGfloat value) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSeti (VGParamType type, VGint value) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetfv(VGParamType type, VGint count,
+                         const VGfloat * values) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetiv(VGParamType type, VGint count,
+                         const VGint * values) VG_API_EXIT;
+
+VG_API_CALL VGfloat VG_API_ENTRY vgGetf(VGParamType type) VG_API_EXIT;
+VG_API_CALL VGint VG_API_ENTRY vgGeti(VGParamType type) VG_API_EXIT;
+VG_API_CALL VGint VG_API_ENTRY vgGetVectorSize(VGParamType type) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetfv(VGParamType type, VGint count, VGfloat * values) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetiv(VGParamType type, VGint count, VGint * values) VG_API_EXIT;
+
+VG_API_CALL void VG_API_ENTRY vgSetParameterf(VGHandle object,
+                                 VGint paramType,
+                                 VGfloat value) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetParameteri(VGHandle object,
+                                 VGint paramType,
+                                 VGint value) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetParameterfv(VGHandle object,
+                                  VGint paramType,
+                                  VGint count, const VGfloat * values) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetParameteriv(VGHandle object,
+                                  VGint paramType,
+                                  VGint count, const VGint * values) VG_API_EXIT;
+
+VG_API_CALL VGfloat VG_API_ENTRY vgGetParameterf(VGHandle object,
+                                    VGint paramType) VG_API_EXIT;
+VG_API_CALL VGint VG_API_ENTRY vgGetParameteri(VGHandle object,
+                                  VGint paramType);
+VG_API_CALL VGint VG_API_ENTRY vgGetParameterVectorSize(VGHandle object,
+                                           VGint paramType) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetParameterfv(VGHandle object,
+                                  VGint paramType,
+                                  VGint count, VGfloat * values) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetParameteriv(VGHandle object,
+                                  VGint paramType,
+                                  VGint count, VGint * values) VG_API_EXIT;
+
+/* Matrix Manipulation */
+VG_API_CALL void VG_API_ENTRY vgLoadIdentity(void) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgLoadMatrix(const VGfloat * m) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetMatrix(VGfloat * m) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgMultMatrix(const VGfloat * m) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgTranslate(VGfloat tx, VGfloat ty) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgScale(VGfloat sx, VGfloat sy) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgShear(VGfloat shx, VGfloat shy) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgRotate(VGfloat angle) VG_API_EXIT;
+
+/* Masking and Clearing */
+VG_API_CALL void VG_API_ENTRY vgMask(VGHandle mask, VGMaskOperation operation,
+                                     VGint x, VGint y,
+                                     VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgRenderToMask(VGPath path,
+                                            VGbitfield paintModes,
+                                            VGMaskOperation operation) VG_API_EXIT;
+VG_API_CALL VGMaskLayer VG_API_ENTRY vgCreateMaskLayer(VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDestroyMaskLayer(VGMaskLayer maskLayer) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgFillMaskLayer(VGMaskLayer maskLayer,
+                                             VGint x, VGint y,
+                                             VGint width, VGint height,
+                                             VGfloat value) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgCopyMask(VGMaskLayer maskLayer,
+                                        VGint dx, VGint dy,
+                                        VGint sx, VGint sy,
+                                        VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgClear(VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
+
+/* Paths */
+VG_API_CALL VGPath VG_API_ENTRY vgCreatePath(VGint pathFormat,
+                                VGPathDatatype datatype,
+                                VGfloat scale, VGfloat bias,
+                                VGint segmentCapacityHint,
+                                VGint coordCapacityHint,
+                                VGbitfield capabilities) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgClearPath(VGPath path, VGbitfield capabilities) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDestroyPath(VGPath path) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgRemovePathCapabilities(VGPath path,
+                                          VGbitfield capabilities) VG_API_EXIT;
+VG_API_CALL VGbitfield VG_API_ENTRY vgGetPathCapabilities(VGPath path) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgAppendPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgAppendPathData(VGPath dstPath,
+                                  VGint numSegments,
+                                  const VGubyte * pathSegments,
+                                  const void * pathData) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgModifyPathCoords(VGPath dstPath, VGint startIndex,
+                                    VGint numSegments,
+                                    const void * pathData) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgTransformPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT;
+VG_API_CALL VGboolean VG_API_ENTRY vgInterpolatePath(VGPath dstPath,
+                                        VGPath startPath,
+                                        VGPath endPath,
+                                        VGfloat amount) VG_API_EXIT;
+VG_API_CALL VGfloat VG_API_ENTRY vgPathLength(VGPath path,
+                                 VGint startSegment, VGint numSegments) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgPointAlongPath(VGPath path,
+                                  VGint startSegment, VGint numSegments,
+                                  VGfloat distance,
+                                  VGfloat * x, VGfloat * y,
+                                  VGfloat * tangentX, VGfloat * tangentY) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgPathBounds(VGPath path,
+                              VGfloat * minX, VGfloat * minY,
+                              VGfloat * width, VGfloat * height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgPathTransformedBounds(VGPath path,
+                                         VGfloat * minX, VGfloat * minY,
+                                         VGfloat * width, VGfloat * height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDrawPath(VGPath path, VGbitfield paintModes) VG_API_EXIT;
+
+/* Paint */
+VG_API_CALL VGPaint VG_API_ENTRY vgCreatePaint(void) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDestroyPaint(VGPaint paint) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetPaint(VGPaint paint, VGbitfield paintModes) VG_API_EXIT;
+VG_API_CALL VGPaint VG_API_ENTRY vgGetPaint(VGPaintMode paintMode) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetColor(VGPaint paint, VGuint rgba) VG_API_EXIT;
+VG_API_CALL VGuint VG_API_ENTRY vgGetColor(VGPaint paint) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgPaintPattern(VGPaint paint, VGImage pattern) VG_API_EXIT;
+
+/* Images */
+VG_API_CALL VGImage VG_API_ENTRY vgCreateImage(VGImageFormat format,
+                                  VGint width, VGint height,
+                                  VGbitfield allowedQuality) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDestroyImage(VGImage image) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgClearImage(VGImage image,
+                              VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgImageSubData(VGImage image,
+                                const void * data, VGint dataStride,
+                                VGImageFormat dataFormat,
+                                VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetImageSubData(VGImage image,
+                                   void * data, VGint dataStride,
+                                   VGImageFormat dataFormat,
+                                   VGint x, VGint y,
+                                   VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL VGImage VG_API_ENTRY vgChildImage(VGImage parent,
+                                 VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL VGImage VG_API_ENTRY vgGetParent(VGImage image) VG_API_EXIT; 
+VG_API_CALL void VG_API_ENTRY vgCopyImage(VGImage dst, VGint dx, VGint dy,
+                             VGImage src, VGint sx, VGint sy,
+                             VGint width, VGint height,
+                             VGboolean dither) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDrawImage(VGImage image) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetPixels(VGint dx, VGint dy,
+                             VGImage src, VGint sx, VGint sy,
+                             VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgWritePixels(const void * data, VGint dataStride,
+                               VGImageFormat dataFormat,
+                               VGint dx, VGint dy,
+                               VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetPixels(VGImage dst, VGint dx, VGint dy,
+                             VGint sx, VGint sy,
+                             VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgReadPixels(void * data, VGint dataStride,
+                              VGImageFormat dataFormat,
+                              VGint sx, VGint sy,
+                              VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgCopyPixels(VGint dx, VGint dy,
+                              VGint sx, VGint sy,
+                              VGint width, VGint height) VG_API_EXIT;
+
+/* Text */
+VG_API_CALL VGFont VG_API_ENTRY vgCreateFont(VGint glyphCapacityHint) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDestroyFont(VGFont font) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetGlyphToPath(VGFont font,
+                                              VGuint glyphIndex,
+                                              VGPath path,
+                                              VGboolean isHinted,
+                                              const VGfloat glyphOrigin [2],
+                                              const VGfloat escapement[2]) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetGlyphToImage(VGFont font,
+                                               VGuint glyphIndex,
+                                               VGImage image,
+                                               const VGfloat glyphOrigin [2],
+                                               const VGfloat escapement[2]) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgClearGlyph(VGFont font,VGuint glyphIndex) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDrawGlyph(VGFont font, 
+                                         VGuint glyphIndex,
+                                         VGbitfield paintModes,
+                                         VGboolean allowAutoHinting) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDrawGlyphs(VGFont font,
+                                          VGint glyphCount,
+                                          const VGuint *glyphIndices,
+                                          const VGfloat *adjustments_x,
+                                          const VGfloat *adjustments_y,
+                                          VGbitfield paintModes,
+                                          VGboolean allowAutoHinting) VG_API_EXIT;
+
+/* Image Filters */
+VG_API_CALL void VG_API_ENTRY vgColorMatrix(VGImage dst, VGImage src,
+                               const VGfloat * matrix) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgConvolve(VGImage dst, VGImage src,
+                            VGint kernelWidth, VGint kernelHeight,
+                            VGint shiftX, VGint shiftY,
+                            const VGshort * kernel,
+                            VGfloat scale,
+                            VGfloat bias,
+                            VGTilingMode tilingMode) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSeparableConvolve(VGImage dst, VGImage src,
+                                     VGint kernelWidth,
+                                     VGint kernelHeight,
+                                     VGint shiftX, VGint shiftY,
+                                     const VGshort * kernelX,
+                                     const VGshort * kernelY,
+                                     VGfloat scale,
+                                     VGfloat bias,
+                                     VGTilingMode tilingMode) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGaussianBlur(VGImage dst, VGImage src,
+                                VGfloat stdDeviationX,
+                                VGfloat stdDeviationY,
+                                VGTilingMode tilingMode) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgLookup(VGImage dst, VGImage src,
+                          const VGubyte * redLUT,
+                          const VGubyte * greenLUT,
+                          const VGubyte * blueLUT,
+                          const VGubyte * alphaLUT,
+                          VGboolean outputLinear,
+                          VGboolean outputPremultiplied) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgLookupSingle(VGImage dst, VGImage src,
+                                const VGuint * lookupTable,
+                                VGImageChannel sourceChannel,
+                                VGboolean outputLinear,
+                                VGboolean outputPremultiplied) VG_API_EXIT;
+
+/* Hardware Queries */
+VG_API_CALL VGHardwareQueryResult VG_API_ENTRY vgHardwareQuery(VGHardwareQueryType key,
+                                                  VGint setting) VG_API_EXIT;
+
+/* Renderer and Extension Information */
+VG_API_CALL const VGubyte * VG_API_ENTRY vgGetString(VGStringID name) VG_API_EXIT;
+
+#ifdef __cplusplus 
+} /* extern "C" */
+#endif
+
+#endif /* _OPENVG_H */

include/VG/vgext.h

@@ -0,0 +1,233 @@
+/* $Revision: 6810 $ on $Date:: 2008-10-29 07:31:37 -0700 #$ */
+
+/*------------------------------------------------------------------------
+ * 
+ * VG extensions Reference Implementation
+ * -------------------------------------
+ *
+ * Copyright (c) 2008 The Khronos Group Inc.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and /or associated documentation files
+ * (the "Materials "), to deal in the Materials without restriction,
+ * including without limitation the rights to use, copy, modify, merge,
+ * publish, distribute, sublicense, and/or sell copies of the Materials,
+ * and to permit persons to whom the Materials are furnished to do so,
+ * subject to the following conditions: 
+ *
+ * The above copyright notice and this permission notice shall be included 
+ * in all copies or substantial portions of the Materials. 
+ *
+ * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+ * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+ * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
+ * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
+ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
+ * THE USE OR OTHER DEALINGS IN THE MATERIALS.
+ *
+ *//**
+ * \file
+ * \brief	VG extensions
+ *//*-------------------------------------------------------------------*/
+
+
+
+#ifndef _VGEXT_H
+#define _VGEXT_H
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+#include <VG/openvg.h>
+#include <VG/vgu.h>
+
+#ifndef VG_API_ENTRYP
+#   define VG_API_ENTRYP VG_API_ENTRY*
+#endif
+
+#ifndef VGU_API_ENTRYP
+#   define VGU_API_ENTRYP VGU_API_ENTRY*
+#endif
+
+/*-------------------------------------------------------------------------------
+ * KHR extensions
+ *------------------------------------------------------------------------------*/
+
+typedef enum  {
+
+#ifndef VG_KHR_iterative_average_blur
+  VG_MAX_AVERAGE_BLUR_DIMENSION_KHR        = 0x116B,
+  VG_AVERAGE_BLUR_DIMENSION_RESOLUTION_KHR = 0x116C,
+  VG_MAX_AVERAGE_BLUR_ITERATIONS_KHR       = 0x116D,
+#endif
+
+  VG_PARAM_TYPE_KHR_FORCE_SIZE             = VG_MAX_ENUM
+} VGParamTypeKHR;
+
+#ifndef VG_KHR_EGL_image
+#define VG_KHR_EGL_image 1
+/* VGEGLImageKHR is an opaque handle to an EGLImage */
+typedef void* VGeglImageKHR; 
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL VGImage VG_API_ENTRY vgCreateEGLImageTargetKHR(VGeglImageKHR image);
+#endif
+typedef VGImage (VG_API_ENTRYP PFNVGCREATEEGLIMAGETARGETKHRPROC) (VGeglImageKHR image);
+
+#endif
+
+
+#ifndef VG_KHR_iterative_average_blur
+#define VG_KHR_iterative_average_blur 1
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL void vgIterativeAverageBlurKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
+#endif 
+typedef void (VG_API_ENTRYP PFNVGITERATIVEAVERAGEBLURKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
+
+#endif
+
+
+#ifndef VG_KHR_advanced_blending
+#define VG_KHR_advanced_blending 1
+
+typedef enum {
+  VG_BLEND_OVERLAY_KHR        = 0x2010,
+  VG_BLEND_HARDLIGHT_KHR      = 0x2011,
+  VG_BLEND_SOFTLIGHT_SVG_KHR  = 0x2012,
+  VG_BLEND_SOFTLIGHT_KHR      = 0x2013,
+  VG_BLEND_COLORDODGE_KHR     = 0x2014,
+  VG_BLEND_COLORBURN_KHR      = 0x2015,
+  VG_BLEND_DIFFERENCE_KHR     = 0x2016,
+  VG_BLEND_SUBTRACT_KHR       = 0x2017,
+  VG_BLEND_INVERT_KHR         = 0x2018,
+  VG_BLEND_EXCLUSION_KHR      = 0x2019,
+  VG_BLEND_LINEARDODGE_KHR    = 0x201a,
+  VG_BLEND_LINEARBURN_KHR     = 0x201b,
+  VG_BLEND_VIVIDLIGHT_KHR     = 0x201c,
+  VG_BLEND_LINEARLIGHT_KHR    = 0x201d,
+  VG_BLEND_PINLIGHT_KHR       = 0x201e,
+  VG_BLEND_HARDMIX_KHR        = 0x201f,
+  VG_BLEND_CLEAR_KHR          = 0x2020,
+  VG_BLEND_DST_KHR            = 0x2021,
+  VG_BLEND_SRC_OUT_KHR        = 0x2022,
+  VG_BLEND_DST_OUT_KHR        = 0x2023,
+  VG_BLEND_SRC_ATOP_KHR       = 0x2024,
+  VG_BLEND_DST_ATOP_KHR       = 0x2025,
+  VG_BLEND_XOR_KHR            = 0x2026,
+
+  VG_BLEND_MODE_KHR_FORCE_SIZE= VG_MAX_ENUM
+} VGBlendModeKHR;
+#endif
+
+#ifndef VG_KHR_parametric_filter
+#define VG_KHR_parametric_filter 1 
+
+typedef enum {
+  VG_PF_OBJECT_VISIBLE_FLAG_KHR = (1 << 0),
+  VG_PF_KNOCKOUT_FLAG_KHR       = (1 << 1),
+  VG_PF_OUTER_FLAG_KHR          = (1 << 2),
+  VG_PF_INNER_FLAG_KHR          = (1 << 3),
+
+  VG_PF_TYPE_KHR_FORCE_SIZE     = VG_MAX_ENUM
+} VGPfTypeKHR;
+
+typedef enum {
+  VGU_IMAGE_IN_USE_ERROR           = 0xF010,
+
+  VGU_ERROR_CODE_KHR_FORCE_SIZE    = VG_MAX_ENUM
+} VGUErrorCodeKHR;
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL void VG_API_ENTRY vgParametricFilterKHR(VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguDropShadowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA) ;
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
+#endif
+typedef void (VG_API_ENTRYP PFNVGPARAMETRICFILTERKHRPROC) (VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUDROPSHADOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
+
+#endif
+
+
+/*-------------------------------------------------------------------------------
+ * NDS extensions
+ *------------------------------------------------------------------------------*/
+
+#ifndef VG_NDS_paint_generation
+#define VG_NDS_paint_generation 1
+
+typedef enum { 
+  VG_PAINT_COLOR_RAMP_LINEAR_NDS            = 0x1A10,
+  VG_COLOR_MATRIX_NDS                       = 0x1A11,
+  VG_PAINT_COLOR_TRANSFORM_LINEAR_NDS       = 0x1A12,
+
+  VG_PAINT_PARAM_TYPE_NDS_FORCE_SIZE        = VG_MAX_ENUM
+} VGPaintParamTypeNds;
+
+typedef enum {
+  VG_DRAW_IMAGE_COLOR_MATRIX_NDS            = 0x1F10,
+
+  VG_IMAGE_MODE_NDS_FORCE_SIZE              = VG_MAX_ENUM
+} VGImageModeNds;
+#endif 
+
+
+#ifndef VG_NDS_projective_geometry
+#define VG_NDS_projective_geometry 1
+
+typedef enum {
+  VG_CLIP_MODE_NDS                          = 0x1180,
+  VG_CLIP_LINES_NDS                         = 0x1181,
+  VG_MAX_CLIP_LINES_NDS                     = 0x1182,
+
+  VG_PARAM_TYPE_NDS_FORCE_SIZE        = VG_MAX_ENUM
+} VGParamTypeNds;
+
+typedef enum {
+  VG_CLIPMODE_NONE_NDS                      = 0x3000,
+  VG_CLIPMODE_CLIP_CLOSED_NDS               = 0x3001,
+  VG_CLIPMODE_CLIP_OPEN_NDS                 = 0x3002,
+  VG_CLIPMODE_CULL_NDS                      = 0x3003,
+
+  VG_CLIPMODE_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGClipModeNds;
+
+typedef enum {
+  VG_RQUAD_TO_NDS              = ( 13 << 1 ),
+  VG_RCUBIC_TO_NDS             = ( 14 << 1 ),
+  
+  VG_PATH_SEGMENT_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGPathSegmentNds;
+
+typedef enum {
+  VG_RQUAD_TO_ABS_NDS            = (VG_RQUAD_TO_NDS  | VG_ABSOLUTE),
+  VG_RQUAD_TO_REL_NDS            = (VG_RQUAD_TO_NDS  | VG_RELATIVE),
+  VG_RCUBIC_TO_ABS_NDS           = (VG_RCUBIC_TO_NDS | VG_ABSOLUTE),
+  VG_RCUBIC_TO_REL_NDS           = (VG_RCUBIC_TO_NDS | VG_RELATIVE),
+
+  VG_PATH_COMMAND_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGPathCommandNds;
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL void VG_API_ENTRY vgProjectiveMatrixNDS(VGboolean enable) ;
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguTransformClipLineNDS(const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
+#endif 
+typedef void (VG_API_ENTRYP PFNVGPROJECTIVEMATRIXNDSPROC) (VGboolean enable) ;
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUTRANSFORMCLIPLINENDSPROC) (const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
+
+#endif
+
+#ifdef __cplusplus 
+} /* extern "C" */
+#endif
+
+#endif /* _VGEXT_H */

include/VG/vgplatform.h

@@ -0,0 +1,92 @@
+/* $Revision: 6810 $ on $Date:: 2008-10-29 07:31:37 -0700 #$ */
+
+/*------------------------------------------------------------------------
+ *
+ * VG platform specific header Reference Implementation
+ * ----------------------------------------------------
+ *
+ * Copyright (c) 2008 The Khronos Group Inc.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and /or associated documentation files
+ * (the "Materials "), to deal in the Materials without restriction,
+ * including without limitation the rights to use, copy, modify, merge,
+ * publish, distribute, sublicense, and/or sell copies of the Materials,
+ * and to permit persons to whom the Materials are furnished to do so,
+ * subject to the following conditions: 
+ *
+ * The above copyright notice and this permission notice shall be included 
+ * in all copies or substantial portions of the Materials. 
+ *
+ * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+ * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+ * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
+ * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
+ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
+ * THE USE OR OTHER DEALINGS IN THE MATERIALS.
+ *
+ *//**
+ * \file
+ * \brief VG platform specific header
+ *//*-------------------------------------------------------------------*/
+
+#ifndef _VGPLATFORM_H
+#define _VGPLATFORM_H
+
+#include <KHR/khrplatform.h>
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+#ifndef VG_API_CALL 
+#if defined(OPENVG_STATIC_LIBRARY)
+#	define VG_API_CALL
+#else
+#	define VG_API_CALL KHRONOS_APICALL
+#endif /* defined OPENVG_STATIC_LIBRARY */
+#endif /* ifndef VG_API_CALL */
+
+#ifndef VGU_API_CALL 
+#if defined(OPENVG_STATIC_LIBRARY)
+#	define VGU_API_CALL
+#else
+#	define VGU_API_CALL KHRONOS_APICALL
+#endif /* defined OPENVG_STATIC_LIBRARY */
+#endif /* ifndef VGU_API_CALL */
+
+
+#ifndef VG_API_ENTRY
+#define VG_API_ENTRY
+#endif
+
+#ifndef VG_API_EXIT
+#define VG_API_EXIT
+#endif
+
+#ifndef VGU_API_ENTRY
+#define VGU_API_ENTRY
+#endif
+
+#ifndef VGU_API_EXIT
+#define VGU_API_EXIT
+#endif
+
+typedef float          VGfloat;
+typedef signed char    VGbyte;
+typedef unsigned char  VGubyte;
+typedef signed short   VGshort;
+typedef signed int     VGint;
+typedef unsigned int   VGuint;
+typedef unsigned int   VGbitfield;
+
+#ifndef VG_VGEXT_PROTOTYPES
+#define VG_VGEXT_PROTOTYPES
+#endif 
+
+#ifdef __cplusplus 
+} /* extern "C" */
+#endif
+
+#endif /* _VGPLATFORM_H */

include/VG/vgu.h

@@ -0,0 +1,131 @@
+/* $Revision: 6810 $ on $Date:: 2008-10-29 07:31:37 -0700 #$ */
+
+/*------------------------------------------------------------------------
+ * 
+ * VGU 1.1 Reference Implementation
+ * -------------------------------------
+ *
+ * Copyright (c) 2008 The Khronos Group Inc.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and /or associated documentation files
+ * (the "Materials "), to deal in the Materials without restriction,
+ * including without limitation the rights to use, copy, modify, merge,
+ * publish, distribute, sublicense, and/or sell copies of the Materials,
+ * and to permit persons to whom the Materials are furnished to do so,
+ * subject to the following conditions: 
+ *
+ * The above copyright notice and this permission notice shall be included 
+ * in all copies or substantial portions of the Materials. 
+ *
+ * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+ * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+ * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
+ * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
+ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
+ * THE USE OR OTHER DEALINGS IN THE MATERIALS.
+ *
+ *//**
+ * \file
+ * \brief	VGU 1.1 API.
+ *//*-------------------------------------------------------------------*/
+
+#ifndef _VGU_H
+#define _VGU_H
+
+#ifdef __cplusplus 
+extern "C" { 
+#endif
+
+#include <VG/openvg.h>
+
+#define VGU_VERSION_1_0 1
+#define VGU_VERSION_1_1 2
+
+#ifndef VGU_API_CALL
+#	error VGU_API_CALL must be defined
+#endif
+
+#ifndef VGU_API_ENTRY
+#   error VGU_API_ENTRY must be defined 
+#endif
+
+#ifndef VGU_API_EXIT
+#   error VGU_API_EXIT must be defined 
+#endif
+
+
+typedef enum {
+  VGU_NO_ERROR                                 = 0,
+  VGU_BAD_HANDLE_ERROR                         = 0xF000,
+  VGU_ILLEGAL_ARGUMENT_ERROR                   = 0xF001,
+  VGU_OUT_OF_MEMORY_ERROR                      = 0xF002,
+  VGU_PATH_CAPABILITY_ERROR                    = 0xF003,
+  VGU_BAD_WARP_ERROR                           = 0xF004,
+
+  VGU_ERROR_CODE_FORCE_SIZE                    = VG_MAX_ENUM
+} VGUErrorCode;
+
+typedef enum {
+  VGU_ARC_OPEN                                 = 0xF100,
+  VGU_ARC_CHORD                                = 0xF101,
+  VGU_ARC_PIE                                  = 0xF102,
+
+  VGU_ARC_TYPE_FORCE_SIZE                      = VG_MAX_ENUM
+} VGUArcType;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguLine(VGPath path,
+                                  VGfloat x0, VGfloat y0,
+                                  VGfloat x1, VGfloat y1) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguPolygon(VGPath path,
+                                     const VGfloat * points, VGint count,
+                                     VGboolean closed) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguRect(VGPath path,
+                                  VGfloat x, VGfloat y,
+                                  VGfloat width, VGfloat height) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguRoundRect(VGPath path,
+                                       VGfloat x, VGfloat y,
+                                       VGfloat width, VGfloat height,
+                                       VGfloat arcWidth, VGfloat arcHeight) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguEllipse(VGPath path,
+                                     VGfloat cx, VGfloat cy,
+                                     VGfloat width, VGfloat height) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguArc(VGPath path,
+                                 VGfloat x, VGfloat y,
+                                 VGfloat width, VGfloat height,
+                                 VGfloat startAngle, VGfloat angleExtent,
+                                 VGUArcType arcType) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpQuadToSquare(VGfloat sx0, VGfloat sy0,
+                                                     VGfloat sx1, VGfloat sy1,
+                                                     VGfloat sx2, VGfloat sy2,
+                                                     VGfloat sx3, VGfloat sy3,
+                                                     VGfloat * matrix) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpSquareToQuad(VGfloat dx0, VGfloat dy0,
+                                                     VGfloat dx1, VGfloat dy1,
+                                                     VGfloat dx2, VGfloat dy2,
+                                                     VGfloat dx3, VGfloat dy3,
+                                                     VGfloat * matrix) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpQuadToQuad(VGfloat dx0, VGfloat dy0,
+                                                   VGfloat dx1, VGfloat dy1,
+                                                   VGfloat dx2, VGfloat dy2,
+                                                   VGfloat dx3, VGfloat dy3,
+                                                   VGfloat sx0, VGfloat sy0,
+                                                   VGfloat sx1, VGfloat sy1,
+                                                   VGfloat sx2, VGfloat sy2,
+                                                   VGfloat sx3, VGfloat sy3,
+                                                   VGfloat * matrix) VGU_API_EXIT;
+
+#ifdef __cplusplus 
+} /* extern "C" */
+#endif
+
+#endif /* #ifndef _VGU_H */

include/c11/threads_posix.h

@@ -177,8 +177,13 @@ mtx_init(mtx_t *mtx, int type)
       && type != (mtx_try|mtx_recursive))
         return thrd_error;
     pthread_mutexattr_init(&attr);
-    if ((type & mtx_recursive) != 0)
+    if ((type & mtx_recursive) != 0) {
+#if defined(__linux__) || defined(__linux)
+        pthread_mutexattr_settype(&attr, PTHREAD_MUTEX_RECURSIVE_NP);
+#else
         pthread_mutexattr_settype(&attr, PTHREAD_MUTEX_RECURSIVE);
+#endif
+    }
     pthread_mutex_init(mtx, &attr);
     pthread_mutexattr_destroy(&attr);
     return thrd_success;

include/c11/threads_win32.h

@@ -296,7 +296,7 @@ static void impl_tss_dtor_invoke()
 static inline void
 call_once(once_flag *flag, void (*func)(void))
 {
-    assert(flag && func);
+    assert(!flag && !func);
 #ifdef EMULATED_THREADS_USE_NATIVE_CALL_ONCE
     {
     struct impl_call_once_param param;

include/c99/stdbool.h

@@ -35,7 +35,8 @@
 #define bool    _Bool
 
 /* For compilers that don't have the builtin _Bool type. */
-#if (defined(_MSC_VER) && _MSC_VER < 1800)
+#if (defined(_MSC_VER) && _MSC_VER < 1800) || \
+    (defined __GNUC__&& __STDC_VERSION__ < 199901L && __GNUC__ < 3)
 typedef unsigned char _Bool;
 #endif